WorldWideScience

Sample records for aberto ao ar

  1. Fatores ambientais sobre a idade ao primeiro parto, dias abertos e intervalo entre partos em vacas da raça holandesa na Bacia Leiteira de Castrolanda, estado do Paraná

    Wolff, Maria Cândida Córdova

    2012-01-01

    Dados provenientes do Programa de Análises de Rebanhos Leiteiros do Paraná (PARLPR) da Associação Paranaense de Criadores de Bovinos Leiteiros da Raça Holandesa (APCBRH) foram analisados para estudar os fatores do meio ambiente (rebanho, ano de parto, mês de parto, grupo genético, idade ao parto e efeito vaca) que estariam influenciando as características reprodutivas: idade ao primeiro parto (IPP) em meses, .dias abertos (DA) e intervalo entre partos (IEP) em dias, nas vacas da raça Holandes...

  2. EFEITOS DO CAPITAL INTELECTUAL SOBRE O DESEMPENHO FINANCEIRO EM COMPANHIAS DE CAPITAL ABERTO

    Maria Margarete Baccin Brizolla; Salete Turra

    2015-01-01

    O objetivo deste estudo foi identificar a influência do Capital Intelectual, medido pelo Valor agregado do Capital Intelectual (VACI) sobre o desempenho financeiro em companhias de capital aberto. A classificação do estudo no que se refere aos objetivos é uma pesquisa descritiva, em relação aos procedimentos classifica-se como documental e a abordagem refere-se à análise quantitativa. A investigação que permeia este estudo envolve as características relacionadas ao capital inte...

  3. Teste de provocação oral aberto na confirmação de alergia ao leite de vaca mediada por IgE: qual seu valor na prática clínica? Open oral food challenge in the confirmation of cow's milk allergy mediated by IgE: what is its value in the clinical practice?

    Raquel Bicudo Mendonça

    2011-09-01

    Full Text Available OBJETIVO: Revisar os principais protocolos de padronização para o teste de provocação oral aberto aplicado a crianças com suspeita de alergia ao leite de vaca mediada por imunoglobulina E. FONTES DE DADOS: Foram selecionados artigos publicados, nos últimos dez anos, nas bases de dados Medline, Lilacs e SciELO, utilizando-se os descritores de assunto: "hipersensibilidade alimentar", "leite de vaca", "alergia ao leite de vaca", "teste de provocação oral", "crianças" e "diagnóstico". SÍNTESE DOS DADOS: O teste de provocação oral é o método mais fidedigno para estabelecer ou excluir o diagnóstico de alergia alimentar e sua forma aberta pode ser a primeira opção, quando apenas reações objetivas são esperadas. O local para realizar o teste deve possuir todos os recursos para tratamento de emergência. Como preparo, o paciente deve seguir dieta de exclusão do alimento suspeito e descontinuar o uso de medicamentos que possam interferir no resultado do teste. Habitualmente, utilizam-se 8 a 10g de leite em pó ou 100mL de leite fluido, oferecidos em volumes progressivos, a intervalos de dez a 60 minutos. Apesar da rigidez do método, ainda existem situações em que há dificuldade de interpretação dos resultados; por isso, médicos bem treinados devem aplicar o teste, sendo cautelosos ao julgarem as reações. CONCLUSÕES: Mesmo considerando as limitações que dificultam a aplicação do teste de provocação oral na prática clínica, a implementação do teste nos serviços de saúde poderia reduzir diagnósticos falsos-positivos de alergias.OBJECTIVE: To review the main standardization protocols of the open oral food challenge applied to children with suspicion of cow's milk allergy mediated by immunoglobulin E. DATA SOURCE: Medline, Lilacs and SciELO databases were searched for articles published in the last ten years using the following descriptors: "food hypersensitivity", "cow's milk", "cow's milk allergy", "oral food

  4. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Solange Diccini

    1999-12-01

    Full Text Available No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp-Hospital São Paulo, no período de julho de 1995 a fevereiro de 1997. TIPO DE ESTUDO: Aberto, randomizado, paralelo. Alta da emergência determinada pelo VEF1 e PFE > 60% do previsto. CASUÍSTICA E MÉTODOS: Cento e vinte pacientes em crise de asma foram divididos em dois grupos (N = 60: fenoterol (F e brometo de ipratrópio + fenoterol (BIF com VEF1 e PFE Repeated dosis of inhaled b2-agonists have been used in the treatment of acute asthma. The effect of added ipratropium bromide (IB to b2-agonist is controversial in adults. OBJECTIVE: To evaluate if addition of IB to fenoterol, in repeated doses, induces a greater bronchodilation, a greater reversion of the attack, and discharge from emergency unit in adults with acute severe asthma. SETTING: Pneumology Emergency Department, Unifesp-Hospital São Paulo, in the period from July 1995 to February 1997. TYPE OF STUDY: Open, randomized and parallel study. Discharge from the hospital: FEV1 and PEF > 60% of the predicted value. METHODS: 120 patients with FEV1 and PEF < 50% of the predicted value were divided into two groups (N = 60: fenoterol (F and ipratropium bromide + fenoterol (IBF. Each group received inhalation treatment through a metered-dose inhaler (MDI attached to a holding chamber, administered at 30-minute interval, for a total of three treatments. In the group F four puffs of fenoterol (400 mg were administered, and in the IBF group, 160 mg of BI and 400 mg of fenoterol (four puffs

  5. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    Rogério Atem de Carvalho

    2009-12-01

    Full Text Available Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP. Porém verifica-se que este tipo de sistema ainda não é suficientemente explorado, mesmo no meio acadêmico. Este artigo relata alguns trabalhos publicados sobre o assunto e levanta questões que devem ser tratadas por pesquisadores e demais interessados para adequar e viabilizar o uso desses sistemas conforme a realidade nacional. Assim, após uma introdução ao tema, são apresentadas algumas diferenças entre o FOS-ERP e seus equivalentes proprietários (Proprietary ERP ou P-ERP em termos de modelos de negócios, seleção, customização e evolução. Em seguida são elencados alguns desafios e oportunidades que o FOS-ERP pode oferecer a usuários, fornecedores, pesquisadores e colaboradores individuais. Concluindo, este artigo busca ampliar a discussão sobre FOS-ERP, destacando fatores tais como seu potencial de inovação tecnológica e estratégias de negócios.Enterprise Resources Planning (ERP enables the processing of information required in an enterprise, using a single database. Much has been written about this type of software, addressing issues such as the high cost of licenses acquisitions, and the dependence on consultants for its adaptation and implementation in companies. Currently the development and use of ERP Free Open Source (FOS-ERP has increased. However, this type of system is still not sufficiently explored, even in academia. This article analyses some papers on the subject, and raises questions that must be addressed by researchers and other stakeholders

  6. A eficácia do milnaciprano em pacientes ambulatoriais com transtorno depressivo maior não respondedores ao tratamento com ISRSs: um estudo aberto de 12 semanas Efficacy of milnacipran in outpatients experiencing major depression non respondent to SSRIs: a 12-week open study

    Marcelo P. Fleck

    2010-01-01

    Full Text Available CONTEXTO: O objetivo deste estudo é avaliar a eficácia do milnaciprano em pacientes ambulatoriais com depressão maior grave que não respondem em tempo e em dosagem adequados à terapia com ISRSs. MÉTODOS: Um estudo aberto multicêntrico com a duração de 12 semanas foi elaborado para avaliar a eficácia do milnaciprano após falha em um experimento com ISRS. Remissão completa (HAMD-17 50%, CGI e avaliação da qualidade de vida (WHOQOL-Bref. RESULTADOS: O escore HAMD-17 médio da amostra foi de 27 (7,2. As taxas de remissão com o milnaciprano foram de 17,5%, e as de resposta, 61,3%. Na linha de base, 70,9% dos pacientes foram classificados como gravemente sintomáticos. Ao final do tratamento, 48,1% dos pacientes foram classificados como normais assintomáticos ou sintomáticos limítrofes e 20,2% eram moderadamente sintomáticos. Além disso, os quatro domínios do WHOQOL-Bref, um instrumento genérico de mensuração de qualidade de vida, apresentou diferenças clínicas e estatísticas: CONCLUSÃO: Nossos resultados sugerem que o milnaciprano é uma possível opção para pacientes que não respondem a ISRSs. Uma vez que não há evidências na literatura de um antidepressivo que seja a melhor opção quando um ISRS falha, o uso do milnaciprano deveria ser considerado em casos de pacientes com depressão severa.BACKGROUND: The objective of this study is to evaluate the efficacy of milnacipran in outpatients experiencing severe MDD non-respondent to adequate time and dosing of SSRI therapy. METHODS: A 12 week multi-centric study open study was designed to evaluate the efficacy of milnacipran after a SRRI trial failure. Complete remission (HAMD-17 50%, CGI and quality of life measure (WHOQOL-Bref. RESULTS: The mean HAMD-17 score of the sample was 27 (7.2. The remission rates for minalcipran were 17.5% and response 61.3%. At baseline, 70.9% of the patients were markedly or severely ill. At treatment end, 48.1% of the patients were normal

  7. EFEITOS DO CAPITAL INTELECTUAL SOBRE O DESEMPENHO FINANCEIRO EM COMPANHIAS DE CAPITAL ABERTO

    Maria Margarete Baccin Brizolla

    2015-06-01

    Full Text Available O objetivo deste estudo foi identificar a influência do Capital Intelectual, medido pelo Valor agregado do Capital Intelectual (VACI sobre o desempenho financeiro em companhias de capital aberto. A classificação do estudo no que se refere aos objetivos é uma pesquisa descritiva, em relação aos procedimentos classifica-se como documental e a abordagem refere-se à análise quantitativa. A investigação que permeia este estudo envolve as características relacionadas ao capital intelectual, em 166 companhias listadas na BM&FBovespa, compondo a amostra no período de 2013. Os dados foram coletados na base de dados Economática®. Quanto à técnica estatística foi utilizada a Correlação Canônica. Os resultados da pesquisa demonstram que o capital intelectual influência significativamente o desempenho financeiro, em companhias de capital aberto.

  8. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    Rogério Atem de Carvalho; Renato Campos

    2009-01-01

    Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP). Porém verifica-se que este tipo de sistem...

  9. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Solange Diccini; Clystenes Odyr Soares Silva; Jorge Nakatani; Carlos Alberto de Castro Pereira

    1999-01-01

    No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI) ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp...

  10. Processing and extracting data from Dicionário Aberto

    Simões, Alberto; Almeida, J. J.; Farinha, Rita

    2010-01-01

    Synonyms dictionaries are useful resources for natural language processing. Unfortunately their availability in digital format is limited, as publishing companies do not release their dictionaries in open digital formats. Dicionário-Aberto is an open and free digital synonyms dictionary for the Portuguese language. It is under public domain which makes it usable for any task. Synonyms dictionaries are commonly used for the extraction of relations between words, constructing structures similar...

  11. Determinação analítica da performance da irrigação por sulcos abertos e em declive

    Aristides Fraga Lima Filho

    2015-06-01

    Full Text Available Uma solução analítica foi desenvolvida, para avaliar sulcos abertos e em declive, com base na teoria de Balanço de Volume de Walker e Skogerboe (1987. Essa metodologia é capaz de obter, matematicamente, a performance de um sistema, dispensando a construção de gráficos que definem os parâmetros de avaliação. A solução matemática é baseada no ajuste de equações ao modelo potencial, no cálculo das áreas sob as curvas definidas no ajuste e na intercessão de curvas, obtendo-se, assim, a performance de sistemas de irrigação por sulcos abertos e em declive. Para validação da metodologia, foi realizado um experimento de campo, na Fazenda Experimental da Universidade Federal do Ceará, situada no município de Pentecoste, pertencente ao Centro de Ciências Agrárias. Os dados de campo foram submetidos à análise pelas duas metodologias. Os resultados mostraram que a metodologia analítica pode ser usada para avaliar a irrigação por sulcos abertos e em declive.

  12. Educação ao ar livre pela aventura: o aprendizado de valores morais em expedições à natureza Education outdoors through adventure: learning moral values in nature expeditions

    Flavio Theodor Kunreuther

    2012-06-01

    Full Text Available A educação ao ar livre, por meio de cursos no formato expedição, ainda acontece de forma tímida no Brasil. Entende-se por expedição uma experiência educacional contínua, de múltiplos dias, em que alunos e instrutores aventuram-se em um trajeto em área remota da natureza de forma autossuficiente. O presente estudo analisa os cursos desse tipo. Por meio de entrevistas e questionários semiestruturados, investigou-se a aprendizagem dos alunos segundo suas próprias percepções e as dos educadores da instituição, com ênfase no desenvolvimento moral do indivíduo. Como parte do estudo de caso sobre um aluno adolescente participante de um dos cursos, entrevistou-se também uma psicóloga que coordena um abrigo para menores. Os resultados encontrados indicam que os cursos de educação ao ar livre caracterizam-se por experiências que estimulam trabalhos em grupo, debates sobre justiça e solidariedade, e reflexões sobre valores e princípios como coragem, esforço pessoal, disciplina, respeito e superação de limites. Os resultados também indicam que tal proposta educacional aufere experiências sensíveis e de conexão do ser humano com a natureza. Muito embora haja potencial educacional para a educação ao ar livre, a atuação do educador perante seus alunos é fundamental para que as experiências sejam física e psicologicamente seguras, alcancem seus potenciais pedagógicos de desenvolvimento da moralidade e ajudem as pessoas a desenvolverem uma consciência ambiental, manifestada por meio de ações concretas ao retornarem dos cursos para suas comunidades.Open air education through courses organized as expeditions is still incipient in Brazil. We understand an expedition as a continued educational experience taking several days in which students and instructors venture into a remote natural area in a self-sufficient way. The present study analyzes courses of this type. Using interviews and semi-structured questionnaires, it

  13. Julgamento de colinearidade e percepção de distância exocêntrica em campo aberto

    Javier Enrique Santillán

    2011-01-01

    Full Text Available O propósito foi investigar experimentalmente o desempenho dos observadores numa original tarefa de julgamento de colinearidade em campo aberto (dimensões 20 x 30 m. Participaram do experimento 30 observadores. Os estímulos foram estacas verticais de alturas variáveis, quatro fixos e quatro móveis. A tarefa consistiu em ajustar os dois estímulos móveis (mediante controle à distância para que ficassem colineares aos dos estímulos fixos nos extremos de cada diagonal. Foi realizada uma análise de variância (ANOVA fatorial sobre os erros de colinearidade, revelando somente efeito significativo para o fator ‘Estímulo Móvel’ (F(3,473=69,86 p<0,001 notando-se uma sistemática na distribuição dos erros. As pequenas variações na distância exocêntrica percebida (com erros constantes dez vezes menores que os encontrados ao avaliar as distâncias egocêntricas e a relação dos erros cometidos com as distâncias egocêntricas indicariam que o marco de referência eliciado por esta tarefa de colinearidade, embora possa estar baseado nos indícios exocêntricos, é escalado por um fator egocêntrico.

  14. Otimização econômica de explotações a céu aberto

    Frederico Augusto Rosa do Carmo

    2006-09-01

    Full Text Available A determinação dos limites da cava final de qualquer projeto de mineração é um dos maiores desafios de um projeto de mineração. Tais limites precisam ser definidos já no início dos trabalhos de planejamento de lavra e devem ser reconsiderados, novamente e rotineiramente, durante toda a vida útil da mina. Um dos propósitos do plano de exaustão de minas a céu aberto é determinar a cava final ótima, baseando-se em um modelo econômico sujeito a restrições técnicas e visando à maximização do valor atual líquido do projeto. O primeiro algoritmo específico relacionado ao tema foi publicado por Lerchs e Grossmann (1965. O algoritmo de Lerchs e Grossmann tem sido aceito como padrão de teste em comparação com outros algoritmos equivalentes, que têm sido propostos, porque ele resolve o problema correspondente, segundo a teoria dos grafos, ao corte mínimo e fluxo máximo. Outros algoritmos de otimização de cavas finais de minas a céu aberto também são apresentados nesse trabalho. Além disto, um programa acadêmico para a otimização de cavas foi desenvolvido pelos autores sendo que os fundamentos deste são apresentados no presente artigo.The determination of the final pit limits of any mining project is one of the most important challenges in a mining project. Such limits need to be defined at the beginning of the mine planning and should be reconsidered, again and routinely, during all the useful life of a mine. One of the purposes of the open pit mine exhaustion plan is the determination of the optimal final pit, based on an economic model subject to technical restrictions and aimed to maximize the net present value. LERCHS e GROSSMANN (1965 published the first specific algorithm related to the theme. This algorithm has been accepted as standard in comparison to other equivalent algorithms which have been proposed, because it solves the corresponding problem, according to the graph theory, of the minimum cut and

  15. Análise eletromiográfica de músculos do membro inferior em exercícios proprioceptivos realizados com olhos abertos e fechados

    Daniela Cristina Silveira de Oliveira

    2012-08-01

    Full Text Available INTRODUÇÃO: A propriocepção é um termo utilizado para descrever todas as informações neurais originadas nos proprioceptores das articulações, músculos, tendões, cápsulas e ligamentos, que são enviadas por meio das vias aferentes ao sistema nervoso central. A eletromiografia (EMG é o estudo da função muscular por meio da averiguação do sinal elétrico que emana do músculo, sendo também, o estudo da atividade da unidade motora. OBJETIVO: Realizar uma análise eletromiográfica dos músculos reto femoral (RF e tibial anterior (TA, em diferentes exercícios proprioceptivos (disco de Freeman-DIS e balancim-BAL com os olhos abertos (OA e fechados (OF. MÉTODOS: A análise foi realizada com 10 indivíduos do gênero masculino, fisicamente ativos, em um tempo de coleta de 10 segundos em cada aparelho tanto com olhos abertos como fechados. RESULTADOS: De acordo com nossos achados, observamos uma diferença significativa quando os exercícios proprioceptivos são realizados com olhos abertos e olhos fechados, obtendo uma ativação muscular maior, de acordo com a análise eletromiográfica, nos exercícios com olhos fechados, ressaltando a importância do sistema visual e como ele interfere na posição do corpo quando este é submetido a variações de equilíbrio causadas pelos aparelhos pesquisados. CONCLUSÃO: Concluímos que o músculo reto femoral não apresentou diferenças significativas evidentes entre os aparelhos balancim e disco de Freeman, assim como quando o exercício era realizado com os olhos abertos ou fechados. A diferença significativa ocorrida foi entre o balancim OA e OF e entre balancim OA e disco de Freeman OF. Já o músculo tibial anterior, apresentou diferenças significativas maiores, principalmente com os olhos fechados, independente do aparelho, os quais não apresentaram diferenças significativas entre eles.

  16. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Laerte Francisco Filippsen; Denyse Maria Galvão Leite; Aparecido da Silva; Gilberto Alexandre Vargas

    2001-01-01

    O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames soro...

  17. Ars disyecta Ars disyecta

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  18. Exposição ao mercúrio e ao arsênio em Estados da Amazônia: síntese dos estudos do Instituto Evandro Chagas/FUNASA Exposure to mercury and arsenic in Amazon States: a summary of studies by the Evandro Chagas Institute/FUNASA

    Elisabeth C. de Oliveira Santos

    2003-06-01

    Full Text Available Este artigo é uma revisão das pesquisas da Seção de Meio Ambiente do Instituto Evandro Chagas/FUNASA sobre exposição ao mercúrio (Hg no vale do rio Tapajós e Estado do Acre, e exposição ao arsênio (As através de resíduos da exploração de manganês (Mn realizada pela ICOMI deixados no Porto de Santana-AP. Em relação ao mercúrio, têm sido pesquisadas populações sob risco através da via respiratória ou alimentar. No primeiro caso, os trabalhadores de casas de compra e venda de ouro têm apresentado teores mais elevados de Hg em urina do que os garimpeiros estudados. No segundo caso, as populações ribeirinhas têm mostrado níveis diferenciados de exposição (Hg em cabelo. Comunidades ribeirinhas situadas em áreas não afetadas pelo mercúrio da garimpagem e com hábitos alimentares semelhantes às de área de risco têm sido avaliadas, visando a construção de parâmetros de normalidade regional. São também pesquisados os teores de Hg em materiais ambientais e na biota aquática. Os estudos de saúde humana e ambiente na cidade de Santana-AP objetivaram avaliar as fontes e possíveis vias de exposição da população da comunidade do Elesbão ao arsênio. Verificou-se a existência de fonte de risco através dos rejeitos de Mn, porém os níveis de As na água consumida pela população mostraram-se dentro dos parâmetros de normalidade. As médias encontradas em sangue e cabelo coincidem com médias de normalidade referidas na literatura, em populações não expostas, e as associações entre variáveis epidemiológicas, avaliação clínico-laboratorial e os teores de arsênio não mostraram significância estatística.This article is a review of the studies carried out by Environmental Section of the Evandro Chagas Institute/FUNASA on mercury (Hg exposure in the Tapajós river basin, and arsenic exposure (As due to residues of the manganese (Mn exploration, performed by ICOMI and left at the port of Santana

  19. Estratégia da Estrutura de Capital sob os Efeitos das Fusões: Estudo de Caso das Instituições de Ensino Superior Brasileiras de Capital Aberto

    Raul Carlos de Mello

    2010-11-01

    Full Text Available O objetivo deste artigo foi identificar os reflexos produzidos por uma estratégia de crescimento, que se utiliza das fusões, aquisições ou incorporações, sobre a estrutura de capital das instituições de ensino superior brasileiras de capital aberto. A pesquisa utilizada foi de caráter descritivo e o método empregado foi o dedutivo, tendo como meio de investigação o estudo de caso múltiplo. Desse modo, ao elaborar um mapeamento, para o período de 2004 a 2008, de todas as aquisições desenvolvidas pelas instituições de ensino superior brasileiras de capital aberto e dos indicadores relacionados às estruturas de capital, identificou-se uma influência da estratégia de aquisições sobre a estrutura de capital em duas fases: na própria definição da estratégia, ao identificar e usufruir das fontes necessárias para a implantação, e na sua implantação, ao decidir pela agregação das dívidas da empresa adquirida.

  20. CNPq e o acesso aberto à informação científica

    José Donizetti Freire

    2015-01-01

    Nesta tese se discute o processo formal de comunicação científica por meio de artigos publicados em revistas científicas nacionais e internacionais e a acessibilidade dessas informações em canais de acesso aberto. Descrevem-se os modelos de negócios das editoras científicas e elabora-se uma proposta de sistema de gestão da produção científica financiada pelo Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) em repositório digital de acesso aberto. A pesquisa envolveu várias...

  1. Influência do DNA mitocondrial no glaucoma primário de ângulo aberto sob a visão da cienciometria

    Leonardo Mariano Reis

    2013-10-01

    Full Text Available OBJETIVO: O glaucoma primário de ângulo aberto é uma doença degenerativa do nervo óptico que se encontra entre as principais causas de cegueira no mundo. Aspectos familiares já foram implicados como fatores importantes e comprovados em inúmeros estudos. Nesse artigo, apresentamos uma revisão sistemática dos trabalhos sobre glaucoma primário de ângulo aberto e DNA mitocondrial e fazemos uma análise estatística à luz dos conceitos da cienciometria. MÉTODOS: A pesquisa bibliográfica de trabalhos envolvendo DNA mitocondrial e glaucoma primário de ângulo aberto foi realizada por meio da base de dados do sítio Scopus. Foi feito o levantamento a partir das palavras-chaves "Mitochondrial DNA" e "Glaucoma" em todos os campos para publicações no período compreendido de 1992 até agosto de 2012. Finalmente, foi realizada a estatística e cienciometria com os principais dados: autores que publicaram sobre o assunto DNA mitocondrial e glaucoma; revistas e outras publicações que tiveram trabalhos relacionados com o tema; Centros de Pesquisa e Universidades que mais publicaram e países onde foram realizados os estudos sobre DNA mitocondrial e glaucoma. RESULTADOS: Identificamos que esses estudos têm aumentado sobremaneira ao longo dos últimos anos, mas ainda se encontram confinados, na maior parte, a alguns centros de pesquisa e concentrados em seletos grupos de autores na área da oftalmologia em países desenvolvidos. No Brasil, ainda não temos pesquisas publicadas sobre o assunto até o momento. CONCLUSÃO: Esses estudos são de fundamental importância para a elucidação das causas genéticas do glaucoma e para o desenvolvimento de novas terapias que não visem tão somente a diminuição da pressão intraocular.

  2. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L.) sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L.) under air exposure stress

    Roberta Dias da Silva; Laudicéia Oliveira Rocha; Bruno Duarte Alves Fortes; Dirson Vieira; Maria Clorinda Soares Fioravanti

    2012-01-01

    No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus) sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM), a hemoglobina corpuscular média (HCM), a concentração de hemoglobina corpuscular média (CHCM), o leucograma, contagem diferencial de l...

  3. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Laerte Francisco Filippsen

    2001-04-01

    Full Text Available O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames sorológicos para Aujeszky, parvovirose, leptospirose e brucelose. Foram coletadas amostras de fezes dos leitões com diarréia para realização de exames bacteriológicos. A principal causa de mortalidade em leitões lactentes criados ao ar livre foi o esmagamento. A prevalência de doenças infecciosas não foi elevada. A ocorrência mais freqüente foi diarréia em leitões lactentes. O índice de pneumonia no rebanho de suínos criados ao ar livre foi baixo. Não houve ocorrência de doenças infecciosas da reprodução.The aim of this work was to determine the prevalence of infectious diseases in an outdoor pig herd in the South-western region of Paraná, Brazil, from October 1996 to June 1999. A total of 969 animals were examined. All infections observed were registered. All animals found dead within the period of study and one piglet of each litter sacrified on the 28th post weaning day were autopsied. Blood samples were collected for Aujeszky, parvovirus, leptospirosis and brucellosis serological tests. Faecal samples from piglets with diarrhoea were taken for bacteriological tests. Crushing was the main cause of outdoor suckling piglets mortality. The prevalence of infectious diseases was not high. The most frequent occurrence in suckling piglets was diarrhoea. The pneumonia index in the herd raised outdoors was low. There was no occurrence of reproductive infectious diseases.

  4. Frações nitrogenadas de silagens de milho "safrinha" sob diferentes tempos de exposição ao ar antes da ensilagem Nitrogenous fractions of silages from a maize crop planted late in season, under different periods of air exposure previous to ensiling

    João Pedro Velho

    2008-02-01

    Full Text Available Objetivou-se avaliar o efeito da maturidade dos grãos de milho e do tempo de exposição ao ar antes da ensilagem sobre o pH e os componentes nitrogenados de silagens de milho "safrinha". O experimento foi conduzido em delineamento completamente casualizado com arranjo fatorial 2 x 4, no qual foram testados dois estádios de maturidade (MA ao corte (grão completamente leitoso (GL ou grão ½ leitoso ½ farináceo (GF e quatro tempos de exposição ao ar (EX, sem compactação (0, 12, 24 e 36 horas antes da ensilagem em minissilos. Houve efeito significativo (PThis experiment was aimed at evaluating the effect of corn grain maturity and air exposure time prior to ensiling on the pH and nitrogenous fractions of corn silage from corn crop planted late in the season. A completely randomized 2 x 4 factorial arrangement was used to test the effect of two maturity stages at harvest (GL, milky kernel and GF, ½ milky ½ dough kernel of maize crops and the effects of four periods of air exposure of chopped materials (zero, 12, 24 and 36 hours previous to packing in mini-silos, on pH and N fractions of silages. There was a significant effect (P<0.05 related to stage of maturity and period of air exposure concerning the contents of crude protein and neutral detergent insoluble nitrogen, as well as an interaction between the main effects for ammonia nitrogen and acid detergent insoluble nitrogen. Due to the interaction, the maize silage harvested at the milky kernel stage resulted in higher pH value and ammonia nitrogen contents. A delayed packing procedure increases the insoluble nitrogen fractions and may affect negatively protein digestibility.

  5. Ars Electronica

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  6. THE AMBIGUOUS EXPERIENCE OF THE JOUISSANCE AND OF THE BODY IN THE NOVEL A CÉU ABERTO

    Marcio Markendorf

    2010-07-01

    Full Text Available Taking as its object of study the book A céu aberto, written by João Gilberto Noll, this paper discusses the theme of ambiguity in contemporary literature. The analysis is focused on the evaluation of a doppelgänger body, indeterminate in relation to sexuality, gender and jouissance.

  7. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  8. Efeitos ambientais da produção de suínos ao ar livre: evolução e distribuição espacial das formas de P no solo e perdas de P na água de drenagem Environmental impact of outdoor pig production: soil P forms evolution spatial distribution and P losses in drainage waters

    Carmo Horta

    2012-06-01

    Full Text Available A produção de suínos ao ar livre é considerada pelos consumidores como um modo de produção mais amigo do ambiente e do bem-estar animal. No entanto, os nutrientes contidos na ração e no "excreta" dos suínos são continuamente introduzidos no solo conduzindo a aumentos significativos desses nutrientes no solo, em especial do fósforo (P. Esta continua adição de P ao solo pode exceder a sua capacidade de retenção originando perdas significativas de P para as águas de drenagem e de escoamento superficial, contribuindo para a poluição difusa das águas superficiais. O principal objectivo deste trabalho foi avaliar o impacto da produção de suínos ao ar livre sobre o teor em P do solo avaliando a sua distribuição espacial e temporal, e avaliar também a perda de P através das águas de drenagem interna do solo. A unidade experimental de produção de suínos ao ar livre deste trabalho tem 2.8 ha, um declive entre 5 e 30% e uma carga animal de 9 adultos / ha. Observou-se um aumento do P do solo, quer do P biodisponível (P Olsen, P-Ol quer do P inorgânico (Pi ou orgânico (Po. No Inverno observaram-se elevadas perdas de P por erosão e escoamento superficial, mas ao longo do tempo observou-se um aumento global do P no solo. Um teor em P-Ol > 20 mg kg-1 originou um aumento significativo na perda de P para as águas de drenagem interna. Melhores práticas de maneio da unidade experimental, bem como uma escolha da área de produção menos susceptível à erosão, conduzirão a uma prevenção nos riscos de perda de P e na eutrofização das águas superficiais.When compared with intensive indoor production, outdoor pig production is considered by consumers as the production system that causes the least negative environmental effects and contributes to animal welfare. Nevertheless, the continuous input of nutrients in food or pig excretions, increases soil nutrients levels, as is the case with phosphorus (P. This continuous soil P

  9. Impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica: revisão de literatura Impact of the open and closed tracheal suctioning system on the incidence of mechanical ventilation associated pneumonia: literature review

    Fernanda Maia Lopes; Marcelo Farani López

    2009-01-01

    A pneumonia é a infecção nosocomial mais comum em unidades de terapia intensiva, sendo a ventilação mecânica um fator fortemente associado ao seu desenvolvimento. O objetivo deste estudo foi descrever o impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica. Realizou-se uma pesquisa na base de dados Pubmed para identificar tentativas controladas aleatórias, publicadas no período de 1990 a novembro de 2008. Nove estudos foram incluí...

  10. O espaço político aberto pela leitura literária

    Leonardo Pinto de Almeida

    2013-01-01

    Full Text Available O presente artigo se propõe questionar sobre o espaço político aberto pela leitura literária. Especificando a literatura como uma tentativa de compreensão de problemas relacionados à existência, sublinhamos como a leitura literária coloca em questão nossas convicções e verdades defendidas cotidianamente. Para tanto, compreendemos as relações tecidas entre a linguagem, o poder e a resistência no seio da experiência literária. Concluímos que a leitura literária é atravessada por formas de resistência às palavras de ordem que circulam de forma hegemônica em nossa sociedade, disponibilizando assim uma transformação em nossa rede afetiva e cognitiva.

  11. Open Access Serials: the High Dilution Research case. Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Publicações de acesso aberto: o caso da pesquisa em altas diluições

    Carlos Renato Zacharias

    2008-09-01

    ático, revisado por pares e de fácil acesso, capaz de alcançar parâmetros de alto impacto sem perder seu foco, onde os marcos de referência e conceitos teóricos possam ser apresentados e intensamente discutidos, abarcando do experimental ao teórico, pesquisa básica e aplicada, pesquisas clínicas, históricas e sociológicas. As características do sistema aberto se correspondem adequadamente com os requerimentos de um periódico para a comunidade ligada às altas diluições. Igualmente, o meio eletrônico permite divulgar textos e gráficos de maior tamanho, filmes, entrevistas, áudio e outros tipos de formatos multimedia. Por esse motivo, um periódico científico de acesso aberto dedicado às altas diluições seria muito bem recebido pela comunidade internacional. Palavras-chave: Acesso aberto, altas diluições, periódicos online.   Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Resumen La publicación de acceso abierto parece ser el nuevo paradigma en publicación científica, representando una tendencia creciente en todos los segmentos de la sociedad. En particular, nos interesa la aplicación de este modelo en la investigación de altas diluciones. Tal área multidisciplinar está abierta a especialistas de todas las áreas del saber, necesitando aún ensayos y modelos experimentales, así como abordajes teóricos. Sin embargo, estos investigadores deben ser reunidos en torno de un periódico temático, revisado por pares y de fácil acceso, capaz de alcanzar parámetros de alto impacto sin perder su foco, adonde los marcos de referencia y conceptos teóricos puedan ser presentados e intensamente discutidos, abarcando desde lo experimental a lo te

  12. Análise fluido-dinâmica do escoamento em ensaio de permeabilidade ao ar de argamassas preparadas com cimento Portland de alto-forno Fluid-dynamic analysis of the flow in air permeability measurement of mortars prepared with blast-slag furnace Portland cement

    V. M. Pereira

    2008-06-01

    Full Text Available O estudo dos fenômenos fluido-dinâmicos de escoamento em meios porosos tem sido de grande interesse por diversas áreas das ciências, de forma a se avaliar não só a permeabilidade do material, mas também analisar o comportamento do fluido permeante quando no interior destes materiais. Tratando-se de compósitos à base de cimento, a mensuração da permeabilidade torna-se fundamental para que sua durabilidade possa ser estimada, pois é a permeabilidade que controla a taxa de ingresso e movimentação de agentes deletérios no interior destes materiais. Dessa forma, diversas metodologias e equacionamentos matemáticos têm sido utilizados para prever a permeabilidade de materiais à base de cimento. No entanto, várias discrepâncias e disparidades nos resultados têm sido encontradas. Dentre as metodologias empregadas para mensurar a permeabilidade de meios porosos, encontra-se a desenvolvida por Thenoz, a qual tem demonstrado bons resultados em materiais à base de cimento. Dessa forma, este trabalho visa, por meio de ensaio de permeabilidade ao ar, realizado de acordo com a metodologia de Thenoz, avaliar o comportamento fluido-dinâmico do ar durante o ensaio de permeabilidade em argamassas. Para isto, foram utilizadas argamassas preparadas com dois tipos de cimento Portland (CP II E - 32 e CP III - 32, duas relações água/cimento (0,5 e 0,6 e ensaiadas em idades de 14 e 28 dias. Por meio dos resultados obtidos foi possível observar que durante o escoamento a compressibilidade do ar pode ser ignorada e o regime de escoamento pode ser considerado como laminar, demonstrando que a metodologia proposta por Thenoz e o equacionamento matemático empregado pode resultar em coeficientes de permeabilidade ao ar confiáveis, pois fenômenos e considerações que poderiam influenciar neste tipo de escoamento podem ser negligenciados.Fluid-dynamic phenomena study in porous media flow has been of great interest for diverse areas of sciences

  13. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  14. Análise de vinte genótipos de sorgo (Sorghum bicolor (L.) Moench), de portes médio e alto, pertencentes ao ensaio nacional

    Pesce Domingos Marcelo Cenachi; Goncalves Lúcio Carlos; Rodrigues José Avelino Santos; Rodriguez Norberto Mario; Borges Iran

    2000-01-01

    Os vinte genótipos de sorgo estudados foram cultivados e ensilados aos 104 dias de idade, em estádio de grão pastoso, em silos de laboratório de "PVC", com 10 cm de diâmetro e 40 cm de comprimento. Os silos foram abertos aos 150 dias após a ensilagem. O delineamento adotado foi o inteiramente casualizado. No material estudado (verde e ensilado), foram determinados os valores de fibra em detergente neutro (FDN), fibra em detergente ácido (FDA), hemicelulose, celulose, lignina, cinzas totais, m...

  15. MINERÍA A CÉU ABERTO: OS EMBATES DA COMUNA AFRODESCENDENTE PLAYA DE ORO, ESMERALDAS - EQUADOR

    Janaina Lobo

    2014-01-01

    Antes de iniciar a narrativa sobre o caso da minería a céu aberto e seus efeitos na Comuna afrodescendente de Playa de Oro, eu gostaria de fazer alguns breves apontamentos sobre a eleição do lugar dessa pesquisa. Ou melhor, gostaria de situar o leitor nessa incursão etnográfica pelo Equador. Explico essa escolha: não é por acaso o meu deslocamento para uma comunidade negra na parte setentrional deste país que sequer faz fronteira com o Brasil. Por pelo menos dez anos eu estive envolvida entre...

  16. REGULARIDADE NO PAGAMENTO DE DIVIDENDOS E GOVERNANÇA CORPORATIVA: ESTUDO EM COMPANHIAS DE CAPITAL ABERTO LISTADAS NA BM&FBOVESPA

    Ramon Kael Benassi Bachmann

    2012-08-01

    Full Text Available O objetivo deste estudo é verificar qual a relação entre nível de governança corporativa e regularidade do pagamento de dividendos das companhias de capital aberto listadas na BM&FBOVESPA, entre 2001 e 2010. Empresas listadas na bolsa compuseram três amostras, segregadas conforme (i pagamento de dividendos a acionistas ordinários, (ii preferenciais ou (iii dividendos totais pagos pela companhia. Para representar regularidade admitiu-se como métrica os coeficientes de variação (CV das séries de pagamento de dividendos das companhias, no período analisado. Para os níveis de governança corporativa foram atribuídas duas métricas: uma simples (NG, atribuindo 1 ponto por ano de enquadramento em algum dos níveis, o que considera-os em termos de tempo de enquadramento; e outra ponderada (NGP, atribuindo 1 ponto por ano de enquadramento no Nível 1 (N1, 2 pontos por ano no Nível 2 (N2 e 3 pontos por ano no Novo Mercado (NM, considerando tempo de enquadramento no nível de governança e tipo de nível. Na análise dos dados utilizou-se correlações de Pearson para verificar qual o tipo de relação entre CV e NG e entre CV e NGP, ambos para as 3 amostras. Os resultados indicam que o tempo de enquadramento em qualquer nível de governança, exceto o tradicional, tem relação inversa com regularidade de pagamento de dividendos, reafirmando possíveis gerenciamentos de resultados (income smoothing em companhias não enquadradas ou com pouco tempo de enquadramento. Constatou-se também que o tipo de nível de governança corporativa guarda relação apenas com a regularidade de pagamento de dividendos aos acionistas preferenciais.

  17. Produção e tolerância ao pendoamento de alface-romana em diferentes ambientes

    Cárita Rodrigues de Aquino

    2014-08-01

    Full Text Available O experimento foi conduzido na área experimental da Universidade do Estado de Mato Grosso, localizada no município de Cáceres-MT, no período de maio a agosto de 2011, com o objetivo de avaliar a influência de diferentes ambientes e espaçamentos na produção e tolerância ao pendoamento de alface-romana cultivar Sophia. O delineamento experimental foi em blocos casualizados, arranjados em esquema fatorial 2 x 5, composto por dois espaçamentos (30 x 30 cm e 25 x 25 cm e cinco ambientes de cultivo (tela de sombreamento 30 e 50% , tela termorrefletora de 30 e 50% e ambiente aberto, perfazendo 10 tratamentos com quatro repetições cada. As parcelas experimentais foram constituídas por quatro linhas, com cinco plantas cada, totalizando 20 plantas por parcela. Consideraram-se como área útil para avaliação da produção as seis plantas centrais. As parcelas em que foi utilizado o espaçamento 30 x 30 cm apresentavam 1,8 m² cada, e as com o espaçamento 25 x 25 cm, 1,5 m² cada. As mudas foram transplantadas com 26 dias e a colheita realizada aos 46 dias após o transplantio. Observou-se que o espaçamento de 25 x 25 cm entre plantas e o ambiente aberto proporcionaram maior produtividade da alface-romana. Porém, o tempo para pendoamento das plantas no ambiente aberto foi menor que nos ambientes com as telas de sombreamento ou termorrefletora.

  18. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    Anna Luiza de Fátima Pinho Lins Gryschek; José Claudio Domingos; Cássio Rogério Dias Lemos Figueiredo; Lúcia Yasuko Izumi Nichiata; Leonida Maria Osório

    2000-01-01

    Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como ne...

  19. Metodologia para validar IPS’s de código-fonte aberto

    Trentin, Marco Antônio S; Linden, Gustavo S; Zandoná, Tomás Damo

    2004-01-01

    O presente trabalho tem por objetivo descrever uma metodologia para realizar testes com ferramentas IPS (Intrusion Prevention Systems). Essas ferramentas são mecanismos que são implementados como gateways (in-line) em uma rede de computadores para receber, analisar e encaminhar o tráfego para o seu destino. A análise é feita através da procura por pacotes que contenham assinaturas de ataques aos computadores da rede. Como se trata de uma nova tecnologia é necessário determinar métricas para a...

  20. Qualidade do ar interior em instalações desportivas

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  1. Correlação entre a necrose de frutos associada ao Colletotrichum spp. com as características frutos por nó e produtividade entre genótipos de café arábica Correlation between fruit necrosis associated to Colletotrichum spp. with the fruits per node and yield traits of arabic coffee

    Gustavo Hiroshi Sera

    2008-02-01

    Full Text Available O fungo Colletotrichum spp. vem sendo associado à graves perdas para a cafeicultura brasileira. Objetivou-se neste trabalho verificar a existência de relação entre a variável necrose de frutos associada ao Colletotrichum spp. ("COL" com a quantidade média de frutos por nó produtivo ("FN" e com a produção ("PRD" em genótipos de café arábica. O ensaio de campo foi realizado no IAPAR (Londrina, PR, Brasil em dezembro de 2004 e em cafeeiros com três anos de idade. A variável "COL" foi avaliada atribuindo-se notas de 1 a 5, onde 1 representam plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação visual subjetiva da produção foi estimada em litros de frutos em estádio cereja, por planta. A correlação de Pearson foi estimada para avaliar a existência de associações entre as variáveis. Foram observadas correlações positivas e significativas a 1 % entre "COL" e "FN" e entre "COL" e "PRD". A necrose de frutos foi mais intensa em cafeeiros com mais produção e com mais frutos por nó produtivo. Sugere-se que a avaliação da resistência de campo à necrose dos frutos associada à presença de Colletotrichum spp. seja realizada em cafeeiros com alta produção e com alta quantidade de frutos por nó produtivo.Different fungi species of genus Colletotrichum has been associated with losses to the Brazilian coffee crop. The aim of this research was to evaluate the association between the variable fruit necrosis associated to Colletotrichum spp. ("COL" with the fruits per productive node average ("FN" and between "COL" and the yield ("PRD" in Coffea arabica L. genotypes. The field assay was evaluated at IAPAR (Londrina, PR, Brazil, in December 2004 and on coffee trees with three years old. The "COL" variable was evaluated attributing scores from 1 to 5, where score 1 represents plants

  2. Exigências nutricionais da grápia ao fósforo e enxofre em Argissolo Vermelho distrófico arênico: efeito da adubação no crescimento Nutritional demand of grápia to phophorus and sulfur in paleaudalf soil: fertilization effects on growth

    Evandro Luiz Missio

    2004-08-01

    Full Text Available A grápia (Apuleia leiocarpa Vog. Macbride é uma espécie de grande interesse madeireiro, encontrando-se, atualmente, bastante dizimada devido à exploração extrativista, sem haver reposição através de reflorestamento. O objetivo deste trabalho foi determinar os níveis ótimos de adubação de fósforo e enxofre no crescimento de plantas jovens de grápia. As plantas foram cultivadas em vasos contendo 3,5kg de solo Argissolo Vermelho distrófico arênico, sob condições de casa de vegetação não climatizada. O delineamento experimental foi o inteiramente casualizado com seis repetições. Foram avaliados 16 tratamentos em esquema bifatorial completo (4x4, representados pela combinação de quatro doses de P (0, 60, 120 e 180mg kg-1 e quatro de enxofre (0, 10, 20 e 30mg kg-1. A análise do crescimento das plantas foi realizada mensalmente através da altura da planta, diâmetro do caule e número de folhas remanescentes. Aos 130 dias após a emergência das plantas, avaliaram-se ainda o número de folhas caídas, matéria seca das folhas, caule, raízes e total da planta e a relação entre a matéria seca das raízes e da parte aérea. A produção de matéria seca total das plantas jovens de grápia respondeu positivamente à adubação conjunta de P e S, com dose de máxima eficiência técnica estimada de, respectivamente, 204 e 16mg kg-1 de solo. A adubação fosfatada na dose igual ou acima de 120mg kg-1 de solo induziu o aparecimento de clorose foliar típica da deficiência de Fe. A alta disponibilidade de P no solo favoreceu o crescimento da parte aérea em detrimento das raízes.Grápia (Apuleia leiocarpa Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to determine the optimum levels of phosphorus and sulfur fertilization on the initial growth of grápia. Grápia plants were cultivated in pots containing 3.5kg of a Paleudalf soil, under unclimatized glasshouse

  3. Aprendizagem ao ar livre: o ensino da física e da química no 3º ciclo e a formação do indivíduo através do projeto "Escola na natureza"

    Gomes, Raquel das Chagas Franco de Abreu

    2014-01-01

    Este relatório apresenta uma descrição detalhada do percurso académico e da experiência profissional da autora, ao longo de doze anos, enquanto docente de Física e de Química. Descreve-se a prática letiva desenvolvida, atividades e projetos dinamizados, cargos desempenhados e a formação realizada. Procede-se, ainda, ao desenvolvimento de um tema relacionado com o papel assumido pelo professor na dinamização de um ambiente de aprendizagem saudável e proveitoso. Recorre-se à experiê...

  4. Uma análise da correlação entre o EVA® e o MVA® no contexto das empresas brasileiras de capital aberto Correlation between Economic Value Added and Market Value Added for publicly owned Brazilian companies

    José Odálio dos Santos

    2005-03-01

    Full Text Available Este artigo trata do tema da criação de valor, da forma como é medida pelo EVA® (Valor Econômico Adicionado e pelo MVA® (Valor de Mercado Agregado, duas metodologias desenvolvidas no final dos anos 80 pela empresa americana de consultoria Stern Stewart & Co. O EVA® é definido como a diferença entre o lucro operacional líquido depois de impostos e o custo do capital investido na empresa, enquanto o MVA® é determinado pela diferença entre o valor de mercado da empresa e o capital total nela investido. Um estudo realizado por G. Bennett Stewart III, que idealizou essas metodologias juntamente com o seu sócio Joel M. Stern, encontrou uma forte correlação entre o EVA® e o MVA®. Visando averiguar se tal resultado se aplica também ao caso das empresas brasileiras, os autores deste artigo realizaram uma pesquisa semelhante, baseada numa amostra formada por empresas de capital aberto cujas ações foram negociadas na Bovespa (Bolsa de Valores de São Paulo durante o período de 1996 a 2001.This article deals with value creation as measured by Economic Value Added (EVA® and Market Value (MVA® which are methods developed by an American consultant, Stern Stewart & Co, in the late l980's. Economic Value Added is defined as the difference between net operating profit after taxes and the cost of capital invested in a company, while Market Value Added is the difference between market value and the total capital invested in a company. G. Bennett Stewart III, who conceived this approach together with his partner Joel M. Stern, found a strong correlation between Economic Value Added and Market Value Added. Our research investigated whether this also applies to a sample of publicly owned Brazilian companies traded on the São Paulo Stock Exchange between 1996 and 2001.

  5. Superdeformation of Ar hypernuclei

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  6. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L.) com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.)

    Rilvaynia Dantas Soares; Modesto Antonio Chaves; Arienilmar Araujo Lopes da Silva; Marcondes Viana da Silva; Betânia dos Santos Souza

    2007-01-01

    Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC), em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s) sobre o teor de linalol do manjericão (Ocimum basilicum L). Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, u...

  7. Custo-utilidade do tratamento do glaucoma primário de ângulo aberto no Brasil

    Ricardo Augusto Paletta Guedes

    2016-02-01

    Full Text Available RESUMO Objetivo: Determinar a estratégia mais custo-efetiva para o tratamento do glaucoma primário de ângulo aberto em fase inicial, comparando-se as seguintes alternativas: observação, tratamento clínico ou tratamento com laser. Métodos: Por meio de um modelo de Markov, sob a perspectiva do Sistema Único de Saúde (SUS e um horizonte da expectativa de vida média da população brasileira. Comparou-se a razão de custo-utilidade incremental (ICUR entre 3 alternativas de tratamento, assim como seus custos e o ganho em qualidade de vida, medido em QALY (Quality-adjusted life years. Resultados: A ICUR do tratamento inicial com laser e do tratamento inicial com colírios, em relação a não tratar foi de R$ 2.811,39/QALY e R$ 3.450,47/QALY, respectivamente. Ambas as estratégias foram custo-efetivas, com uma discreta vantagem para o tratamento a laser. Esta diferença diminui ainda mais quando se aumenta a idade de entrada no modelo. As duas alternativas propiciaram ganhos significativos de qualidade de vida (em torno de 2,5 QALYs para o tratamento com laser e de 5,0 QALYs para o tratamento com colírios. Conclusão: Tanto o tratamento primário com trabeculoplastia a laser quanto com medicações foram custo-efetivos e proporcionaram ganhos reais de qualidade de vida quando comparados com o não tratamento do GPAA.

  8. Evidências sobre as estruturas de propriedade de capital e de voto das empresas de capital aberto no Brasil

    Dante Mendes Aldrighi

    2007-06-01

    Full Text Available Este artigo analisa a evolução da estrutura de propriedade de capital e de votos das empresas de capital aberto no Brasil no período 1997-2002. Sua principal contribuição reside em estimar a magnitude dos direitos de voto e de fluxo de caixa do acionista último com a maior parcela do capital votante de cada empresa. Examinam-se, também, as fontes da discrepância entre direitos de votos e de fluxo de caixa, avaliando-se a importância relativa da emissão de ações preferenciais sem direito a voto, acordos de votos, estruturas piramidais de propriedade, e posse cruzada de ações. A base de dados compreende 4478 relatórios que as empresas, cumprindo uma exigência legal, submeteram à CVM nesse período.This paper focuses on the ownership and voting structures of limited liability companies in Brazil over the period 1997-2002. Its main contribution lies in measuring the magnitude of deviations between control rights and cash-flow rights for the ultimate shareholder with the largest voting rights. Furthermore, it pinpoints how these discrepancies are generated, evaluating the relative importance of the issuance of preferred stocks with no voting rights, voting agreements, pyramidal arrangements of ownership, and cross-shareholdings. The data set embraces 4,478 reports that companies, complying with a mandatory requirement, filed to the CVM over that period.

  9. do parasita ao ecossistema

    Balazeiro, Clementina Furtado

    2011-01-01

    A triquinose é uma zoonose parasitária, cujo agente causal, um nemátode, pertence ao género Trichinella. Foram já identificadas e caracterizadas várias espécies pertencentes a este género, como T. spiralis, T. nativa, T. britovi, T. nelsoni, T. murreli, T. pseudospiralis, T. papuae e T. zimbabwensis bem como alguns genótipos, T6, T8, T9, e T12. A triquinose é uma doença transmitida por carnivorismo entre os seus hospedeiros. No Homem, a principal fonte de infecção é o consumo de carne infecta...

  10. Do conhecimento ao saber

    Almeida, Maria Cristina Pereira dos Santos

    2013-01-01

    O relatório surge como documento final do percurso iniciado aquando do ingresso no 4º Curso de Pós – Licenciatura em Enfermagem Médico-Cirúrgica da Universidade Católica do Porto, no ano letivo 2010/2011. No decurso deste trabalho pretendemos fazer uma súmula das experiências que este período de formação nos proporcionou, dando visibilidade à unidade curricular estágio, pela sua importância na aquisição de competências na área da Enfermagem Médico-Cirúrgica, na abordagem ao ...

  11. ARS Biodiesel Research Initiatives

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  12. ARS Culture Collection

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  13. Das políticas ao cotidiano: entraves e possibilidades para a educação do campo alcançar as escolas no rural De las políticas a la vida cotidiana: obstáculos y oportunidades para que la educación del campo alcance las escuelas rurales From policies to everyday life: barriers and opportunities for country education to access the rural schools

    Ludmila Oliveira Holanda Cavalcante

    2010-09-01

    Full Text Available O presente artigo visa a trazer para o debate os questionamentos em torno da viabilidade das políticas de educação do campo nos territórios do rural brasileiro. Entre a política de direitos e a cultura de direitos, vale a reflexão de como a "educação do campo", ao alcançar o universo retórico e legalista das políticas educacionais brasileiras já no século XXI, pode de fato ser apropriada pelos (significativos pedaços do rural que não se encontram em "movimento" (este rural ainda sob a lógica da produção capitalista, muitas vezes inerte ao mundo de lutas e labutas dos movimentos sociais em diferentes cantos do Brasil nos últimos vinte anos. O texto aponta para a necessidade de aguçar o debate sobre questões importantes que circundam a educação do rural que se transforma em "campo" e que, ironicamente, pode estar ainda longe de ser implementada entre a noção de um campo ou outro.Este artículo pretende aportar al debate de los planteos relacionados con la viabilidad de las políticas de educación del campo en las zonas rurales de Brasil. Entre la política de derechos y la cultura de derechos vale la reflexión de cómo la "Educación del campo", al alcanzar el universo retórico y legalista de la política educativa brasileña ya en el siglo XXI, puede, de hecho, ser apropiada por partes (significativas de la población rural que no están en "movimiento" (este mundo rural, todavía bajo la lógica de la producción capitalista, muchas veces, ajeno al mundo de los afanes y las luchas de los movimientos sociales en los distintos rincones de Brasil en los últimos veinte años . El texto señala la necesidad de estimular el debate sobre cuestiones importantes de la educación de la zona rural que se convierte en "campo" y que, irónicamente, aún puede estar lejos de ser implementada entre la noción de un campo u otro.This present article aims to discuss the viability of country education policies at the rural territories

  14. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L. com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.

    Rilvaynia Dantas Soares

    2007-08-01

    Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were

  15. Grau de exposição a praguicidas organoclorados em moradores de aterro a céu aberto Levels of exposure to organochlorine pesticides in open-air dump dwellers

    Eladio Santos Filho

    2003-08-01

    Full Text Available OBJETIVO: Estimar o grau de exposição interna aos praguicidas organoclorados (POP dos moradores de um atêrro a céu aberto. MÉTODOS: Estudo observacional, de aferição simultânea e controlado, cujo fator de estudo foi residir em área contaminada por POP e o efeito foi a concentração sanguínea dessas substâncias. A população de estudo foi de 238 pessoas residentes em um aterro a céu aberto (Pilões, no município de Cubatão, SP; e a população de controle ficou dimensionada em 258 pessoas, também residentes no mesmo município (Cota 200. Foram analisados os praguicidas HCB, p-p'DDT, p-p'DDE, p-p'DDD, o-p'DDT, a HCH; b HCH; g HCH; Aldrin; Dieldrin; Endrin; Heptaclor; Heptaclor-epoxi e Mirex. RESULTADOS: Os teores médios sangüíneos de HCB em Pilões foram de 4,66 µg/L, 155 vezes maior que a média na Cota 200 (0,03 µg/L. Em Pilões, os teores médios de DDT total foram de 3,71 µg/L, duas vezes maior do que na Cota 200 (1,85 µg/L e o HCH total apresentou concentrações sangüíneas seis vezes maiores em Pilões, 0,84 µg/L, contra 0,13 µg/L. CONCLUSÕES: Evidenciou-se associação positiva entre residir em Pilões e apresentar teores sangüíneos de POP, com risco muitas vezes maior quando comparado a localidades sem a presença desses contaminantes.OBJECTIVE: To estimate the degree of internal exposure to organochlorine pesticides (persistent organic pollutants, POP among inhabitants of an open-air dump. METHODS: This was an observational study with simultaneous measurement and control, in which the criterion for subjects was that they dwelled in an area contaminated by POP and the effect of such contamination was the concentration of such substances into the blood. The study population consisted of 238 people living on an open-air dump in Pilões, in the municipality of Cubatão, SP, Brazil, and the control population was formed by 258 people, also resident in that municipality, in the Cota 200 district. The following

  16. Fatores associados ao parto vaginal em gestantes de alto risco submetidas à indução do parto com misoprostol Factors associated with vaginal delivery in high-risk pregnant women submitted to labor induction with misoprostol

    Zuleika Studart Sampaio; Carlos Augusto Alencar Júnior; Francisco Edson de Lucena Feitosa; Melania Maria Ramos Amorim

    2004-01-01

    OBJETIVOS: determinar os principais fatores associados ao parto transpelvino em gestantes de alto-risco submetidas à indução do parto com misoprostol vaginal (50 µg). MÉTODOS: trata-se da análise secundária de um ensaio clínico aberto, não randomizado, incluindo 61 gestantes de alto-risco internadas na Enfermaria de Patologia Obstétrica da Maternidade Escola Assis Chateaubriand, em Fortaleza (CE). Todas tinham idade gestacional de mais de 37 semanas, feto único com boa vitalidade e escores de...

  17. Ars Electronica tulekul / Rael Artel

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  18. ARABIC LIGHT STEMMER (ARS

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  19. Práticas de responsabilidade socioambiental nas empresas de capital aberto de Santa Catarina listadas na BM&FBOVESPA = Social responsibility practices in open capital companies from Santa Catarina listed on BM&FBOVESPA

    Daniela Di Domenico

    2015-08-01

    Full Text Available Este artigo tem como objetivo identificar as práticas de ações de responsabilidade social corporativa das sociedades anônimas de capital aberto de Santa Catarina listadas na BM&FBovespa. A justificativa da pesquisa está atrelada à influência da evidenciação dessas informações para os investidores, pesquisadores e usuários das informações ambientais. Quanto aos procedimentos metodológicos o estudo caracteriza-se como exploratório quanto aos objetivos, documental em relação aos procedimentos e a abordagem do problema é predominantemente qualitativa. As empresas que fazem parte da amostra são: BRF S.A., BUETTNER S.A., CASAN, KARSTEN S.A e WEG S.A. Foram várias as práticas de responsabilidade social e ambiental evidenciadas, mas se pode identificar que todas têm como objetivo divulgar a empresa, além do objetivo principal da ação realizada. É possível destacar as principais práticas como sendo as ações e cuidados para o consumo consciente da água e energia, usando fontes que não sejam prejudiciais ao meio ambiente. Outra ação em destaque é o cuidado com a destinação dos resíduos sólidos e líquidos, gerados nos processos operacionais das empresas. A preocupação com a poluição da atmosfera também é evidente, por ser um dos principais problemas ambientais na atualidade.This article aims at identifying the practices of corporate social responsibility of corporations with open capital of Santa Catarina listed BM&FBovespa. The justification of this research is related to the influence of the disclosure of information for the investors, researchers and users of environmental information. In the methodological procedures, the study is characterized as exploratory as its goals, documental regarding the procedures and its approach to the problem is predominantly qualitative. The companies included in the sample are: BRF SA, BUETTNER SA, CASAN, KARSTEN SA and WEG SA. There were several social and environmental

  20. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  1. Geochronology and thermochronology by the 40Ar/39Ar method

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  2. Teste de desencadeamento aberto no diagnóstico de alergia à proteína do leite de vaca Open challenge for the diagnosis of cow's milk protein allergy

    Fernanda Ferreira Correa

    2010-04-01

    Full Text Available OBJETIVO: Relatar os resultados de testes de desencadeamento aplicados em crianças alimentadas com dieta de exclusão das proteínas do leite de vaca. DESCRIÇÃO: Estudo transversal que avaliou testes de desencadeamento oral aberto, com leite de vaca, realizados sob supervisão em ambiente hospitalar por 2,5 horas e ambulatoriamente por 30 dias quando não ocorreu reação imediata. Foram incluídos 121 pacientes, com idades entre 4 e 95 meses. O teste de desencadeamento com leite de vaca foi positivo em 28 (23,1% pacientes. Manifestação clínica de alergia ao leite de vaca diferente da apresentada por ocasião da suspeita diagnóstica ocorreu em 12 (42,9% pacientes com desencadeamento positivo. O desencadeamento positivo foi mais frequente (p = 0,042 nos pacientes alimentados com fórmulas extensamente hidrolisadas ou de aminoácidos (30,3% quando comparados com os alimentados com outras dietas de exclusão (14,5%. CONCLUSÃO: O teste de desencadeamento permitiu que fosse suspensa a dieta de exclusão de grande parte dos pacientes.OBJECTIVES: To report the results of open challenge tests performed in children fed with cow's milk-free diet. DESCRIPTIONS: Cross-sectional study evaluating cow's milk open challenge performed under supervision in a hospital setting during 2.5 hours and ambulatory follow-up for 30 days when no immediate reaction occurred. One hundred and twenty-one patients were included, with ages between 4 and 95 months. Cow's milk open challenge tests were positive in 28 patients (23.1%. A clinical manifestation of cow's milk allergy different from the one presented at diagnosis occurred in 12 (24.9% patients with positive challenge. Positive challenge was more frequent (p = 0.042 in patients fed with extensively hydrolyzed formulae or amino acid-based formulae (30.3% when compared to those fed with other exclusion diets (14.5%. CONCLUSION: Open challenge allowed the interruption of exclusion diet in a significant proportion

  3. Sistema aberto ou fechado de nutrição enteral para adultos críticos: há diferença? Open versus closed enteral nutrition systems for critically ill adults: is there a difference?

    Stella Marys Rigatti Silva

    2012-04-01

    Full Text Available OBJETIVO: Comparar o volume, calorias totais e proteínas recebidos pelos pacientes críticos quando utilizada nutrição enteral (NE por sistema aberto (SA e sistema fechado (SF; identificar os principais motivos para interrupção da NE. MÉTODOS: Estudo de coorte em que foram acompanhados adultos internados no Centro de Terapia Intensiva (CTI em dois períodos: em novembro de 2009, quando se adotava SA de NE para a totalidade dos pacientes (n = 85; e entre outubro de 2010 e abril de 2011, quando foi utilizado SF de NE (n = 170. Foram utilizados testes paramétricos e não paramétricos para comparação das variáveis respeitando-se sua distribuição. RESULTADOS: Os grupos assemelharam-se quanto às características clínicas e demográficas. Diferenças de mínima magnitude matemática e de nenhuma relevância clínica foram observadas entre os grupos: mais calorias/quilo foram prescritas ao grupo SA (p OBJECTIVE: To compare the volume, total calories, and protein received by critically ill patients between open and closed enteral nutrition (EN systems and identify the main reasons for EN discontinuation. METHODS: A cohort study in which adult patients admitted to the intensive care unit (ICU were followed-up in two periods: throughout November 2009 with all patients (n = 85 receiving EN using the open system (OS group; and from October 2010 to April 2011 with patients (n = 170 receiving EN using the closed system (CS group. Parametric and nonparametric tests were used to compare the variables, taking into account their distribution. RESULTS: Demographic and clinical characteristics were similar in both groups. There were minor differences with no statistical significance between groups: more calories/kg were prescribed to the OS group (p < 0.001, and a higher volume (mL/kg, p = 0.002 and protein (g/kg, p = 0.001 were prescribed to the CS group. Fasting, enteral feeding or gastrointestinal problems, and performance of procedures and ICU

  4. Criação intensiva de suínos em confinamento ou ao ar livre: estudo meta-analítico do desempenho zootécnico nas fases de crescimento e terminação e avaliação de carcaça e carne no Longissimus dorsi Intensive pig production in confinement or outdoor systems: a meta-analytical study of the production performance in the growing and finishing phases and carcass and meat evaluation from the Longissimus dorsi

    Alice Bogoni Demori

    2012-07-01

    Full Text Available Uma meta-análise foi realizada para avaliar o desempenho e a qualidade de carcaça e carne de suínos em função do sistema de alojamento nas fases de crescimento/terminação. Foram selecionadas publicações indexadas com resultados de experimentos comparando variáveis de desempenho e de pós-abate de suínos alojados em sistemas intensivos convencionais ou ao ar livre. A base de dados contemplou 27 artigos publicados entre 1997 e 2009. Ao total, foram considerados 2.985 animais e 701 médias na análise de dados. A meta-análise foi realizada através de duas análises sequenciais: gráfica e de variância-covariância. O sistema de criação de suínos ao ar livre aumentou em 9% (P0,05 pelo sistema de alojamento dos suínos. Concluiu-se que o sistema de criação influencia no desempenho dos suínos, mas não interfere nas características de carcaça e carne estudadas.A meta-analysis was carried out to study performance and characteristics of carcass and meat in pigs in function of housing system during the growing/finishing period. Indexed publications with results of experiments comparing performance and post-slaughter variables of pigs housed in outdoor or conventional intensive systems were selected. In total, 2.985 animals and 701 averages were considered in the data analysis. Meta-analysis followed two sequential analyses: graphic and variance. The outdoor productive system increased in 9% (P0.05 by the housing system. It is concluded that the housing system influences the pig performance, but does not interfere in characteristics of carcass and meat.

  5. Performance of cultivars of arugula under shade screens and open field /Desempenho de cultivares de rúcula sob telas de sombreamento e campo aberto

    Sérgio Batista Silva de Souza

    Full Text Available Considering the increasing economic importance and due to the lack of technical information for growing arugula in tropical regions, it was evaluated the performance of arugula cultivated under different shade screens and at open field. Eight treatments were evaluated in a 2x4 factorial design, with two cultivars (Cultivada and Folha Larga x four crop environments (open field, greenhouse shading with 30%, 40% and 50%, with four replications in randomized blocks. The evaluated were plant height, leaf number, fresh and dry matter of the above ground part. Cultivars Folha Larga and Cultivada, showed satisfactory yield: that production in the open field showed acceptable values, showing viable cultivation in the winter in Cáceres-MT, even in warm temperatures, especially for early harvest at around 37 days after sowing. However, cultivation of arugula is favored using 50% shade screen, which can increase the production about 43%.Pelo crescente aumento da importância econômica e perante a escassez de informações técnicas para o cultivo da rúcula em regiões tropicais, avaliou-se o desempenho de rúcula cultivada sob diferentes telados de sombreamento e a campo aberto. Foram avaliados oito tratamentos em esquema fatorial 2x4, sendo duas cultivares (Cultivada e Folha Larga x quatro ambientes de cultivo (campo aberto, telado com sombrite 30%, 40% e 50% com quatro repetições, em blocos casualizados. As características avaliadas foram altura da planta, número de folhas e massas de matéria fresca e de matéria seca parte aérea. Foi observado que as cultivares Folha Larga e Cultivada apresentaram produção satisfatória: a produção em campo aberto apresentou valores aceitáveis, mostrando-se viável o cultivo no período de inverno em Cáceres-MT, mesmo sob temperaturas cálidas, principalmente para colheitas antecipadas por volta dos 37 dias após a semeadura. Porém, o cultivo de rúcula é favorecido sob tela preta 50%, que pode

  6. Geological Dating by 40 Ar - 39 Ar method

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  7. 40Ar/39Ar age calibration against counted annuallayers

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  8. A POTÊNCIA DIDÁTICA DOS RECURSOS EDUCACIONAIS ABERTOS PARA A DOCÊNCIA NA CONTEMPORANEIDADE. THE DIDACTICAL FRUITFULNESS OF OPEN EDUCATIONAL RESOURCES FOR TEACHING NOWADAYS

    Lucila Pesce

    2013-01-01

    O presente artigo discute sobre a fecundidade didática dos recursos educacionais abertos (REA), para a docência na contemporaneidade, trazendo uma reflexão, a partir da contextualização política e cultural, em consonância com a necessária leitura crítica das tecnologias da informação e comunicação (TIC). Inicia com um panorama do atual contexto político brasileiro sobre formação de professores para o uso pedagógico das TIC. Prossegue com um brevíssimo delineamento de alguns dispositivos digit...

  9. Progressão atípica de perda visual em paciente com glaucoma primário de ângulo aberto

    Marcelo Mendes Lavezzo

    2014-01-01

    Full Text Available A dolicoectasia da artéria carótida interna (ACI é uma condição rara que pode ser acompanhada de manifestações neuro-oftalmológicas, como perda da acuidade e alteração do campo visual decorrente da compressão do nervo óptico (NO. O objetivo é relatar um caso de paciente do sexo masculino, 67 anos, portador de glaucoma primário de ângulo aberto (GPAA com evolução atípica, assimetria de escavação, palidez da rima do NO à esquerda, devido à neuropatia óptica compressiva à esquerda, por segmento dolicoectásico da ACI. O diagnóstico foi baseado na história clínica, aspecto do NO e exames de neuroimagem.

  10. Recursos Educacionais Abertos (REA: modelos para localização e adaptação / Open educational resources (OER: models for adaptation and localization

    Tel Amiel

    2011-04-01

    Full Text Available Neste artigo apresentamos questões relativas à localização e adaptação de recursos educacionais digitais. Começamos com uma discussão sobre objetos de aprendizagem (OA e recursos educacionais abertos (REA. Apresentamos três estratégias que podem auxiliar designers, professores e usuários a refletir sobre a possibilidade de reuso, localização, e adaptação cultural de recursos educacionais digitais.AbstractIn this article we present concerns regarding localization of digital educational resources. We begin with a discussion regarding learning objects (LO and open educational resources (OER. Finally we present three strategies that can help designers, teachers, and users to think about the reuse, localization, and cultural repurposing of digital educational resources.

  11. ANALYSIS OF THE RELATIONSHIP BETWEEN DISCLOSED VOLUME OF INVESTMENT IN INFORMATION SYSTMES AND MARKET VALUE OF OPEN CAPITAL BRAZILIAN COMPANIES IN THE ELECTRIC ENERGY SECTOR ANÁLISE DA RELAÇÃO ENTRE VOLUME DE INVESTIMENTOS EM SISTEMAS DE INFORMAÇÃO DIVULGADOS E VALOR DE MERCADO DAS EMPRESAS BRASILEIRAS DE CAPITAL ABERTO DO SETOR DE ENERGIA ELÉTRICA

    Cássia Maria Gurgel Marinho Fernandes

    2007-07-01

    2004. O investimento em sistemas de informação foi identificado no Relatório da Administração das empresas por meio dos seguintes termos: sistemas de informação, tecnologia da informação, obras de geração,distribuição e transmissão de energia elétrica, expansão, manutenção e segurança dos sistemas, telecomunicações, comércio eletrônico, e-business, Planejamento de Recursos Empresariais (ERP e treinamento e desenvolvimento do profissional. A metodologia utilizada neste trabalho envolve regressões log-lineares estimadas por Ordinary Least Squares (OLS para dados em panel data, em que há uma combinação de séries temporais com dados transversais (cross-section. Foram testados os três tipos de panel data (intercepto comum ou pooled regression, efeitos fixos e efeitos aleatórios de modo a garantir robustez aos resultados. Os resultados da pesquisa corroboram a hipótese H1, de que o valor investido em sistemas de informação, divulgado nos relatórios de administração anuais das empresas brasileiras de capital aberto do setor de energia elétrica, influencia o valor de mercado destas empresas. A hipótese H2, de que a magnitude da variação desse valor está em função da variação no investimento em sistemas de informação, foi rejeitada nesta pesquisa. Palavras-chave: Sistemas de informação. Investimentos. Valor de mercado.

  12. The 38Ar(p,d)37Ar reaction

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  13. Variants in RBP4 and AR genes modulate age at onset in familial amyloid polyneuropathy (FAP ATTRV30M).

    Santos, Diana; Coelho, Teresa; Alves-Ferreira, Miguel; Sequeiros, Jorge; Mendonça, Denisa; Alonso, Isabel; Lemos, Carolina; Sousa, Alda

    2016-05-01

    Familial amyloid polyneuropathy (FAP) ATTRV30M is a neurodegenerative disorder due to point mutations in the transthyretin gene, with V30M being the commonest. FAP ATTRV30M shows a wide variation in age at onset (AO) between clusters, families and generations. Portuguese patients also show remarkable AO differences between genders. Genes found to be associated with FAP ATTRV30M pathways may act as AO modifiers. Our aim was to further explore the role of APCS and RBP4 genes and to study for the first time the involvement of sex-linked genetic modifiers - AR and HSD17B1 genes - in AO variation in Portuguese families. We collected DNA from a sample of 318 patients, currently under follow-up. A total of 18 tagging SNPs from APCS, RBP4, AR and HSD17B1 and 5 additional SNPs from APCS and RBP4 previously studied were genotyped. To account for nonindependency of AO between members of the same family, we used generalized estimating equations (GEEs). We found that APCS and RBP4 were associated with late AO. In addition, rs11187545 of the RBP4 was associated with an early AO. For the AR, in the male group three SNPs were associated with an early AO, whereas in the female group four were associated with both an early and later AO. These results strengthened the role of APCS and RBP4 genes and revealed for the first time the contribution of AR genes as an AO modifier in both males and females. These findings may have important implications in genetic counseling and for new therapeutic strategies. PMID:26286643

  14. 40Ar-39Ar geochronology and thermochronology: principles and potential

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  15. Electron scattering from 36Ar and 40Ar

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  16. Ars Poetica : [luuletused] / Mats Traat

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  17. MEMS AO for Planet Finding

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; Jung, Paul

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  18. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  19. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias

    Marcelo Souza Hadlich

    2012-10-01

    Full Text Available FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine. Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de código aberto capaz de manipular imagens DICOM de exames de angiotomografia de coronárias. MÉTODOS: Desenvolvemos e testamos o software intitulado ImageLab na avaliação de 100 exames selecionados de forma randômica por meio de um banco de dados. Foram realizadas 600 análises divididas por dois observadores utilizando o ImageLab e um outro software comercializado junto a aparelhos de tomografia computadorizada Philips Brilliance, na avaliação da presença de lesões e placas coronarianas nos territórios do Tronco da Coronária Esquerda (TCE e na Artéria Descendente Anterior (ADA. Para avaliar as concordâncias intraobservador, interobservadores e intersoftware, utilizamos concordância simples e estatística Kappa. RESULTADOS: As concordâncias observadas entre os softwares foram em geral classificadas como substancial ou quase perfeitas na maioria das comparações. CONCLUSÃO: O software ImageLab concordou com o software Philips na avaliação de exames de angiotomografia de coronárias especialmente em pacientes sem lesões, com lesões inferiores a 50% no TCE e inferiores a 70% na ADA. A concordância para lesão >70% na ADA foi menor, porém isso também é observado quando se utiliza o padrão de referência anatômico.

  20. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  1. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  2. Analysis list: AR [Chip-atlas[Archive

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  3. Analysis list: Ar [Chip-atlas[Archive

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  4. Estudo terapêutico aberto com sulfato de aminosidine na leishmaniose mucosa causada for Leishmania (viannia braziliensis

    Gustavo A.S. Romero

    1996-12-01

    Full Text Available No período de setembro a novembro de 1994 foram tratados 21 pacientes com leishmaniose mucosa ativa, predominantemente adultos lavradores do sexo masculino, com sulfato de aminosidine intramuscular, I6mg/kg/dia por 20 dias. Treze pacientes eram virgens de tratamento e 8 haviam sido tratados sem sucesso com Glucantime®". O diagnóstico baseou-se inicialmente em crítêrios epidemiolôgicos, clínicos e nos resultados da intrademoireação de Montenegro e a imunofluorescência indireta para anticoipos séricos antileishmânia e durante o acompanhamento nos resultados dos estudos parasitológicos. Sessenta e sete por cento dos pacientes tiveram diagnóstico parasitológico confirmado sendo a inoculação do material de biópsia das lesões em hamsters o método mais sensível. O tempo médio de acompanhamento foi de 12,6 meses. A adesão ao tratamento foi de 100%. Os efeitos colaterais foram dor no local da injeção (86%, proteinúria leve (24%, elevação do nível sérico de creatinina (5% e perda auditiva subclínica em um dos dois pacientes que realizaram audiometria. Obsevou-se cura clínica em 48% dos pacientes e a percentagem acumulada de recidiva foi de 29% (4/14pacientes durante o acompanhamento.

  5. Cometas: Das Lendas aos Fatos

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  6. Restrição materna de polifenóis e dinâmica ductal fetal na gestação normal: um ensaio clínico aberto

    Paulo Zielinsky

    2013-09-01

    Full Text Available FUNDAMENTOS: Recentemente demonstramos reversão da constrição ductal fetal após redução da ingesta materna de alimentos ricos em polifenóis (ARP, por sua ação inibidora da síntese das prostaglandinas. OBJETIVOS: Testar a hipótese de que fetos normais no 3º trimestre também melhoram a dinâmica ductal após restrição materna de polifenóis. MÉTODOS: Ensaio clínico aberto com 46 fetos com idade gestacional (IG > 28 semanas submetidos a dois estudos Dopplerecocardiográficos com intervalo de duas semanas, sendo os examinadores cegados para os hábitos alimentares maternos. Um questionário de frequência alimentar validado para esse objetivo foi aplicado e uma dieta com alimentos pobres em polifenóis (< 30 mg/100 mg foi orientada. Um grupo controle de 26 fetos no 3º trimestre foi submetido ao mesmo protocolo. Utilizou-se o teste-t para amostras independentes. RESULTADOS: A IG média foi 33 ± 2 semanas. A média do consumo materno diário de polifenóis (CMDP foi 1277 mg, caindo para 126 mg após orientação (p = 0,0001. Ocorreu diminuição significativa nas Velocidades Ductais Sistólica (VSD e Diastólica (VDD e na relação dos diâmetros ventriculares (VD/VE, assim como aumento do índice de pulsatilidade (IP [VSD = 1,2 ± 0,4 m/s (0,7-1,6 para 0,9 ± 0,3 m/s (0,6-1,3 (p = 0,018;VDD = 0,21 ± 0,09 m/s (0,15-0,32 para 0,18 ± 0,06 m/s (0,11-0,25 (p = 0,016; relação VD/VE = 1,3 ± 0,2 (0,9-1,4 para 1,1 ± 0,2 (0,8 - 1,3 (p = 0,004; IP do ducto = 2,2 ± 0,03 (2,0-2,7 para 2,4 ± 0,4 (2,2-2,9 (p = 0,04]. A IG média dos controles foi de 32 ± 4 semanas, não ocorrendo diferenças significativas no CMDP, nas velocidades ductais, no IP do ducto e na relação VD/VE. CONCLUSÃO: A restrição da ingesta de alimentos ricos em polifenóis no 3º trimestre por duas semanas melhora a dinâmica do fluxo no ducto arterioso fetal e as dimensões do VD.

  7. Estudo de caso de uma pilha de milho ensacado ao ar livre

    Mexia, António; Barros, G.

    2003-01-01

    From a bag stack of stored maize, in open air, in Zimbabwe, during 30 months, samples were taken to study the influence of the factors, temperature and moisture content, in the development of stackburn in maize, seed viability and commercial grade. It was concluded that stackburned maize reduced the seed viability and the commercial grade.

  8. "Ars Electronica 2009" / Raivo Kelomees

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  9. Massagem ao bebé

    Figueiredo, Bárbara

    2007-01-01

    Apresenta-se uma revisão da investigação desenvolvida no âmbito da massagem e da estimulação táctil-cinestésica ao bebé. Descrevem-se os estudos empíricos conduzidos no sentido de avaliar os efeitos no desenvolvimento, no bem-estar e em problemas específicos do bebé de termo e prematuro. Conclui-se a respeito do impacto positivo da massagem sobre a criança, os pais e na interacção entre ambos; nomeadamente porque beneficia dois objectivos primordiais dos cuidados de ...

  10. Oldest human footprints dated by Ar/Ar

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  11. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Eneida Rejane Rabelo

    2007-02-01

    ón para el manejo de la enfermedad y el desarrollo de la capacidad de autoayuda. En este artículo revisaremos en detalle aspectos de la educación para pacientes con insuficiencia cardiaca dada por enfermeros.O principal objetivo do tratamento da insuficiência cardíaca (IC consiste em alcançar e manter a estabilidade clínica dos pacientes. Vários estudos demonstram que programas multidisciplinares para educação sistemática sobre a doença são estratégias positivas para estes pacientes. Enfermeiros engajados em clínicas de IC desempenham papel fundamental no processo de educação e acompanhamento dos pacientes. Os objetivos deste processo são ensinar, reforçar, melhorar e avaliar constantemente as habilidades dos pacientes para o autocuidado, que incluem a monitorização do peso, a restrição de sódio e de líquidos, a realização de atividade física, o uso regular das medicações, a monitorização de sinais e de sintomas de piora da doença e o contato precoce com a equipe assistencial. Desta forma, a educação para o entendimento da IC, e o desenvolvimento de habilidades para o autocuidado, são considerados chaves para melhorar a adesão, evitar crises de descompensação e conseqüentemente manter a estabilidade clínica dos pacientes. Neste artigo nos revisamos detalhadamente os aspectos envolvidos no processo de educação dispensados aos pacientes por enfermeiros no contexto das clínicas de IC.

  12. Lévi-Strauss nos 90 voltas ao passado

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  13. AR DOC: Augmented reality documentaries

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  14. ARS - Helsinki - 2006 / Galina Balashova

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  15. Ars Industrialis, arsindustrialis.org

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  16. Aerosol Observing System (AOS) Handbook

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  17. arXiv.org and Physics Education

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  18. Efeito de níveis de água, coberturas do solo e condições ambientais na temperatura do solo e no cultivo de morangueiro em ambiente protegido e a céu aberto Effect of water levels, soil covers and enviroment in maximum soil temperature in strawberry crop in field and greenhouse

    Regina C. de M. Pires

    2004-12-01

    Full Text Available A temperatura do solo é um importante parâmetro no cultivo do morangueiro, pois interfere no desenvolvimento vegetativo, na sanidade e na produção. O objetivo do presente trabalho foi avaliar o efeito de diferentes níveis de água, coberturas de canteiro em campo aberto e em ambiente protegido, na temperatura máxima do solo no cultivo do morangueiro. Foram realizados dois experimentos: um em cultivo protegido e outro a campo aberto, em Atibaia - SP, em esquema fatorial 2 x 3 (coberturas do solo e níveis de irrigação, em blocos ao acaso, com cinco repetições. As coberturas de solo utilizadas foram filmes de polietileno preto e transparente. A irrigação localizada foi aplicada por gotejo sempre que o potencial de água no solo atingisse -0,010 (N1, -0,035 (N2 e -0,070 (N3 MPa, em tensiômetros instalados a 10 cm de profundidade. A temperatura do solo foi avaliada por termógrafos, sendo os sensores instalados a 5 cm de profundidade. Houve influência do ambiente de cultivo, da cobertura do solo e dos níveis de irrigação na temperatura máxima do solo. A temperatura do solo sob diferentes coberturas dependeu não somente das características físicas do plástico, como também da forma de instalação no canteiro. A temperatura máxima do solo aumentou com a diminuição do potencial da água no solo, no momento da irrigação.The soil temperature is an important parameter in strawberry crop, because, it interferes in vegetative development, plant health conditions and yield. The aim of this work was to evaluate the effect of different water levels, soil covers in field conditions and greenhouse in maximum soil temperature in strawberry crop. Two experiments were accomplished, one in greenhouse and other in field conditions, at Atibaia - SP, Brazil. The experimental design was a factorial 2 x 3 (soil covers and water levels, with 5 repetitions. The soil covers were clear and black plastics. The trickle irrigation was applied

  19. POTENCIAL DOS RECURSOS EDUCACIONAIS ABERTOS PARA INTEGRAÇÃO DAS TECNOLOGIAS E CONVERGÊNCIA ENTRE AS MODALIDADES NA UFSM. POTENTIAL OF OPEN EDUCATIONAL RESOURCES FOR TECHNOLOGY INTEGRATION AND CONVERGENCE BETWEEN THE MODALITIES AT UFSM

    Elena Maria Mallmann

    2013-11-01

    Full Text Available O foco de análise é a implementação e o fomento de práticas escolares, para potencializar a integração das tecnologias e a convergência entre as modalidades na Universidade Federal de Santa Maria (UFSM, Brasil, por meio de Recursos Educacionais Abertos. Objetivamos sistematizar princípios conceituais e práticas que balizam a utilização de recursos educacionais abertos, com vistas a maximizar diálogo e produção curricular mediados por tecnologias. Os procedimentos metodológicos de pesquisa-ação (planejamento participativo, observação e questionários survey geraram dados para análise referente à programação e à problematização de Recursos Educacionais Abertos, em cursos de graduação e pós-graduação mediados pelo Moodle institucional. Os resultados de acoplamento da pesquisa à ação didático-metodológica inovadora na UFSM evidenciam crescimento exponencial na programação semanal de recursos e atividades de estudo no Moodle. A afirmação conclusiva destaca que a disponibilização e o suporte técnico institucional de tecnologias em rede ampliam condições para integração e convergência entre as modalidades, especialmente no âmbito dos recursos educacionais abertos como hipertextos programados em html. The analysis focus is the implementation and the fomentation of school practices in order to enhance the technology integration and the convergence between the modalities at the Federal University of Santa Maria (UFSM, Brazil, through open educational resources. We aimed to systematize conceptual principles and practices that beacon the use of open educational resources, aspiring to maximize dialogue and curricular production mediated by technologies. The action research methodological procedures (participatory planning, observation and survey questionnaires generated analysis data relative to the programming and problematization of open educational resources, in undergraduate and graduate courses mediated

  20. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias Free and open-source software application for the evaluation of coronary computed tomography angiography images

    Marcelo Souza Hadlich; Gláucia Maria Moraes de Oliveira; Feijóo, Raúl A.; Azevedo, Clerio F; Bernardo Rangel Tura; Paulo Gustavo Portela Ziemer; Pablo Javier Blanco; Gustavo Pina; Márcio Meira; Nelson Albuquerque de Souza e Silva

    2012-01-01

    FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine). Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de c...

  1. Acesso aberto à informação científica: políticas e iniciativas governamentais Acceso abierto a la información científica: políticas e iniciativas gobernamentales

    Adriana Rosecler Alcará

    2010-03-01

    Full Text Available Trata das políticas de acesso aberto à informação científica e das propostas de ação com ênfase para as iniciativas governamentais em diferentes países. Descreve as recomendações da Unesco e da IFLA. Identifica as principais iniciativas, ações e recomendações internacionais. Finaliza evidenciando peculiaridades de áreas e de formas de tratamento da questão nas políticas já estabelecidas.

  2. Paleozoic accretionary orogenesis in the eastern Beishan orogen: constraints from zircon U-Pb and 40Ar/39Ar geochronology

    Ao, Songjian; Xiao, Wenjiao; Windley, Brian; Mao, Qigui

    2016-04-01

    The continental growth mechanism of the Altaids in Central Asia is still in controversy between models of continuous subduction-accretion versus punctuated accretion by closure of multiple oceanic basins. The Beishan orogenic belt, located in the southern Altaids, is a natural laboratory to address this controversy. Key questions that are heavily debated are: the closure time and subduction polarity of former oceans, the emplacement time of ophiolites, and the styles of accretion and collision. This paper reports new structural data, zircon ages and Ar-Ar dates from the eastern Beishan Orogen that provide information on the accretion process and tectonic affiliation of various terranes. Our geochronological and structural results show that the younging direction of accretion was northwards and the subduction zone dipped southwards under the northern margin of the Shuangyingshan micro-continent. This long-lived and continuous accretion process formed the Hanshan accretionary prism. Our field investigations show that the emplacement of the Xiaohuangshan ophiolite was controlled by oceanic crust subduction beneath the forearc accretionary prism of the Shuangyingshan-Mazongshan composite arc to the south. Moreover, we address the age and terrane affiliation of lithologies in the eastern Beishan orogen through detrital zircon geochronology of meta-sedimentary rocks. We provide new information on the ages, subduction polarities, and affiliation of constituent structural units, as well as a new model of tectonic evolution of the eastern Beishan orogen. The accretionary processes and crustal growth of Central Asia were the result of multiple sequences of accretion and collision of manifold terranes. Reference: Ao, S.J., Xiao, W., Windley, B.F., Mao, Q., Han, C., Zhang, J.e., Yang, L., Geng, J., Paleozoic accretionary orogenesis in the eastern Beishan orogen: Constraints from zircon U-Pb and 40Ar/39Ar geochronology. Gondwana Research, doi: http://dx.doi.org/10.1016/j

  3. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  4. Conteúdos abertos e compartilhados: novas perspectivas para a educação Open and shared contents: new perspectives for education

    Osmar Mantovani

    2006-04-01

    Full Text Available Mudanças em curso no cenário de produção e divulgação de conhecimentos bem como algumas questões importantes indutoras de tais mudanças são apontadas. A principal é o desbalanceamento, cada vez maior, entre os interesses da indústria cultural e os da sociedade, em favor da primeira, provocado, em anos recentes, por mudanças sucessivas no direito de propriedade intelectual por pressão da mesma indústria cultural que tem, hoje, o seu modelo de negócio ameaçado por práticas apoiadas por novas tecnologias de informação e comunicação e, especificamente, pela Internet. Tal desbalanceamento cerceia, em particular, a escola na escolha dos recursos mais apropriados para a educação de seus alunos. Um contramovimento promove "conteúdos abertos". Um ambiente que foi desenhado para apoiar a comunidade escolar na publicação e no compartilhamento de conteúdos para, dessa forma, ajudá-la a promover uma educação com parâmetros mais democráticos e adequados às transformações em curso é apresentado.Ongoing changes in the scenario of knowledge production and dissemination as well as some of the important issues that induced them are pointed out. The main one is an increasing shift of balance from the interests of society to those of the culture industry promoted, these last years, by successive amendments to the intellectual property rights. These were passed under the pressures of that industry whose business model is nowadays threatened by the practices supported by the new information and communication technologies and the Internet in particular. Such shift of balance specifically limits schools in their choices of the most appropriate resources to educate their students. A counter-movement is promoting "open contents" through an environment, presented here, designed to support the school community in publishing and sharing tasks. It is aimed at helping that community promote an education with more democratic and better

  5. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  6. Beta decay of 31Ar

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  7. Plântulas de soja 'Tracajá' expostas ao ozônio sob condições controladas Soybean 'Tracajá' seedlings exposed to ozone under controlled conditions

    Patricia Bulbovas; Silvia Ribeiro de Souza; Regina Maria de Moraes; Flávio Luizão; Paulo Artaxo

    2007-01-01

    O objetivo deste trabalho foi avaliar o crescimento inicial, acúmulo de biomassa, trocas gasosas e defesas antioxidativas de soja 'Tracajá', cultivada na Região Amazônica, exposta ao ozônio sob condições controladas. Sementes germinadas em vasos foram levadas para duas câmaras, uma com ar filtrado (AF) e outra com ar filtrado mais 30 ppb de ozônio (AF + O3). Aos 10 e 20 dias após a semeadura, as trocas gasosas, crescimento em altura e acúmulo de biomassa foram medidos; aos 20 dias após a seme...

  8. Repositório Virtual de Acesso Aberto em Agricultura & Aquicultura: compartilhar e valorizar pesquisas científicas e acadêmicas relacionadas com a agricultura, aquicultura, alimentação e meio ambiente. (http://voa3r.eu)

    Aventurier, Pascal; Le Hénaff, Diane

    2011-01-01

    VOA3R é um projeto europeu de 3 anos (2010-2012, ICT Policy Support Program, Seventh Framework Programme - FP7) que visa compartilhar conhecimentos científicos nas áreas de agricultura para alimentos, aquicultura e meio ambiente a partir de arquivos abertos de parceiros europeus e internacionais. As organizações com arquivos abertos nos temas do projeto estão convidadas a disponibilizá-los no VOA3R. O VOA3R é um consórcio constituído por 14 parceiros de 10 países : - UAH (Universidad...

  9. Ars discendi, ars docendi : programme Pascal

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  10. 40Ar/39Ar dating of the Late Cretaceous

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  11. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  12. Triaxial superdeformation in $^{40}$Ar

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  13. Ars grammatica de Dionisio Tracio

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  14. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    Anna Luiza de Fátima Pinho Lins Gryschek

    2000-09-01

    Full Text Available Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como necessidades de qualificação foram apontadas: biossegurança, preparo e administração de medicamentos específicos e assistência de enfermagem aos clientes com HIV e Aids.This study discourses about the especific training needs of the nursing teams of the Centers of Reference of Sexual Transmissible Diseases (STD and Aids from the STD/Aids Program of the Health Secretary of the Township of São Paulo for the assistance of clients with HIV and Aids. From a total of 671 nursing workers, 453 answered the questionnaire. They identified the following training needs: contents related to standard precautions, preparation and administration of specific drugs and other general nursing care to HIV + clients.

  15. Cartografar é traçar um plano comum

    Virgínia Kastrup

    2013-08-01

    Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

  16. A EDUCAÇÃO DE ADULTOS E O PROGRAMA DE COMBATE AO ANALFABETISMO EM PRESIDENTE PRUDENTE

    Cristiano A. G. Di Giorgi

    2009-12-01

    Full Text Available Neste artigo, após traçar breve quadro do histórico e da situação atual da Educação de Adultos no País, descrevemos o programa "Combate ao Analfabetismo" desenvolvido pela Prefeitura Municipal de Presidente Prudente, cuja direção pedagógica esta a cargo da FCT/UNESP - Campus de Presidente Prudente. Apontamos os principais problemas didático-pedagógicos e administrativos colocados ao programa e as soluções que foram encontradas.

  17. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  18. AoB PLANTS: origins and features

    Jackson, Michael B.

    2009-01-01

    Introduction AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Background Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access h...

  19. 244-AR Vault Interim Stabilization Project Plan

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  20. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  1. The Coronae of AR Lac

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  2. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  3. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  4. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  5. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  6. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  7. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  8. 39Ar/Ar measurements using ultra-low background proportional counters

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  9. Ilha das Flores, estatura e peso em crianças dos 6 aos 11 anos.

    Antunes, Maria A. G.

    1990-01-01

    IV Expedição Científica do Departamento de Biologia – Flores 1989. 0s estudos de crescimento físico humano têm-se revelado de grande interesse pois permitem conhecer as características de diferentes populações e a variabilidade existente intra e interpopulações. Mas um dos aspectos mais importantes destes estudos talvez o de, ao se analisar o estado de crescimento e tempo de desenvolvimento do indivíduo, permitir destrinçar factores que influenciam nefastamente o crescimento. ...

  10. arXiv.org and Physics Education

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  11. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  12. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  13. O museu aberto e comunicativo : fundamentação e proposta para estudos de públicos à luz de um enfoque info-comunicacional

    Beites, Alexandre Manuel Rodrigues

    2011-01-01

    Os estudos de públicos aplicados ao universo museológico sofreram uma evolução que transitou sem grande efectividade ate um momento - o actual, em que lhes são exigidos resultados uteis. Vive-se uma "encruzilhada" metodológica para a qual esta dissertação pretende contribuir com uma proposta. Apostar no registo e tratamento dos dados info-comunicacionais do visitante como matéria-prima será o ponto de partida para uma estratégia, que se quer qualitativa, integradora de varias disciplinas e co...

  14. Prolonged plume volcanism in the Caribbean Large Igneous Province: New insights from Curaçao and Haiti

    Loewen, Matthew W.; Duncan, Robert A.; Kent, Adam J. R.; Krawl, Kyle

    2013-10-01

    We present 36 new 40Ar-39Ar incremental heating age determinations from the Caribbean Large Igneous Province (CLIP) providing evidence for extended periods of volcanic activity and suggest a new tectonomagmatic model for the province's timing and construction. These new 40Ar-39Ar ages for the Curaçao Lava Formation (CLF) and Haiti's Dumisseau Formation show evidence for active CLIP volcanism from 94 to 63 Ma. No clear changes in geochemical character are evident over this period. The CLF has trace element signatures (e.g., Zr/Nb = 10-20) and flat rare earth element (REE) trends consistent with plume volcanism. The Dumisseau Formation also has plume-like geochemistry and steeper REE trends similar to ocean island basalts. Volcanism in the Dumisseau Formation appears to have largely ceased by 83 Ma while at Curaçao it continued until 63 Ma. A rapidly surfacing and melting plume head alone does not fit this age distribution. Instead, we propose that the residual Galapagos plume head, following initial ocean plateau construction, was advected eastward by asthenospheric flow induced by subducting oceanic lithosphere. Slab rollback at the Lesser Antilles and Central America subduction zones created an extensional regime within the Caribbean plate. Mixing of plume with upwelling asthenospheric mantle provided a source for intermittent melting and eruption through the original plateau over a ˜30 Ma period.

  15. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  16. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  17. Revis\\~ao da Constru\\c{c}\\~ao de Modelos Supersim\\'etricos

    Rodríguez, M C

    2001-01-01

    Foi com base neste estudo que fizemos a constru\\c{c}\\~ao da vers\\~ao supersim\\'etrica dos modelos de simetria $SU(3)_{C} \\otimes SU(3)_{L} \\otimes U(1)_{N}$ \\cite{susy331}, apresentado no final da minha tese de doutorado \\cite{mcr1}. Bem como dos estudos fenomenol\\'ogicos subsequente \\cite{mcr}.

  18. Into the Blue: AO Science with MagAO in the Visible

    Close, Laird M; Follette, Katherine B; Hinz, Phil; Morzinski, Katie M; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-01-01

    We review astronomical results in the visible ({\\lambda}<1{\\mu}m) with adaptive optics. Other than a brief period in the early 1990s, there has been little astronomical science done in the visible with AO until recently. The most productive visible AO system to date is our 6.5m Magellan telescope AO system (MagAO). MagAO is an advanced Adaptive Secondary system at the Magellan 6.5m in Chile. This secondary has 585 actuators with < 1 msec response times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve <30mas resolutions, 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R < 8 mag stars. These relatively high visible wavelength Strehls are made possible by our powerful combination of a next generation ASM and a Pyramid WFS with 378 controlled modes and 1000...

  19. Ao encontro do equilíbrio

    Freitas, Licínia Marisa Oliveira

    2013-01-01

    O presente Relatório apresenta as atividades desenvolvidas ao longo de todo o período de estágio referentes ao módulo I e II. O módulo I teve por base a primeira e segunda fase do Planeamento em Saúde, que se refere ao Diagnóstico de Situação de Saúde da população com patologia de Diabetes Mellitus e Priorização das Necessidades. No módulo II surgiram os projetos de intervenção nas necessidades detetadas e avaliação das mesmas com a verificação dos ganhos em saúde observados. Numa primeira...

  20. Into the blue: AO science with MagAO in the visible

    Close, Laird M.; Males, Jared R.; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-08-01

    We review astronomical results in the visible (λresponse times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve Pyramid WFS with 378 controlled modes and 1000 Hz loop frequency. We'll review the key steps to having good performance in the visible and review the exciting new AO visible science opportunities and refereed publications in both broad-band (r,i,z,Y) and at Halpha for exoplanets, protoplanetary disks, young stars, and emission line jets. These examples highlight the power of visible AO to probe circumstellar regions/spatial resolutions that would otherwise require much larger diameter telescopes with classical infrared AO cameras.

  1. Ars ornata / Kadri Mälk

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  2. "Ars Ornata" Mediterrania / Kadri Mälk

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  3. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  4. Craving decrease with topiramate in outpatient treatment for cocaine dependence: an open label trial Diminuição da fissura com topiramato no tratamento ambulatorial para dependência de cocaína: um ensaio clínico aberto

    Alessandra Diehl Reis

    2008-06-01

    Full Text Available OBJECTIVE: To evaluate anticraving action and tolerability of topiramate in cocaine user treatment. METHOD: Male users of inhaled cocaine which met criteria for cocaine dependence (Diagnostic and Statistical Manual of Mental Disorders, fourth edition were selected for outpatient 12-week, open label trial with topiramate; individual dosage ranged between 25-300 mg/day. Main clinical variables were abstinence rate, craving intensity, frequency and duration, adherence, dropouts, side effects and impulsivity measure through Barratt Impulsivity Scale. Patients received assertive strategic counseling for abstinence assistance and medication monitoring evaluation every two weeks. Comparative analysis was made with intention to treat, missing values were replaced (last observation carried forward, and significance level was 5%. RESULTS: Adherence to treatment was 57% (at least three evaluations, 32% dropped out (one evaluation. There were no severe side effects. Negative test average was 25.4% (31.2. Significant reduction in craving intensity and duration was observed in 25% of the sample. No statistical significant reduction in craving frequency was observed in 7.1%. Increase in frequency was observed in 10.7% and 82.1% did not present any variation. No significant statistical variations in Barratt Impulsivity Scale or in the total score were found in the final evaluation when compared to baseline. CONCLUSION: More randomized placebo-controlled trials with topiramate for cocaine dependants should be performed to evaluate preliminary evidence.OBJETIVO: Avaliar a ação anticraving e tolerabilidade do topiramato em usuários de cocaína. MÉTODO: Homens usuários de cocaína inalada que preenchiam critérios para dependência de cocaína (Manual Diagnóstico e Estatístico de Desordens Mentais, quarta edição foram selecionados para 12 semanas de tratamento ambulatorial, em ensaio clínico aberto com topiramato; dosagens escalonadas entre 25-300 mg

  5. The mass of 32Ar and 33Ar for fundamental tests

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  6. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  7. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  8. LÓGICA DIAGNÓSTICA EM SERVIÇOS ABERTOS DE SAÚDE MENTAL: TENSÕES ENTRE PSIQUIATRIA E PSICANÁLISE

    Fuad Kyrillos Neto

    2014-09-01

    Full Text Available O objetivo desse artigo é oferecer uma contribuição ao debate acerca da questão das lógicas diagnósticas no campo da saúde mental no Brasil. Para isso, contextualiza-se brevemente o movimento da Reforma Psiquiátrica. Posteriormente, apresentam-se fragmentos de um caso clínico atendido em um Centro de Atenção Psicossocial (CAPS. A partir desse caso, o texto se desenvolve no sentido de discutir as tensões e consequências para a condução do tratamento em referenciais diagnósticos distintos: a classificação Diagnostic and Statistical Manual of Mental Disorders (DSM e a psicopatologia psicanalítica. Um deles refere-se aos manuais estatísticos utilizados pela psiquiatria contemporânea, fundado no conceito de transtorno mental, enquanto o outro se refere ao campo da psicanálise e o diagnóstico estrutural. Dessa forma, o argumento aproxima-se da discussão sobre a utilização de uma razão diagnóstica profícua para a proposta da Reforma Psiquiátrica Brasileira. Conclui-se que a psiquiatria contemporânea se organiza em torno de uma lógica diagnóstica que leva à alienação dos sujeitos em um discurso pretensamente universal que os impossibilita de reconhecer sua singularidade no campo social. Por outro lado, observa-se a possibilidade da clínica psicanalítica manter-se em consonância com os objetivos da reforma. O diagnóstico em psicanálise serve para orientar o tratamento a fim de que o sujeito possa se posicionar de modo menos dependente no laço social, a partir de uma aposta na singularidade do sujeito e sua desalienação.

  9. 40Ar/39Ar age and thermal history of the Kirin chondrite

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  10. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  11. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  12. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    2008-01-01

    O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  13. Into the Blue: AO Science in the Visible with MagAO

    Close, Laird; Males, Jared; Morzinski, Katie; Kopon, Derek; Follette, Kate; Rodigas, Timothy; Hinz, Philip; Wu, Ya-Lin; Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Uomoto, Alan; Hare, Tison

    2013-12-01

    The Magellan Clay telescope is a 6.5m Gregorian telescope located in Chile at Las Campanas Observatory. We have fabricated an 85 cm diameter aspheric adaptive secondary with our subcontractors and partners, MagAO passed acceptance tests in spring 2012, and the entire System was commissioned from Nov 17 to Dec 7, 2012. This secondary has 585 actuators with response times (0.7 ms typically). We fabricated a high order (585 mode) pyramid wavefront sensor (similar to that of LBT's FLAO). The relatively high actuator count allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We have built an CCD science camera called "jVisAO". On-sky long exposures (60s) achieve 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R Pyramid WFS with 200-400 controlled modes and 1000 Hz loop frequencies. To minimize non-common path errors and enable visible AO the VisAO science camera is fed by an advanced triplet ADC and is piggy-backed on the WFS optical board itself. Despite the ability to make 25 mas images we still have ~4 mas of resolution loss to residual vibrations. We will discuss what the most difficult aspects are for visible AO on ELTs scaling from our experience with MagAO.

  14. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  15. Characterization of an AO-OCT system

    Evans, J W; Zawadzki, R J; Jones, S; Olivier, S; Werner, J S

    2007-07-26

    Adaptive optics (AO) and optical coherence tomography (OCT) are powerful imaging modalities that, when combined, can provide high-volumetric-resolution, images of the retina. The AO-OCT system at UC Davis has been under development for 2 years and has demonstrated the utility of this technology for microscopic, volumetric, in vivo retinal imaging [1]. The current system uses an AOptix bimorph deformable mirror (DM) for low-order, high-stroke correction [2] and a 140-actuator Boston Micromachines DM for high-order correction [3]. We are beginning to investigate the potential for increasing the image contrast in this system using higher-order wavefront correction. The first step in this analysis is to quantify the residual wavefront error (WFE) in the current system. Developing an error budget is a common tool for improved performance and system design in astronomical AO systems [4, 5]. The process for vision science systems is also discussed in several texts e.g. [6], but results from this type of analysis have rarely been included in journal articles on AO for vision science. Careful characterization of the AO system will lead to improved performance and inform the design of a future high-contrast system. In general, an AO system error budget must include an analysis of three categories of residual WFE: errors in measuring the phase, errors caused by limitations of the DM(s), and errors introduced by temporal variation. Understanding the mechanisms and relative size of these errors is critical to improving system performance. In this paper we discuss the techniques for characterizing these error sources in the AO-OCT system. It is useful to first calculate an error budget for the simpler case using a model eye, and then add the additional errors introduced for the case of a human subject. Measurement error includes calibration error, wavefront sensor (WFS) CCD noise, and sampling errors. Calibration errors must be measured by an external system. Typically this

  16. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  17. A indústria de publicação contra o acesso aberto La industria de publicación contra el acceso abierto The publishing industry against open access journals

    Kenneth Rochel de Camargo Jr

    2012-12-01

    Full Text Available A publicação em revistas de acesso aberto cresceu expressivamente nos últimos anos. As publicações de acesso fechado, por sua vez, têm custo de acesso cada vez mais elevado, por se beneficiarem de um modelo econômico peculiar: o trabalho relevante e os insumos essenciais são entregues gratuitamente a fornecedores que contam com um mercado cativo, praticamente sem concorrência. O mercado editorial é altamente oligopolizado, característico de indústrias que trabalham com o regime de copyright. Isso contribui para a elevação dos preços de seus produtos. Políticas mandatórias de acesso aberto, como a determinada pela agência National Institutes of Health, constituem-se em ameaça a esse modelo de negócios e são enfrentadas pela indústria em várias frentes, incluindo a passagem de legislação para sabotar tais iniciativas. O objetivo deste comentário foi apresentar alguns aspectos principais desse enfrentamento e sugerir possíveis estratégias de incremento da publicação de acesso aberto em nosso meio.La publicación en revistas de acceso abierto creció expresivamente en los últimos años. Las publicaciones de acceso cerrado, por su parte, tienen costo de acceso cada vez más elevado, por beneficiarse de un modelo económico peculiar: el trabajo relevante y los insumos esenciales son entregados gratuitamente a los proveedores que cuentan con un mercado cautivo, prácticamente sin concurrencia. El mercado editorial es altamente monopolizado, característico de industrias que trabajan con el régimen de copyright. Esto contribuye a la elevación de los precios de sus productos. Políticas obligatorias de acceso abierto, como la determinada por el National Institutes of Health, constituyen amenazas a este modelo de negocios y son enfrentadas por la industria en varios ángulos, incluyendo el paso de legislación para sabotear tales iniciativas. El objetivo de este comentario fue presentar algunos aspectos principales de este

  18. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  19. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  20. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  1. FATORES ASSOCIADOS AO BAIXO PESO AO NASCER NO ESTADO DE GOIÁS

    Ruth Minamisava

    2004-12-01

    Full Text Available Recém-nascidos de baixo peso ao nascer (RNBP são considerados problemas de saúde pública pela associação com altas taxas de mortalidade e morbidade. Nenhum estudo prévio sobre fatores associados ao RNBP na região central do Brasil foi encontrado na literatura. Assim, este estudo teve como objetivo identificar as prevalências e os fatores associados ao baixo peso ao nascer entre nascidos vivos no Estado de Goiás, Brasil. Foi realizado um estudo transversal tendo como fonte de dados o Sistema de Informações de Nascidos Vivos ligado ao Ministério da Saúde. Examinou-se todos os 92.745 recém-nascidos de gestação única residentes no estado de Goiás, no ano 2000. Usou-se análise de regressão logística para identificar os fatores associados ao RNBP (< 2500 g. Em Goiás, os RNBP apresentaram uma prevalência de 5,96% e os fatores associados ao baixo peso ao nascer foram: prematuridade, baixa e avançada idade materna, mulheres não casadas, menos de sete consultas de pré-natal, parto não hospitalar e neonatos do sexo feminino. Ações intersetoriais são necessárias para reduzir as desigualdades da saúde materna e infantil.

  2. Cosmologia e Representa\\c{c}\\~ao

    Ribeiro, Marcelo Byrro

    2013-01-01

    This work presents a brief and non-technical description of the main results and concepts of the modern scientific cosmology, viewing it from an epistemological perspective which allows a dialog with other modes of thinking like e.g. history, philosophy, sociology and religion. This epistemological viewpoint is based on the philosophical theses advanced by Ludwig Boltzmann (1844-1906) which states that scientific theories are nothing more than representations, or images, of nature (arXiv:phys...

  3. Experimental comparison of Wide Field AO control schemes using the Homer AO bench.

    Parisot, Amélie; Petit, Cyril; Fusco, Thierry

    2011-09-01

    Wide Field Adaptive Optics (WFAO) concepts, such as Laser Tomography AO (LTAO) or Multi-Conjugate AO (MCAO) have been developed in order to overcome the anisoplanatism limit of classical AO. Most of the future AO-assisted instruments of ELTs rely on such concepts which have raised critical challenges such as tomographic estimation and from laser and natural guide star combined with efficient DM(s) control. In that context, the experimental validation of the various clever control solutions proposed by several teams in the past years is now essential to reach a level of maturity compatible with their implementation in future WFAO developments for ELT. The ONERA wide field AO facility (HOMER bench) has been developed for these very issues. Gathering a 3D turbulence generator, laser and natural guide stars, two deformable mirrors with variable altitude positions and a PC-based flexible and user-friendly RTC , HOMER allows the implementation and comparison of control schemes from the simplest least-square to the optimal Linear Quadratic Gaussian solutions including Virtual DM and Pseudo-closed loop approaches. After a description of the bench internal calibrations and ultimate performance, all the control schemes are compared experimentally. Their evolutions as a function of wavefront sensors SNR as well as their robustness to calibration / model errors are particularly emphasised. Finally, we derive from the previous works some specific calibrations and identifications procedures ensuring both robustness and efficiency of WFAO systems and we extrapolate their applications to the future ELT AO systems.

  4. K/Ar ages from basal gneiss region

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  5. Ar-41 measurements and nuclear emergency preparedness

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  6. Improved Ar(II) transition probabilities

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  7. Online Scene Modeling for Interactive AR Applications

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  8. AR-扩增实境

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  9. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  10. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  11. Análise de Risco aplicada aos alimentos no Brasil: perspectivas e desafios Risk Analysis applied to food safety in Brazil: prospects and challenges

    Ana Virgínia de Almeida Figueiredo; Maria Spínola Miranda

    2011-01-01

    Trata-se de um estudo de caso no qual se discutiram as ideias do Comitê do Codex Alimentarius do Brasil (CCAB), coordenado pelo Instituto Nacional de Metrologia, Normalização e Qualidade Industrial (Inmetro) sobre a norma Codex Alimentarius de Análise de Risco aplicada aos alimentos (AR). Os objetivos deste trabalho foram identificar e analisar a opinião dos membros do CCAB sobre AR e levantar as propostas para a adoção desta norma no país, destacando as limitações e as potencialidades locais...

  12. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  13. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  14. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  15. Comparação entre os sistemas aberto e fechado de aspiração: revisão sistemática Comparison between open and closed suction systems: a systematic review

    Izabela Menezes Pagotto

    2008-12-01

    Full Text Available OBJETIVOS: Este estudo foi realizado para tentar esclarecer qual sistema de aspiração é mais eficiente. O objetivo foi comparar os sistemas fechado e aberto de aspiração através de revisão sistemática. MÉTODOS: A busca de artigos científicos foi realizada nas bases de dados MedLine, LILACS e Cochrane abrangendo o período entre 1997 e agosto de 2007 utilizando as palavras-chave: endotracheal suction e closed suction. Foram incluídos os estudos que compararam o sistema aberto e fechado de aspiração, realizados em adultos humanos e que eram ensaios aleatórios e controlados. RESULTADOS: Dos 78 artigos encontrados apenas 15 preencheram os critérios e foram detalhados na revisão. Dentre estes, nove artigos comparavam a incidência de pneumonia associada à ventilação mecânica entre os dois sistemas, seis comparavam a saturação de oxigênio, quatro comparavam pressão arterial e freqüência cardíaca, três comparavam volumes pulmonares, dois comparavam remoção de secreção e quatro; custos. Não houve diferença em relação às variáveis comparadas: incidência de pneumonia associada à ventilação mecânica, mortalidade, tempo de unidade de terapia intensiva, tempo de ventilação mecânica, PaCO2, PaO2, pressão arterial média, freqüência cardíaca e remoção de secreção no uso do sistema aberto e fechado de aspiração. Porém, houve sempre diminuição de SpO2 e dos volumes pulmonares com o uso do sistema aberto; e custos maiores na maioria dos trabalhos quando utilizado o sistema fechado. CONCLUSÕES: O sistema fechado de aspiração parece aumentar o risco de colonização, mas traz as vantagens de não diminuir os volumes pulmonares e não acarretar queda de saturação especialmente em pacientes com insuficiência respiratória grave e em uso de níveis mais altos de pressão expiratória final positiva.OBJECTIVES: This study attempted to identify which is the more effective suction system. The objective was

  16. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  17. Hazard evaluation for 244-AR vault facility

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  18. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  19. Lignocellulosic Biofuels: Bioenergy Research at ARS

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  20. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  1. A compilation of 40Ar-39 and K-Ar ages: report 25

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  2. The ChArMEx database

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  3. Avaliação da tolerabilidade e do controle de ciclo de dois contraceptivos orais de baixa dose: estudo comparativo aberto Assessment of the tolerability and cycle control of two low-dose oral contraceptives: an open-label study

    Edmund C. Baracat

    1998-06-01

    Full Text Available Realizou-se um estudo aberto comparativo em nove centros brasileiros para avaliar a tolerabilidade e o controle de ciclo obtido com o uso de dois contraceptivos orais de baixa dose contendo 20 mg etinilestradiol/75 mg gestodeno e 20 mg etinilestradiol/150 mg desogestrel, durante seis ciclos de tratamento. Foram selecionadas 167 mulheres saudáveis com vida sexual ativa (77 no grupo do gestodeno e 90 no grupo do desogestrel, das quais 138 completaram os seis ciclos de tratamento. Em um subgrupo de novas usuárias realizou-se também perfil lipídico e hemostático. Foram avaliados 867 ciclos no total. Ocorreu sangramento irregular em 4,6% dos ciclos com gestodeno e em 8,1% com desogestrel. A tolerabilidade a ambas preparações foi boa, mas houve significativamente mais náusea no grupo do desogestrel. O controle de ciclo foi bom com os dois contraceptivos, sendo que houve freqüência significativamente menor de sangramento irregular no grupo do gestodeno quando se leva em conta que todos os ciclos foram considerados. Não houve alterações clinicamente significativas no perfil hemostático. O perfil lipídico mostrou tendência a tornar-se mais favorável após seis ciclos de tratamento com as duas preparações. Não ocorreu alteração no peso médio das mulheres no grupo do gestodeno; no grupo do desogestrel houve aumento significativo no peso médio de aproximadamente 1 kg após seis meses de tratamento. A adesão ao tratamento foi boa com as duas preparações. Os resultados deste estudo mostram que preparações contendo baixa dose de gestodeno ou desogestrel associados a 20 mg de etinilestradiol são contraceptivos bem tolerados que permitem bom controle de ciclo, sem efeitos colaterais significantes.An open-label comparative study was conducted in nine centers in Brazil to evaluate the tolerability and cycle control of two low-dose oral contraceptives containing 20 mg ethynylestradiol/75 mg gestodene and 20 mg ethynylestradiol/150 mg

  4. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  5. AO distal radius volar plate fixation for AO type C distal radius fracture

    We applied a volar AO distal radius plate for AO type C fractures of the distal radius. The subjects included 1 man and 12 women, and their mean age at the time of surgery was 62 years. The mean follow-up period was 10 months. According to the AO classification, 3 cases were C2, 7 cases were C3-1, and 3 cases were C3-2. Union was achieved in all cases. Wrist function was evaluated using the modified Mayo wrist scoring system. The functional results were excellent in 7 cases, good in 4 cases, and fair in 2 cases. To evaluate the strength of the initial fixation and the accuracy of joint surface reduction after surgery, palmar tilt, ulnar variance, and radial inclination were measured from radiographs that were taken before surgery, immediately after surgery, and at the final follow-up examination, and from CT scan images taken at the final follow-up examination. In 3 cases, correction losses included poor initial fixation and joint surface reduction, and all 3 were AO C3-2 fractures. These cases had comminuted fragments, both volar and dorsal metaphysic, and lunate fossa fragments. A volar locking plate fixation that can support the articular surface should be applied to AO C2 and C3-1 fractures. However, in the absence of bone grafting, it should not be applied to AO C3-2 fractures because it is very difficult not only to reduce the concave lunate fossa fragments but also to fix the fragments to the volar metaphysis. (author)

  6. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  7. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  8. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  9. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  10. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  11. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  12. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  13. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  14. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Ney Procópio Lopes; Márcia Lara; Marcelo Libânio

    2011-01-01

    A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvazi...

  15. AO Observations of Three Powerful Radio Galaxies

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  16. Contribuição ao manejo sustentável do complexo ferruginoso nectandra na floresta nacional de Ibirama, SC Contribution to sustainable forest management of the nectandra ferruginous complex in the Ibirama national forest, SC, Brazil

    Fernando Campanhã Bechara

    2009-02-01

    Full Text Available Diante do mercado aberto para a produção de madeiras tropicais, o complexo ferruginoso Nectandra (CFN, formado pelo grupo de espécies Nectandra lanceolata, N. oppositifolia e N. rigida (canelas-ferrugem, possui aspectos promissores, pois apresenta madeira de alto valor mercadológico e com potencial silvicultural. Esse grupo de espécies é de difícil distinção em campo, justificando-se o manejo do complexo em conjunto. Essas são as primeiras espécies madeireiras a se tornarem abundantes em florestas secundárias na Região Sul do país, favorecidas pela abertura de pequenas clareiras. Realizaram-se estudos demográficos desse grupo, na FLONA de Ibirama, SC, objetivando alicerçar o manejo sustentável de madeira para serraria. Numa Floresta Ombrófila Densa de 38 ha, foram inventariados todos os indivíduos do CFN presentes em 14 parcelas aleatórias de 40 x 40 m. Caracterizou-se a distribuição espacial das árvores, bem como a produção de madeira. A população apresentou distribuição espacial aleatória, sendo 58% de toras de boa qualidade. Ocorreram 43 indivíduos/ha na regeneração, o que caracteriza a formação de banco de plântulas. Foi possível explorar 11 árvores/ha (com DAP > 16 cm, o que representaria 3,5 m³ de madeira/ha. Um ciclo de corte de 20 anos renderia quase 7 m³ de madeira de alta qualidade ao ano. Dez por cento das árvores adultas apresentaram três rebrotas/indivíduo, estabelecendo o potencial de segunda rotação. As árvores classificadas como toras de "baixa qualidade" (32% do total e com DAP > 40 cm podem ser deixadas como porta-sementes. Recomendam-se estudos mais detalhados de demografias espacial e temporal, autoecologia e análise econômica para alicerçar o manejo sustentável.In view of the opening of the tropical wood production market, the Nectandra ferruginous complex (NFC, defined as a group of Nectandra species - N. lanceolata, N. oppositifolia and N. rigida - offers promising

  17. K/Ar dating of diagenetic illite

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  18. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  19. Dicty_cDB: FC-AR02 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  20. Theoretical photoabsorption spectra of Ar n+ clusters

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  1. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  2. 40Ar retention in the terrestrial planets.

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  3. Ar-O2 rf plasma diagnostics by mass spectrometry

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  4. High-spin yrast levels of 38Ar

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  5. A psicologia positiva aplicada ao contexto escolar

    Ramôa, Maria Manuel Valente Braz Sepúlveda

    2016-01-01

    Relatório de estágio apresentado à Escola Superior de Educação de Paula Frassinetti para a obtenção de grau de mestre em educação pré-escolar e ensino do 1º ciclo do ensino básico A Psicologia positiva é considerada uma nova perspetiva de investigação e intervenção, promovendo o estudo das condições e processos que contribuem para o florescimento ou funcionamento ótimo das pessoas, grupos ou instituições, pretendendo debruçar-se sobre as experiências positivas tais como as emoções positiva...

  6. Cosmologia e Representa\\c{c}\\~ao

    Ribeiro, Marcelo Byrro

    2013-01-01

    This work presents a brief and non-technical description of the main results and concepts of the modern scientific cosmology, viewing it from an epistemological perspective which allows a dialog with other modes of thinking like e.g. history, philosophy, sociology and religion. This epistemological viewpoint is based on the philosophical theses advanced by Ludwig Boltzmann (1844-1906) which states that scientific theories are nothing more than representations, or images, of nature (arXiv:physics/0701308v1). By being representations one cannot know how nature really is because the intrinsic and indispensable properties that characterize nature are unreachable by science. In other words, the true essences that constitute nature are unknowable. Therefore, all answers proposed by science are partial, simplified and replaceable. Another way of putting forward this viewpoint is to state that all scientific truths are provisional, a result which naturally leads to the conclusion that the same set of phenomena, or sc...

  7. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias Free and open-source software application for the evaluation of coronary computed tomography angiography images

    Marcelo Souza Hadlich

    2012-10-01

    Full Text Available FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine. Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de código aberto capaz de manipular imagens DICOM de exames de angiotomografia de coronárias. MÉTODOS: Desenvolvemos e testamos o software intitulado ImageLab na avaliação de 100 exames selecionados de forma randômica por meio de um banco de dados. Foram realizadas 600 análises divididas por dois observadores utilizando o ImageLab e um outro software comercializado junto a aparelhos de tomografia computadorizada Philips Brilliance, na avaliação da presença de lesões e placas coronarianas nos territórios do Tronco da Coronária Esquerda (TCE e na Artéria Descendente Anterior (ADA. Para avaliar as concordâncias intraobservador, interobservadores e intersoftware, utilizamos concordância simples e estatística Kappa. RESULTADOS: As concordâncias observadas entre os softwares foram em geral classificadas como substancial ou quase perfeitas na maioria das comparações. CONCLUSÃO: O software ImageLab concordou com o software Philips na avaliação de exames de angiotomografia de coronárias especialmente em pacientes sem lesões, com lesões inferiores a 50% no TCE e inferiores a 70% na ADA. A concordância para lesão >70% na ADA foi menor, porém isso também é observado quando se utiliza o padrão de referência anatômico.BACKGROUND: The standardization of images used in Medicine in 1993 was performed using the DICOM (Digital Imaging and Communications in Medicine standard. Several tests use this standard and it is increasingly

  8. Dicty_cDB: FC-AR12 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  9. Dicty_cDB: FC-AR03 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  10. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  11. Fluvoxamina no transtorno depressivo maior: um estudo multicêntrico aberto Fluvoxamine in the treatment of major depressive disorder: an open multicentric study

    José Alberto Del Porto

    2007-01-01

    Full Text Available OBJETIVO: Este trabalho estudou a eficácia e a tolerabilidade da fluvoxamina no tratamento, de forma aberta, sem comparação com placebo ou outros agentes, por 6 semanas, de pacientes com o diagnóstico de transtorno depressivo maior (TDM. Constitui-se em objetivo secundário do estudo avaliar os efeitos da fluvoxamina sobre o sono dos pacientes. MÉTODOS: Foram incluídos 104 pacientes, maiores de 18 anos, com o diagnóstico de TDM, de acordo com os critérios do Manual Diagnóstico e Estatístico de Transtornos Mentais, 4ª edição (DSM-IV, e com escores, na Escala de Hamilton para Depressão, versão de 17 itens (HAM-D 17, de 17 pontos ou mais. Avaliou-se a eficácia da fluvoxamina por meio das Escalas HAM-D 17 e da CGI (Impressão Clínica Global. A análise dos itens 4, 5 e 6 da HAM-D 17 foi utilizada para a avaliação do sono dos pacientes. Avaliaram-se a segurança e a tolerabilidade da fluvoxamina ao longo das 6 semanas, registrando-se quaisquer eventos adversos. A fluvoxamina foi inicialmente ministrada em doses de 50 ou 100 mg/dia, podendo haver aumentos progressivos até 300 mg/dia. RESULTADOS: Dos 104 pacientes incluídos, 81 (78% concluíram o estudo. Obtiveram resposta favorável (diminuição de 50% ou mais na HAM-D 17 69% dos pacientes, e a taxa de remissão (HAM-D 17 OBJECTIVE: This research studied the efficacy and tolerability of fluvoxamine in the treatment of major depressive disorder (MDD, during 6 weeks, in an open trial, without placebo or active comparator. A secondary objective was the evaluation of the effects of fluvoxamine on the sleep of the pacients. METHODS: 104 patients were inicially included, with the diagnosis of MDD in accordance to the criteria of the Diagnostic and Statistical Manual for Mental Disorders, 4th edition (DSM-IV. Patients should have scores > 17 in the Hamilton Depression Scale for Depression 17 itens (HAM-D 17. The efficacy of fluvoxamine was studied through the HAM-D 17 and CGI (Clinical

  12. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  13. Ar + NO microwave plasmas for Escherichia coli sterilization

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  14. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  15. MEIS1 functions as a potential AR negative regulator

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  16. Argon defect complexes in low energy Ar irradiated molybdenum

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  17. MEIS1 functions as a potential AR negative regulator

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  18. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  19. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  20. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  1. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  2. Vaporization of the Ar+Ni system

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  3. SUMER-IRIS Observations of AR11875

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  4. The Spectroscopic study of 33Ar

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  5. Dicty_cDB: FC-AR10 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  6. Dicty_cDB: FC-AR05 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  7. Dicty_cDB: FC-AR16 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  8. Dicty_cDB: FC-AR17 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  9. Dicty_cDB: FC-AR01 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  10. Dicty_cDB: FC-AR23 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  11. ??Es posible ense??ar emprendimiento?

    Guti??rrez Molina, Catalina; Jaramillo ??ngel, Alejandro

    2015-01-01

    El emprendimiento se ha convertido en una de las principales oportunidades de desarrollo econ??mico para los pa??ses subdesarrollados debido a su capacidad de innovaci??n y generaci??n de empleo; por eso, en a??os recientes gobiernos, grandes corporaciones y universidades han revisado desde diferentes visiones y programas la manera de fomentar y apoyar a los emprendedores como parte del tejido empresarial y social -- En Colombia, el Congreso expidi?? la ley 1014 de 2006 con el fin de fomentar...

  12. Adesao ao guia alimentar para populacao brasileira

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  13. Low-order AO system in LAMOST

    Yuan, Xiangyan; Cui, Xiangqun; Liu, Genrong; Zhang, Yong; Qi, Yongjun

    2006-06-01

    The large sky area multi-object fiber spectroscopic telescope (LAMOST) is a special reflecting Schmidt telescope with its main optical axis on the meridian plane tilted by an angle of 25° to the horizontal. The clear aperture is 4m, working in optical band. The light path is 60m long when working in observing mode and it will be doubled if work in auto-collimation mode. So the image quality is affected clearly by the ground seeing and the dome seeing. In order to improve the seeing condition of the long light path, we enclosed the spherical primary and the focus unit in a tunnel enclosure and cooled the tunnel. This is an effective but passive method. Corresponding experiments and simulations show the main part of the aberrations caused by the ground seeing and dome seeing is slowly changed low order items such as tip-tilt, defocus, astigmatism, coma and spherical aberration. Thus we plan to develop the low-order AO system based on the low-cost 37-channel OKO deformable mirror for the telescope to better the ground seeing and the dome seeing, not aimed to reach diffraction limited image. This work is being carried on now.

  14. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  15. Contributions to the 37Ar background by research reactor operations

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  16. Atividade colinesterásica cerebral e comportamento de ratos após exposição perinatal ao diclorvós Brain cholinesterase activity and the behavior of rats after perinatal exposure to dichlorvos

    Jaqueline Pérola de Souza

    2006-04-01

    Full Text Available O organofosforado diclorvós impregnado em coleiras plásticas é um recurso utilizado em medicina veterinária que visa ao controle de ectoparasitas de cães e gatos. O objetivo deste trabalho foi avaliar os efeitos do uso de coleiras plásticas impregnadas com diclorvós (8,37% em ratas Wistar durante o período de gestação e lactação, como possível fonte de alterações comportamentais e da atividade colinesterásica cerebral dos filhotes. Na desmama, não houve diferença na atividade colinesterásica cerebral entre as mães tratadas com diclorvós e o grupo controle, bem como entre os respectivos filhotes. O tratamento com diclorvós também não influenciou no comportamento geral dos animais, avaliado no campo aberto, nem no nível de ansiedade testado no labirinto em cruz elevado, ambos aos 35 dias pós-natal.The organophosphate dichlorvos impregnated into plastic collars (8.37% is used in veterinary practice as an alternative for the control of ectoparasites in dogs and cats. The aim of this work was to determine the possible toxic effects of these collars in female Wistar rats during pregnancy and lactation, as a possible cause of alterations in brain cholinesterase activity and behavior of offspring. At weaning, there was no difference in brain cholinesterase activity between control and treated dams, nor between their respective offspring as well. The treatment did not affect the general behavior of the offspring, when evaluated in the open field, nor anxiety in the elevated plus-maze, both evaluated on the 35th postnatal day.

  17. Conservação de rúcula minimamente processada produzida em campo aberto e cultivo protegido com agrotêxtil Conservation of minimally processed rocket produced under open field conditions and non woven polypropylene

    Angela F Gonzalez

    2006-09-01

    Full Text Available Folhas de rúcula produzidas em campo aberto e sob cultivo protegido com agrotêxtil foram minimamente processadas, embaladas inteiras ou picadas em bandejas de poliestireno expandido e cobertas com filme de PVC de 14 micras. O delineamento adotado foi o inteiramente casualizado em esquema fatorial 2x2x2 (ambiente de cultivo, forma de preparo e refrigeração a 0(0C e 10(0C, com quatro repetições por tratamento, totalizando 32 bandejas. Os tratamentos foram armazenados a 0ºC e 10ºC por 10 dias, quando foram avaliadas as variáveis perda de massa (%; pH; sólidos solúveis; acidez titulável; cor e aparência. A conservação a 0ºC promoveu uma diminuição da perda de peso da rúcula minimamente processada. A utilização de folhas inteiras ou minimamente processadas foi significativa para sólidos solúveis sendo os maiores valores encontrados para as folhas inteiras. Para folhas picadas observou-se valores de acidez significativamente maiores para as produzidas sob ambiente natural. Independente da forma de preparo, a rúcula produzida em ambiente natural apresentou menor valor de pH. A cor e aparência da rúcula não foram influenciadas pelos tratamentos.Leaves of rocket salad produced under open field and non woven polypropylene were minimally processed and packed entire or pricked in polyestyrene trays covered with PVC film of 14 micras. The treatments were stored at 0(0C and 10(0C per 10 days, when the variables weight loss (%; pH; soluble solids; titratable acidity; colour and appearance were evaluated. The conservation under 0(0C promoted a reduction of weight loss on rocket salad minimally processed. Using entire or minimally processed leaves were significant for soluble solids the biggest values being found for entire leaves. For pricked leaves bigger values of acidity were observed for the produced ones under natural environment. Independent of the preparation form rocket salad produced under natural environment presented minor

  18. Identification and analysis of ARS function of six plant MARs

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  19. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  20. Application of the antibiotic disk diffusion method to multivariate profiling of soil bacterial community: comparing the power to discriminate different soils and dimension of the discrimination with that of the Biolog method Aplicação do método de difusão de disco de antibiótico para traçar o perfil da comunidade bacteriana no solo: comparação de seu poder discriminatório e dimensão da discriminação em relação ao método Biolog

    Ryoichi Doi

    2003-12-01

    Full Text Available The antibiotic disk diffution (ADD method was compared with the Biolog method in terms of power to discriminate soils and dimension of the discrimination. Soils from a forest and a citrus field in Thailand were profiled with these methods. These methods differentiated the soils in the principal component score plots. Then, Wilk's lambda statistic was determined to estimate power of these methods to discriminate the soils. The ADD method scored Wilk's lambda of 0.003 (p = 0.144 and 0.000 (p=0.020, for direct and ratio-transformed calculation, respectively. The Biolog method recorded Wilk's lambda of 0.001 (p=0.067, 0.003 (p=0.144 and 0.035 (p=0.440, at 0.25, 0.50 and 0.75 average well color developments (AWCDs, respectively. The ADD method showed high discrimination power, or at least comparable to that of the Biolog method. Redundancy analysis (RDA resulted in ordination diagrams, which revealed a difference in dimension of the soil discrimination among the methods and the AWCDs. The soil environmental factors significantly related to the bacterial profiles at p=0.05 were: available phosphorus (ADD method and Biolog 0.25 AWCD, and pH (Biolog 0.50 and 0.75 AWCD. These results indicated that the profiling methods and the AWCDs revealed the multidimensionality of the discrimination. The possibility of the application of the ADD method to extraction of such pieces of information for effective land management was suggested.O método de Difusão de Disco de Antibiótico (ADD foi comparado ao método Biolog quanto ao seu poder de discriminar solos e quanto à dimensão da discriminação, analisando-se os solos de uma floresta e de um campo de cítricos na Tailândia. A diferenciação dos solos por esses métodos foi feita de acordo com o score plot do componente principal.Em seguida, determinou-se o valor de lambda de Wilk para estimar o poder discriminatório desses métodos. O método ADD resultou em lambda de Wilk de 0,003 (p=0,144 e 0,035 (p=0

  1. Plasma AR and abiraterone-resistant prostate cancer.

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  2. Behaviour of AR glass fibre for building structural applications

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  3. Opera ar drama... Aleksejus Kartavovas Vilniuje

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  4. Amando de olhos abertos: Emma Goldman e o dissenso político nos EUA Loving with open eyes: Emma Goldman and the political dissent in the Unites States

    Cecilia Azevedo

    2007-01-01

    Este artigo apresenta a trajetória de Emma Goldman, grande nome do anarquismo, pacifismo e feminismo nos EUA, procurando apresentá- la como uma representante da chamada tradição de dissenso neste país que, ao longo de toda sua história, tem disputado os sentidos a serem atribuídos aos ideais nacionais. Em meio à atual guerra no Iraque, a memória e o legado de Emma Goldman vêm sendo recuperados no embate político em torno do sentido do americanismo.This article presents the life of Emma Goldma...

  5. Sensibility of different wheat varieties (strains) to Ar+ implantation

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  6. Practical reactor production of {sup 41}Ar from argon clathrate

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  7. First closed-loop visible AO test results for the advanced adaptive secondary AO system for the Magellan Telescope: MagAO's performance and status

    Close, Laird M.; Males, Jared R.; Kopon, Derek A.; Gasho, Victor; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Uomoto, Alan; Hare, Tyson; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Busoni, Lorenzo; Arcidiacono, Carmelo; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando; Argomedo, Javier

    2012-07-01

    The heart of the 6.5 Magellan AO system (MagAO) is a 585 actuator adaptive secondary mirror (ASM) with response times (0.7 ms typically). This adaptive secondary will allow low emissivity and high-contrast AO science. We fabricated a high order (561 mode) pyramid wavefront sensor (similar to that now successfully used at the Large Binocular Telescope). The relatively high actuator count (and small projected ~23 cm pitch) allows moderate Strehls to be obtained by MagAO in the “visible” (0.63-1.05 μm). To take advantage of this we have fabricated an AO CCD science camera called "VisAO". Complete “end-to-end” closed-loop lab tests of MagAO achieve a solid, broad-band, 37% Strehl (122 nm rms) at 0.76 μm (i’) with the VisAO camera in 0.8” simulated seeing (13 cm ro at V) with fast 33 mph winds and a 40 m Lo locked on R=8 mag artificial star. These relatively high visible wavelength Strehls are enabled by our powerful combination of a next generation ASM and a Pyramid WFS with 400 controlled modes and 1000 Hz sample speeds (similar to that used successfully on-sky at the LBT). Currently only the VisAO science camera is used for lab testing of MagAO, but this high level of measured performance (122 nm rms) promises even higher Strehls with our IR science cameras. On bright (R=8 mag) stars we should achieve very high Strehls (>70% at H) in the IR with the existing MagAO Clio2 (λ=1-5.3 μm) science camera/coronagraph or even higher (~98% Strehl) the Mid-IR (8-26 microns) with the existing BLINC/MIRAC4 science camera in the future. To eliminate non-common path vibrations, dispersions, and optical errors the VisAO science camera is fed by a common path advanced triplet ADC and is piggy-backed on the Pyramid WFS optical board itself. Also a high-speed shutter can be used to block periods of poor correction. The entire system passed CDR in June 2009, and we finished the closed-loop system level testing phase in December 2011. Final system acceptance (

  8. Hyperdeformed band in the 36Ar nucleus?

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  9. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  10. VARIABILIDADE TEMPORAL DA TEMPERATURA DO AR EM JABOTICABAL – SP

    GARCIA, Anice

    2015-05-01

    Full Text Available The study aimed to obtain a monthly average temperature equation estimated from the analysis of the variability of temperatures (maximum, average and minimum, to Jaboticabal /SP. The analysis of the parameters was made monthly, seasonal, annual and interannual. Data (1971-2013 were collected in a Agrometeorological Station of the Universidade Estadual Paulista (UNESP at Jaboticabal Campus(Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. On the data were applied statistical methods (mean, standard deviation and coefficient of variation. Were also correlated the monthly averages obtained by the standard method (INMET and by the method of extreme temperatures. The results showed that standard deviation of the temperatures had a slow variations with low coefficient of variation. The equations obtained between the mean values of standard INMET and the mean of the extreme, can be used for micro region of Jaboticabal with good accuracy in results. Este estudo teve como objetivo analisar a variabilidade de temperatura e obter uma equação mensal de estimativa de temperatura média do ar a partir da análise das temperaturas (máxima, média e mínima, para Jaboticabal –SP. A análise dos elementos foi feita mensal, sazonal, anual e interanualmente. Os dados, referentes ao período de 1971 a 2013, foram coletados na Estação Agroclimatológica da Universidade Estadual Paulista (UNESP – Campus de Jaboticabal (Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. Sobre os dados foram aplicados métodos estatísticos (média, desvio padrão e coeficiente de variação. Foram, também, correlacionadas as médias mensais obtidas pelo método padrão (INMET e pelo método das temperaturas extremas. Os resultados obtidos mostraram que os desvios das temperaturas (máximas, medias e mínimas tiveram variações discretas com consequentes coeficientes de variação baixos para os elementos estudados. As equações obtidas entre as m

  11. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  12. Geochronological stages of magmatism of Sorsk copper-molybdenum-porphyry are district, Kuznetsk Alatau (K-Ar, Ar-Ar and Rb-Sr methods)

    Studies on biotite, amphibole and feldspar rocks were conducted through K-Ar, 39Ar-40Ar and Rb-Sr methods for evaluation of geochronological stages of magmatism development of the Sorsk copper-molybdenum-porphyry ore district. It is shown that general duration of magmatism development at the Sorsk district exceeds 100 mln years with intervals between individual magmatic pulses about 30 mln years. Dating by magmatites, related to ore-bearing porphyry complex and ore-metasotamic formations, is within the interval of 380-400 mln years. 13 refs.; 2 figs

  13. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  14. Suscetibilidade do capim-colonião e de cultivares de milho ao flúor

    Rimena Ramos Domingues

    2011-01-01

    Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.

  15. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  16. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  17. Support for the Astronomically Calibrated 40Ar/39Ar Age of Fish Canyon Sanidine

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    Fish Canyon sanidine (FCs) is the neutron fluence monitor most widely used in Cenozoic argon geochronology. Recommend published ages for FCs have been determined through various intercalibration techniques, but have varied by up to 2% over the last three decades. The robust quality of the...... astronomical timescale, with precision better than 0.1% for the last 10 million years for directly tuned sections, suggests intercalibration with K-bearing minerals intercalated in astronomically tuned stratigraphic sections as the best way to proceed with addressing the true age of FCs. Recently, Kuiper, et...... al. (2008) determined an astronomically calibrated 40Ar/39Ar age of 28.201 0.046 Ma (2), relative to the indirect astronomically tuned Moroccan Melilla Basin Messâdit section. Here, we provide independent verification for the Kuiper, et al. (2008) FCs age using sanidines extracted from the A1 tephra...

  18. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  19. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  20. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  1. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  2. 40Ar/39Ar geochronology and paleomagnetism of Independence volcano, Absaroka volcanic supergroup, Beartooth mountains, Montana

    Harlan, S.S.; Snee, L.W.; Geissman, J.W.

    1996-01-01

    Independence volcano is a major volcanic complex in the lower part of the Absaroka Volcanic Supergroup (AVS) of Montana and Wyoming. Recently reported Rb-Sr mineral dates from the complex give apparent ages of 91 and 84 Ma, whereas field relationships and the physical and compositional similarity of the rocks with other dated parts of the AVS indicate an Early to Middle Eocene age for eruption and deposition. To resolve the conflict between age assignments based on stratigraphic correlations and Rb-Sr dates, we report new paleomagnetic data and 40Ar/39Ar dates for Independence volcano. Paleomagnetic data for the stock and an and andesite plug that cuts the stock are well grouped, of reverse polarity, and yield a virtual geomagnetic pole that is essentially identical to Late Cretaceous and Tertiary reference poles. The reverse polarity indicates that the magnetization of these rocks is probably younger than the Cretaceous normal superchron, or less than about 83.5 Ma. Hornblende from a volcanic breccia near the base of the volcanic pile gives a 40Ar/39Ar age of 51.57 Ma, whereas biotites from a dacite sill and a granodiorite stock that forms the core of the volcano give dates that range from 49.96 to 48.50 Ma. These dates record the age of eruption and intrusion of these rocks and clearly show that the age of Independence volcano is Early to Middle Eocene, consistent with stratigraphic relations. We suggest that the Rb-Sr mineral dates from the Independence stock and related intrusions are unreliable.

  3. Arís 2.1: Adapting Arís for Object Oriented Language

    Rahman, Fahrurrozi

    2014-01-01

    In the software development area, software verification is important such that it can guarantee the software fulfills its requirements. Despite its importance, verifying software is difficult to achieve. Additional knowledge and effort are needed to write specification especially if the software is complex and big in size. Nevertheless, there are some software that already have verified specifications. This project will focus on extending Arís (Analogical Reasoning for reuse of Im...

  4. Dicty_cDB: FC-AR21 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  5. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  6. The Robo-AO automated intelligent queue system

    Riddle, Reed L; Papadopoulos, Athanasios; Baranec, Christoph; Law, Nicholas M

    2014-01-01

    Robo-AO is the first automated laser adaptive optics instrument. In just its second year of scientific operations, it has completed the largest adaptive optics surveys to date, each comprising thousands of targets. Robo-AO uses a fully automated queue scheduling system that selects targets based on criteria entered on a per observing program or per target basis, and includes the ability to coordinate with US Strategic Command automatically to avoid lasing space assets. This enables Robo-AO to select among thousands of targets at a time, and achieve an average observation rate of approximately 20 targets per hour.

  7. Resposta de cultivares de arroz irrigado ao nitrogênio

    Freitas José Guilherme de; Azzini Luiz Ernesto; Cantarella Heitor; Bastos Cândido Ricardo; Castro Lúcia Helena Signori Melo de; Gallo Paulo Boller; Felício João Carlos

    2001-01-01

    Genótipos de arroz irrigado por inundação (Oryza sativa L.) podem apresentar variabilidade de resposta ao nitrogênio. O objetivo deste trabalho foi avaliar a resposta de três cultivares de arroz ao nitrogênio. Os experimentos foram realizados em Mococa, SP, em 1997/98 e 1998/99, em Cambissolo Háplico Tb Eutrófico gleico. O delineamento estatístico foi em blocos ao acaso, em esquema de parcelas subdivididas, com quatro repetições. Nas parcelas foram aplicadas doses de N (0, 50, 100 e 150 kg ha...

  8. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  9. Experimental introduction of excess Ar40 into a granitic melt

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  10. Aspects of What Makes or Breaks a Museum AR Experience

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  11. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  12. Condicionantes economicos oa adoçao de uma inovaçao por parte do consumidor: analise da compra de serviços online

    Izquierdo Yusta, Alicia; Martinez Ruiz, Maria Pilar; Jimenez Zarco, Ana Isabel

    2011-01-01

    Este  trabalho analisa a processo de adoçao de uma inovaçao concreta por parte do consumidor final -neste caso, o usa e adoçao de internet como canal de informaçao e de compra– na aquisiçao de um serviço, No caso concreto, considera-se um serviço turistico de caracteristicas muito particulares como e a reserva de um pernoite hoteleiro. A eleiçao deste produto intangivel resulta numa grande contribuçao a Iiteratura relevante, nao só pela escassez de trabalhos anteriores que tenham analisado es...

  13. Polycyclic orogeny in Central Ogcheon metamorphic belt, Korea: evidence from 40Ar/39Ar hornblende ages

    Full text: The Ogcheon fold-thrust belt is one of the key Phanerozoic belts for delineating the regional correlation in East Asia including mainland China and Japan. This NE-trending belt consists of the Ogcheon metamorphic belt (OMB) in the southwest and the Taebaeksan sedimentary zone in the northeast. The OMB comprises Late (?) Proterozoic to Paleozoic metasedimentary and metavolcanic sequences intruded by Mesozoic granitoids. The age of initial intracontinental rifting is constrained to be earlier than 756 Ma by the U-Pb zircon age of a felsic metavolcanic rock (Lee et al., 1998, Precamb. Res. 89, 47-57). Polyphase tectonism in the OMB is characterised by the Middle Paleozoic Ogcheon orogeny responsible for the ductile stacking of thrust nappes and the Triassic Songrim orogeny occurring at shallower depths under the brittle-ductile transitional regime (Cluzel et al., 1990, Tectonophysics, 183, 41-56). Peak metamorphic conditions of the former are in the range of 5-8 kbar and 520-590 deg C, whereas those of the latter are 1-3 kbar and 350-500 deg C (Min and Cho, 1998, Lithos, 43, 31-51). Major ambiguity in the polycyclic model of the OMB results from the lack of isotopic age data. In order to determine the age of peak metamorphism, we analysed hornblende crystals of quartzose amphibole schists in central OMB, using the 40Ar/39Ar dating technique. Mineral assemblages of amphibole schists are represented by calcic amphiboles + plagioclase + epidote ± garnet + quartz + titanite + Fe-Ti oxide (magnetite or ilmenite). Amphibole separates commonly display discordant age spectra. Nevertheless, amphiboles of five analysed samples yield 40Ar/39Ar intercept dates ranging from 432±4 Ma to 499±10 Ma. Three of them yield plateau dates of 440-492 Ma, defined by more than three contiguous steps accounting for >50% of the total 39ArK released. Two of these plateau dates (465±4 Ma and 492±4 Ma) are from hornblende fractions of different grain size in a garnet

  14. 40Ar/39Ar geochronology of the El Teniente porphyry copper deposit

    breccias. Phyllic alteration primarily occurs as quartz-sericite haloes of quartz-sulfide-sulfate veinlets within the perimeter of the orebody, and slightly overprints potassic alteration. Propylitic alteration occurs largely peripheral to ore-grade rock. The relatively restricted development of phyllic alteration and the occurrence of the central breccia conflict with the classic porphyry copper model of Lowell and Gilbert (1970), but El Teniente may be regarded as a 'variation on a theme' of the classic model, as suggested by Gustafson and Hunt (1975). The exceedingly large size of the El Teniente deposit, coupled with its apparently young mineralization age prompted us to initiate a systematic 40Ar/39Ar study whose goals are to determine the age(s) of the hydrothermal event(s) that produced such a remarkable copper concentration and ultimately to estimate the duration of the hydrothermal activity at El Teniente. This is particularly relevant to an understanding of the processes that formed super-giant high-grade copper deposits in the Chilean Andes and elsewhere. We report here 32 total fusion 40Ar/39Ar ages from sericite and biotite from different lithologic units of El Teniente and five step-heating 40Ar-39Ar ages of samples previously dated using conventional K-Ar methods (Cuadra, 1986) (au)

  15. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  16. Eruption age of an approximately 100,000-year-old basalt from Ar-40/Ar-39 analysis of partially degassed xenoliths

    Gillespie, A. R.; Huneke, J. C.; Wasserburg, G. J.

    1984-01-01

    Eleven samples from five partially degassed Mesozoic granitic xenoliths and two late Pleistocene host basalt samples from Sawmill Canyon in Sierra Nevada, California, have been analyzed using stepwise Ar-40/Ar-39 dating techniques. The petrography and analytic techniques are described and the results are presented. Isotopic compositions of Ar released from the xenoliths in several extraction steps at temperatures below about 900 C were colinear in Ar-36/Ar-40 versus Ar-39/Ar-40 diagrams and defined isochrons, giving a mean age of degassing of 119,000 + or - 7000 yr. Ar-40 extracted at higher temperatures included ancient radiogenic Ar-40 that never diffused from the xenoliths during immersion in the magma. This Ar-40 caused an increase in the apparent age for the high-temperature extractions. The high precision of the eruption age determined by this method is comparable to that obtained elsewhere by conventional K/Ar dating of sanidine.

  17. Correlação e correspondência topográfica entre espessura da camada de fibras nervosas da retina e campo visual no glaucoma primário de ângulo aberto Correlation and topographic match between nerve fiber layer thickness and visual field in primary open angle glaucoma

    Paula Boturão de Almeida

    2001-04-01

    Full Text Available Objetivo: Verificar a correlação e a correspondência topográfica entre a espessura da camada de fibras nervosas da retina, medidas pelo polarímetro de varredura a laser GDxTM Scanning Laser System® e o campo visual, medido pelo perímetro automatizado Humphrey® ("white-white" em portadores de glaucoma primário de ângulo aberto. Métodos: Foram investigadas as seguintes correlações: 1- Correlação entre a média da sensibilidade dos quadrantes e do ponto de fixação do campo visual, em decibéis, e a média da espessura da camada de fibras nervosas da retina correspondente, em micra, sem classificação dos olhos dos pacientes quanto ao estadio do comprometimento perimétrico. 2- A mesma correlação anterior, porém, com os olhos dos pacientes distribuídos em classes quanto à alteração perimétrica. 3- Correlação entre os índices globais do campo visual e os índices numéricos do analisador de espessura da camada de fibras nervosas da retina. 4- Correlação entre a média dos valores do gráfico "total deviation" do campo visual e o desvio da normalidade da camada de fibras nervosas da região correspondente. 5- Investigou-se a freqüência de correspondência topográfica entre os defeitos perimétricos e as alterações da camada de fibras nervosas da retina. Utilizou-se o coeficiente de correlação de Spearman, sendo o nível de rejeição para a hipótese de nulidade fixado num valor menor ou igual a 0,05 (5%. Resultados: Observou-se as seguintes correlações estatisticamentes significantes, mas de forma muito pouco intensa: 1- GDX total e Campo visual total; GDX superior e Campo visual nasal inferior; GDX inferior e Campo visual nasal superior; GDX nasal e Campo visual temporal; GDX superior e Campo visual inferior; GDX inferior e Campo visual superior. 2- GDX inferior e Campo visual nasal (medial superior dos pacientes classificados como graves. 3- Nos olhos classificados como normais: PSD e EM; CPSD e SI.Nos olhos

  18. Touch interface for markless AR based on Kinect

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  19. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  20. Proton resonance spectroscopy in 36Ar

    Excitation functions for proton elastic scattering and for proton-induced reactions on 35Cl were measured with the KN Van de Graaff accelerator and associated high resolution system at TUNL. Differential cross sections for 35Cl(p,p0), (p,p1), (p,p2), (p, α0), and (p, α1) were measured in the range Ep = 0.6 to 4.0 MeV. The data were measured at five angles with an overall resolution of about 350 eV. The measured excitation functions were analyzed with a multi-level, multi-channel R-matrix formalism for approximately 200 levels. Resonance parameters were extracted. The resonance parameters included resonance energy, total angular momentum, parity, partial elastic and reaction widths, channel spin or orbital angular momentum mixing ratios, and for some resonances the relative signs of width amplitudes. A number of resonances have strong level-level interference effects. Comparison of these data with the Porter-Thomas distribution resulted in good agreement of almost all channels which had a statistically significant number of resonances. These comparisons indicate that nearly all the proton and alpha strength in 36Ar for this energy range was seen in the present study. The s-wave proton strength function ratio for s = 1 and s = 2 resonances was found to be consistent with previous measurements for 4N nuclei

  1. An efficient algorithm for generating AoA networks

    Mouhoub, Nasser Eddine

    2012-01-01

    The activities, in project scheduling, can be represented graphically in two different ways, by either assigning the activities to the nodes 'AoN' directed acyclic graph (dag) or to the arcs 'AoA dag'. In this paper, a new algorithm is proposed for generating, for a given project scheduling problem, an Activity-on-Arc dag starting from the Activity-on-Node dag using the concepts of line graphs of graphs.

  2. A Large-Telescope Natural Guide Star AO System

    Redding, David; Milman, Mark; Needels, Laura

    1994-01-01

    None given. From overview and conclusion:Keck Telescope case study. Objectives-low cost, good sky coverage. Approach--natural guide star at 0.8um, correcting at 2.2um.Concl- Good performance is possible for Keck with natural guide star AO system (SR>0.2 to mag 17+).AO-optimized CCD should b every effective. Optimizing td is very effective.Spatial Coadding is not effective except perhaps at extreme low light levels.

  3. Paleomagnetic and 40Ar/39Ar geochronologic data from late Proterozoic mafic dikes and sills, Montana and Wyoming

    Harlan, Stephen S.; Geissman, John William; Snee, Lawrence W.

    1997-01-01

    Paleomagnetic and 40Ar/39Ar results from mafic dikes and sills in northwestern Wyoming and western Montana yield similar virtual geomagnetic poles and isotopic dates. In combination with paleomagnetic and geochronologic data from elsewhere in the western Cordillera, these data provide evidence for a regional mafic magnetic event at 780 to 770 Ma that affected a large area of western North America.

  4. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  5. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  6. Dicty_cDB: FC-AR11 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  7. Dicty_cDB: FC-AR19 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  8. Dicty_cDB: FC-AR15 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  9. Dicty_cDB: FC-AR07 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  10. Dicty_cDB: FC-AR24 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  11. Dicty_cDB: FC-AR13 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  12. Gestão ambiental nas empresas de capital aberto do segmento ‘Novo Mercado’: discutindo a homogeneidade e heterogeneidade de práticas à luz da teoria institucional [doi: 10.5329/RECADM.20121102003

    Vivianne Pereira Salas Roldan

    2012-11-01

    Full Text Available O objetivo geral deste estudo foi analisar o comportamento das empresas de capital aberto, do segmento ‘Novo Mercado’ da BM&FBovespa, quanto à adoção de práticas de gestão ambiental, à luz da teoria institucional. Em síntese, os objetivos específicos da pesquisa analisam a tendência para a homogeneidade e heterogeneidade de práticas ambientais das empresas, sua relação com a abordagem de gestão ambiental e com as pressões ambientais evidenciadas, dando destaque especial para o setor de Construção. É uma pesquisa descritiva, bibliográfica e documental, de abordagem quantitativa. Os dados foram obtidos a partir dos websites e relatórios anuais das empresas, de 2009 e 2010. Constatou-se que 66,7% das 123 empresas do Novo Mercado adotam práticas ambientais. Quanto à abordagem de gestão ambiental, 58,5% dessas empresas são proativas, 28% reativas, e 13,4% preventivas. Verificou-se que quanto mais proativa a abordagem de gestão ambiental, mais diversificadas são as pressões ambientais, e maior é a possibilidade de existir isomorfismo entre as empresas quanto à adoção de práticas sustentáveis, assim como heterogeneidade. Na análise do setor de construção, constatou-se essas possibilidades destacadas, sendo as práticas homogêneas e heterogêneas desse campo detalhadas e discutidas no estudo.   Palavras-chave Teoria institucional, Pressões ambientais, Gestão Ambiental.     ENVIRONMENTAL MANAGEMENT OF COMPANIES OF THE SEGMENT 'NEW MARKET': DISCUSSING THE HOMOGENEITY AND HETEROGENEITY OF PRACTICES IN LIGHT OF INSTITUTIONAL THEORY   ABSTRACT The aim of this study was to analyze the behavior of companies of the segment 'New Market' BM&FBovespa, on the adoption of environmental management practices in light of institutional theory. In summary, the specific objectives of the research analyzing the trend toward homogeneity and heterogeneity of environmental practices of firms, their relationship with the approach

  13. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  14. Adjuvantes e assistência de ar em pulverizador de barras sobre a deposição da calda e controle de Phakopsora pachyrhizi (Sydow & Sydow

    Hélio Oliveira Aguiar Júnior

    2011-09-01

    Full Text Available Com o intuito de melhorar a cobertura da pulverização e diminuir as perdas na produtividade da cultura da soja, o estudo objetivou avaliar o efeito da adição de adjuvantes à calda combinado ou não ao uso da assistência de ar sobre a deposição da pulverização, controle de Phakopsora pachyrhizi H. Sydow & P. Sydow, perdas de produção (peso de 1000 grãos e produtividade da cultura (kg ha-1. Dois experimentos a campo foram conduzidos na cultura da soja, variedade Conquista, safra agrícola 2008/09. Um deles no delineamento em blocos ao acaso com três doses de adjuvantes associados a um marcador cúprico combinadas a dois níveis de ar na barra de pulverização (0 e 29 km h-1, totalizando 6 tratamentos e 4 repetições. Outro experimento foi instalado no mesmo local do anterior. O delineamento experimental utilizado foi o de blocos ao acaso com 7 tratamentos: fungicida e dois adjuvantes associados ao fungicida, combinados a dois níveis de ar na barra de pulverização (0 e 29 km h-1, mais testemunha, e 4 repetições. Após a pulverização do fungicida piraclostrobina + epoxiconazole com diferentes tecnologias, procedeu-se a avaliação da severidade da doença através da estimativa da área abaixo da curva de progresso da doença (AACPD e da produtividade da cultura da soja. A assistência de ar na velocidade máxima gerada pelo ventilador (29 km h-1, combinada ao fungicida piraclostrobina + epoxiconazole mais o adjuvante organosiliconado Silwet L-77 contribuiu para melhor controle da ferrugem asiática, proporcionando incremento na produtividade e no peso de 1000 grãos.

  15. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  16. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  17. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  18. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  19. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  20. Toward a high-resolution 40Ar/39Ar geochronology of the Tatun Volcano Group, Taiwan

    Mesko, G. T.; Song, S.; Chang, S.; Hemming, S. R.; Turrin, B. D.

    2010-12-01

    The Tatun Volcano Group [TVG] consists of five volcanic subgroups of which ~30 edifices have been identified, all in close proximity to the densely populated Taipei Basin to its south (Song et al., 2000, Journal of the Geological Society of China, in Chinese). Evidence of eruptions is in the form of mostly lava flows, with pyroclastic flows, and ash deposition (Tsai et al., 2010, TAO), consistent with vulcanian and plinian eruptions that are only minimally preserved because of the region’s high weathering rate (Belousov et al., 2010, Journal of Volcanology and Geothermal Research). The TVG is made up of calc-alkaline andesite, with few interspersed basaltic lava flows that bear geochemical signatures consistent with subduction volcanism, yet due to tectonic location Teng (1996, Geology) describes it as Ryukyu back-arc basin volcanism, and still others attribute volcanism here to post-collisional collapse of the Taiwan orogen (Wang et al., 1999, Tectonophysics and 2004, Journal of Petrology). Various TVG samples were previously K-Ar dated by Juang and Chen (1989, Bulletin of Central Geological Survey, in Chinese), Tsao (1994, Bulletin of Central Geological Survey, in Chinese), and 40Ar/39Ar whole rock analyses by Lee (1996, masters thesis, National Taiwan University) to suggest volcanism from 2.8-2.5Ma and then from 1.5-.22Ma after which volcanic events ceased. In contrast, radiocarbon dates obtained from charcoal in related sediment by Chen et al. (2010, TAO) and Belousov et al. (2010, Journal of Volcanology Geothermal Research) suggest volcanic activity was present at 20ka and 6ka respectively. The andesite samples are microcrystalline; therefore hand picked aliquots of groundmass from the hand magnetic fraction were subjected to several iterations of sonic rinse in glycine-based soap, then 4N HNO3, then quartz-distilled water in a preparation modified from Nicolaysen et al. (2000, EPSL). Samples were co-irradiated at the USGS facility in Denver using Alder

  1. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  2. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  3. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  4. Amando de olhos abertos: Emma Goldman e o dissenso político nos EUA Loving with open eyes: Emma Goldman and the political dissent in the Unites States

    Cecilia Azevedo

    2007-12-01

    Full Text Available Este artigo apresenta a trajetória de Emma Goldman, grande nome do anarquismo, pacifismo e feminismo nos EUA, procurando apresentá- la como uma representante da chamada tradição de dissenso neste país que, ao longo de toda sua história, tem disputado os sentidos a serem atribuídos aos ideais nacionais. Em meio à atual guerra no Iraque, a memória e o legado de Emma Goldman vêm sendo recuperados no embate político em torno do sentido do americanismo.This article presents the life of Emma Goldman, who played a central role in the history of anarchism, pacifism and feminism in the United States. In the present days, when a new war is taking place in Iraq, the memory and legacy of Emma Goldman are being reassessed amidst the debate over the political meaning of Americanism.

  5. High-precision 40Ar/39Ar age for the Jehol Biota

    Chang, S.; Zhang, H.; Renne, P. R.; Fang, Y.

    2008-12-01

    Abundant fossils of the terrestrial Jehol Biota, including plants, insects, dinosaurs, birds, mammals and freshwater invertebrates, were discovered from the Yixian Formation and the overlying Jiufotang Formation in Inner Mongolia, Hebei Province and Liaoning Province, northeastern China. Because of the exceptional preservation of fossils, the Jehol Biota is one of the most important Mesozoic fossil outcrops and referred to as a "Mesozoic Pompeii". The Jehol Biota has provided a rare opportunity to address questions about the origin of birds, the evolution of feathers and flight, the early diversification of angiosperms and the timing of the radiation of placental mammals. The Tuchengzi Formation, which lies unconformably just below the Yixian Formation and consists mainly of variegated sandstones, is less fossiliferous than the two overlying formations. However, dinosaur tracks, silicified wood and compressed plants are found in this formation. A systematic 40Ar/39Ar dating of the Yixian and the Jiufotang formations was undertaken to provide a framework for understanding the timing and duration of the Jehol Biota and evolutionary events represented within it. Furthermore, determining the absolute age of the Tuchengzi Formation provides information to interpret abundant dinosaur tracks within and provide better age constrains for the beginning of the Jehol Biota. Here we present robust high-precision 40Ar/39Ar data for six tuff samples and two basalt samples collected from the Tuchengzi, the Yixian and the Jiufotang formations near the classic outcrops in western Liaoning, NE China. We obtain an age of 139.5 ± 1.0 Ma for the uppermost Tuchengzi Formation, an age of 129.7 ± 0.5 Ma for a basaltic lava from the bottom of the Yixian Formation and an age of 122.1 ± 0.3 Ma for a tuff from the base of the overlying Jiufotang Formation. Our data indicate that the Yixian Formation was deposited during the Early Cretaceous, the Barremian to early Aptian, within a time span

  6. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  7. Expression of ER and AR in lung cancer

    Shuling WANG

    2008-02-01

    Full Text Available Background and objective Epidemiology of lung cancer differs between sexes and it might be partially explained by different sex hormone levels in women and men. There are some epidemiological data indicating that gender is a significant, independent prognostic factor in lung cancer. The aim of this study is to determine expression of ER (estrogen receptor and AR (androgen receptor in lung cancer, and evaluate the relationship between their expression and clinical or pathologic characteristics. Methods Immunohistochemistry assay was used to detect expression of ER and AR. Results Positive expression of ER and AR were 14.3%(15/105 and 20%(21/105. Positive expression of ER had no relationship with age, gender, pathology, histological differentiation, TNM staging, size of tumor and lymph node metastasis. Although age, gender, pathology, histological differentiation and size of tumor had no effect on the expression of AR, positive rate of AR in staging III lung cancer was significantly higher than that in staging I lung cancer. The different AR expression was significant between N0 and N2 lymph node metastasis ( Chisquare= 4.7828,P=0.0287. Conclusion The expression of ER has no relationship with biological behavior. Positive expression of AR may be correlated with the progression and the lymph node metastasis of lung cancer.

  8. Molecular modeling of the effects of 40Ar recoil in illite particles on their K-Ar isotope dating

    Szczerba, Marek; Derkowski, Arkadiusz; Kalinichev, Andrey G.; Środoń, Jan

    2015-06-01

    The radioactive decay of 40K to 40Ar is the basis of isotope age determination of micaceous clay minerals formed during diagenesis. The difference in K-Ar ages between fine and coarse grained illite particles has been interpreted using detrital-authigenic components system, its crystallization history or post-crystallization diffusion. Yet another mechanism should also be considered: natural 40Ar recoil. Whether this recoil mechanism can result in a significant enough loss of 40Ar to provide observable decrease of K-Ar age of the finest illite crystallites at diagenetic temperatures - is the primary objective of this study which is based on molecular dynamics (MD) computer simulations. All the simulations were performed for the same kinetic energy (initial velocity) of the 40Ar atom, but for varying recoil angles that cover the entire range of their possible values. The results show that 40Ar recoil can lead to various deformations of the illite structure, often accompanied by the displacement of OH groups or breaking of the Si-O bonds. Depending on the recoil angle, there are four possible final positions of the 40Ar atom with respect to the 2:1 layer at the end of the simulation: it can remain in the interlayer space or end up in the closest tetrahedral, octahedral or the opposite tetrahedral sheet. No simulation angles were found for which the 40Ar atom after recoil passes completely through the 2:1 layer. The energy barrier for 40Ar passing through the hexagonal cavity from the tetrahedral sheet into the interlayer was calculated to be 17 kcal/mol. This reaction is strongly exothermic, therefore there is almost no possibility for 40Ar to remain in the tetrahedral sheet of the 2:1 layer over geological time periods. It will either leave the crystal, if close enough to the edge, or return to the interlayer space. On the other hand, if 40Ar ends up in the octahedral sheet after recoil, a substantially higher energy barrier of 55 kcal/mol prevents it from leaving

  9. A Survey on Web-based AR Applications

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  10. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  11. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  12. 40Ar-39Ar dating of Luna 16 and Luna 20 samples

    Two fragments of Luna 16 mare basalt and two Luna 20 samples (one metaclastic fragment and a group of five anorthositic particles) from the Royal Society allocation have been dated by using the 40Ar-39Ar technique. The Luna 16 ages confirm that mare lavas were extruded in Mare Fecunditatis 3.4 to 3.5 Ga ago. Similarly, the age of the Luna 20 metaclastic fragment provides further support for a 3.9 Ga age for the Crisium basin and for the widespread cataclysmic bombardment of the moon between 4.05 and 3.85 Ga. The presence of at least two isotopically distinct, non-radiogenic argon components in the Luna 20 anorthositic sample comprises an unequivocal age assignment but the simplest model leads to a plateau age of 4.40 +- 0.10 Ga and a minimum age of 4.30 +- 0.10 Ga. There are now several lunar highland samples which are significantly older than 4.0 Ga and which give rise to a secondary age grouping in the interval 4.2 to 4.3 Ga. Depending on whether highland ages were primarily reset during the excavation of a large number of medium-sized craters or a small number of large basins, this secondary grouping implies either a significant peak in the cratering rate at 4.0 Ga or statistical fluctuations in a monotonically decreasing cratering rate. (author)

  13. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  14. Geology and 40Ar/39Ar Geochronology of Akutan Volcano, Eastern Aleutian Islands

    Coombs, M. L.; Jicha, B. R.

    2013-12-01

    40Ar/39Ar dating and new whole-rock geochemical analyses are used to establish an eruptive chronology for Akutan volcano, Akutan Island, in the eastern Aleutian island arc. Akutan Island (166° W, 54.1° N) is the site of long-lived volcanism and the entire island comprises volcanic rocks as old as 3.3 Ma (Richter et al., 1998, USGS Open-File 98-135). Our current focus is on the 225 km2 western half of the island, which is home to the Holocene active cone, Holocene to latest Pleistocene satellite vents, and underlying middle Pleistocene volcanic basement rocks. Eruptive products span the tholeiitic-calc-alkaline boundary, are medium-K, and range from basalt to dacite. Furnace incremental heating experiments on groundmass separates of 38 samples resulted in 29 40Ar/39Ar ages. The remainder did not yield radiogenic 40Ar contents and are likely Holocene in age. The oldest ages (1251×10 and 1385×12 ka) are from a wedge of flat-lying dissected lavas north of the Holocene cone; these likely represent the upper part of the volcanic basement that underlies the entire island. Above a major unconformity lie basaltic andesite to dacite lavas that range from 765× 4 to 522×8 ka. The eroded remnants of the source volcano for these flows appears to crop out as a series of variably hydrothermally altered breccias and domes 5 km east-northeast of the current summit. A 625 m-tall eroded basaltic center, Lava Peak, sits 6 km northwest of the summit; its deeply incised western flank exposes lava flows and a plug. Two flows are dated at 598×16 and 602×15 ka. A high ridge 1.5 km south of the summit is made of oxidized, mostly andesitic lavas 284-249 ka old; these are presumably the remnants of an eruptive center located near the current cone. Flat Top Peak, 3.5 km southwest of the summit, produced almost exclusively basalts and six dated lavas range from 155×8 to 98×18 ka. Lavas from Flat Top (1065 m asl) are deeply eroded suggesting extensive ice cover during marine isotope

  15. Acesso ao cuidado à saúde da criança em serviços de atenção primária

    Rosane Meire Munhak da Silva

    2014-10-01

    Full Text Available Realizou-se uma pesquisa de abordagem qualitativa com base no referencial metodológico da hermenêutica dialética, com o objetivo de identificar o atributo acesso da atenção primária para a resolução dos problemas de saúde de crianças menores de um ano a partir dos relatos de pais e cuidadores. Envolveram-se 16 cuidadores de crianças atendidas em unidades de pronto atendimento de Cascavel-PR, em 2010. Foram reconhecidas quatro categorias temáticas: Aconselhamento familiar ao buscar atenção à saúde da criança; Ausência de acolhimento ao primeiro contato; Presença de classificação de risco para atenção à saúde da criança; Barreiras que impedem o acesso à atenção à saúde. Concluiu-se que as famílias exibiram dificuldades para alcançar resolutividade aos problemas de saúde dos filhos, mediante a falta de acesso aos serviços de atenção primária.

  16. Dicty_cDB: FC-AR08 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  17. Dicty_cDB: FC-AR06 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  18. Dicty_cDB: FC-AR18 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  19. Dicty_cDB: FC-AR14 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  20. Dicty_cDB: FC-AR09 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  1. Applications of 37Ar, 39Ar and 85Kr in hydrology, oceanography and atmospheric studies. Current state of the art

    Knowledge of the atmospheric concentrations of 37Ar, 39Ar and 85Kr is required to apply these isotopes in hydrology and oceanography; these concentrations are reported on in the paper. It is demonstrated in a general way, and for specific examples, how 39Ar and 85Kr results can be used for groundwater dating. The combination of these isotope results with 3H and 14C data is discussed. Subsurface production of 39Ar may limit its application in dating, but could yield information about underground processes, particularly if the results are combined with other isotope data such as 37Ar and 222Rn. Argon-39 is applied in oceanography as a steady state tracer and allows valuable conclusions to be reached on the formation and ventilation rates of deep ocean water. Examples from the deep North Atlantic and for a depth profile in the Pacific illustrate how conclusions on the mixing, ageing and flow rates can be drawn from 39Ar results. The origin of measured 37Ar activity values in tropospheric air is described, and selected time series are used to discuss atmospheric circulation processes. (author). 12 refs, 6 figs, 2 tabs

  2. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  3. 40Ar/39Ar dating and geochemistry of tholeiitic magmatism related to the early opening of the Central Atlantic rift

    Tholeiitic effusive and intrusive magnetism from Iberia, Morocco, Algeria and Mali, realted to the early opening of the Central Atlantic rift, was dated by the 40Ar/39Ar step-heating method. Four plateau ags, rangin from 203.7±2.7 to 197.1±1.8 Ma, were obtained on plagioclase from dykes from theTaoudenni area (Mali) and two lava flows from Morocco. The Messejana dyke (Iberia), which previously yielded discrepant conventional K-Ar dates, did not furnish any 40Ar/39Ar plateau dates. However, there is a clear inverse relationship between apparent age and K/Ca atio for gas fractions from a plagioclase separate (proportional to the alteration degree) which, combined with dates obtained on amphibole, biotite and pyroxene, allows us to determine an age of around 200 Ma for this body. These data, and those obtained on the Foum Zguid (Morocco) and the Ksi Ksou (Algeria) dykes, give evidence of a brief magmatic event (between 206 and 195 Ma ago) which affected a large area ca. 2500 km long. Trace-element modelling shows that most of these formations originated from a homogeneous, enriched, source material. Such a brief magmatic episode related to the opening of a continental rift is in agreement with findings in other magmatic provinces (e.g. the Deccan traps and the Red Sea rift, precisely dated by the 40Ar/39Ar method as well). (orig.)

  4. DNA damages induced by Ar F laser

    The photo ablation process used in corneal refractive surgery by the Argon Fluoride (Ar F) laser emitting in ultraviolet C at 193 nm, exposes viable cells round the irradiated zone to sub ablative doses (< 400 joules.m -2). Despite that DNA absorption is higher at 193 nm than 254 nm, cytotoxicity of 193 nm laser radiation is lower than radiation emitted by 254 nm UV-C lamps. In situ, DNA could be protected of laser radiation by cellular components. Consequently, some authors consider that this radiation does not induce genotoxic effect whereas others suspect it to be mutagenic. These lasers are used for fifteen years but many questions remain concerning the long term effects on adjacent cells to irradiated area. The purpose of this study is to describe the effect of 193 nm laser radiation on DNA of stromal keratocytes which are responsible of the corneal structure. The 193 nm laser irradiation induces directly DNA breakage in keratocytes as it has been shown by the comet assay under alkaline conditions. Two hours post irradiation, damages caused by the highest exposure (150 J.m-2) are not repaired as it has been measured with the Olive Tail Moment (product of tail length and tail DNA content). They give partly evidence of induction of an apoptotic process in cells where DNA could be too damaged. In order to characterize specifically double strand breaks, a comparative analysis by immunofluorescence of the H2 Ax histone phosphorylation (H2 Ax) has been performed on irradiated keratocytes and unirradiated keratocytes. Results show a dose dependent increase of the number of H2 Ax positive cells. Consequences of unrepaired DNA lesions could be observed by the generation of micronuclei in cells. Results show again an increase of micronuclei in laser irradiated cells. Chromosomal aberrations have been pointed out by cytogenetic methods 30 mn after irradiation. These aberrations are dose dependent (from 10 to 150 J.m-2). The number of breakage decreases in the long run

  5. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  6. Numerical simualtion of underground 37Ar transportation to the ground

    Monitoring radioactive gas 37Ar is an important technique for the On-Site Inspection(OSI) of the Comprehensive Nuclear Test Ban Treaty (CTBT) verification regime. In order to establish a theoretical model that can be used to calculate the appearing time and radioactivity of 37Ar which transports to the ground after a nuclear explosion, the rock media in the test area is assumed to be a homogeneous porous media, without consideration of gas absorption by and release from the rock media. The seepage model in the porous media is used to calculate 37Ar transportation. Computational results give the time 37Ar leaks to the ground and the variation of its radioactivity with time. And we can analyze and consider the computational results when we have developed OSI noble gas monitoring systems and evaluated their effectiveness. (authors)

  7. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  8. Ar2 - O2 RF plasma diagnostics by mass spectrometry

    An investigation on the nature, energy and fluxes of the dominant species from a rf 13.56 MHz argon-oxygen plasma was carried out using a quadrupolar mass spectrometer. The mass spectrometer is sampling the plasma species through the anode space charge, being placed on the grounded electrode - the chamber wall. The ion energy distributions of most important ions from plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated using the mass spectrometer. The main results are as follows: i) the oxygen addition in the argon discharge leads to the plasma potential decreasing and therefore the potential difference on the sheath formed in front of the anode wall is diminished as compared with the discharge in pure argon; ii) the combination of two effects, the rf modulation of the sheath potential, and the charge exchange, as a dominant inelastic interaction process in the sheath, leads to pronounced and characteristic additional structures in the ion energy distributions. (authors)

  9. K-Ar ages of dikes in Northeast Japan

    Thirteen dike swarms in Northeast Japan were dated by the K-Ar method. The K-Ar ages in this study give some crucial constraints to the volcanostratigraphy and imply that the geological situation of some dike swarms estimated in the other studies should be reexaminned while other dike swarms showed the K-Ar ages concordant with the geological ages. Available K-Ar ages of the volcanic rocks from the present and other studies indicate that the volcanic front in Northeast Japan had a temporal position about 22-23Ma ago to the east of that in the Quaternary and that the volcanism appears to have been inactive from 17 to 21Ma ago. (author)

  10. Avaliação clínica e evolutiva de crianças em programa de atendimento ao uso de fórmulas para alergia à proteína do leite de vaca

    Ana Laissa O. Aguiar

    2013-06-01

    Full Text Available OBJETIVO: Determinar características clínicas e evolutivas de crianças acompanhadas em programa de referência para fornecimento de fórmulas especiais para alergia ao leite de vaca. MÉTODOS: Estudo descritivo, realizado em amostra de conveniência, com 214 crianças até três anos, com diagnóstico clínico e/ou teste padronizado de provocação oral aberto, referenciadas ao Programa de Fórmulas para Alergia ao Leite de Vaca, em Hospital Universitário Pediátrico de Natal, Rio Grande do Norte (2007/2009. Avaliaram-se dados clínico-epidemiológicos e indicação de fórmulas (soja, hidrolisado ou aminoácido à consulta inicial, além de resposta clínica e evolução nutricional (Anthro-OMS 2006 após três meses. Aplicaram-se os testes do qui-quadrado e t pareado nas análises, considerando-se significante p<0,05. RESULTADOS: Ao primeiro atendimento, a média de idade foi de 9,0±6,9 meses. Manifestações digestórias foram observadas em 81,8%; cutâneas, em 36,9%; e respiratórias, em 23,8%. Escore Z do IMC <-2,0 desvios padrão (DP foi encontrado em 17,9% das crianças com sintomas digestórios isolados, em 41,7% em uso de leite de vaca e em 8,7% com outras fórmulas (p<0,01. Fórmula de proteína isolada de soja foi usada em 61,2%; hidrolisados, em 35,4%; e aminoácidos, em 3,3%. As médias de escore Z do IMC ao atendimento inicial e após três meses foram, respectivamente, -0,24±1,47DP e 0,00±1,26DP (p=0,251, quando em uso de soja, e -0,70±1,51DP e -0,14±1,36DP (p=0,322, em uso de hidrolisado. CONCLUSÕES: Manifestações digestórias da alergia ao leite de vaca foram preponderantes e determinaram maior comprometimento nutricional. As fórmulas de substituição ao leite de vaca mais utilizadas foram de proteína isolada de soja e hidrolisados proteicos. O uso de ambas foi importante para a manutenção do estado nutricional.

  11. Augmented Reality Computer-Aided Drawing (AR-CAD)

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  12. Second generation Robo-AO instruments and systems

    Baranec, Christoph; Law, Nicholas M; Chun, Mark R; Lu, Jessica R; Connelley, Michael S; Hall, Donald; Atkinson, Dani; Jacobson, Shane

    2014-01-01

    The prototype Robo-AO system at the Palomar Observatory 1.5-m telescope is the world's first fully automated laser adaptive optics instrument. Scientific operations commenced in June 2012 and more than 12,000 observations have since been performed at the ~0.12" visible-light diffraction limit. Two new infrared cameras providing high-speed tip-tilt sensing and a 2' field-of-view will be integrated in 2014. In addition to a Robo-AO clone for the 2-m IGO and the natural guide star variant KAPAO at the 1-m Table Mountain telescope, a second generation of facility-class Robo-AO systems are in development for the 2.2-m University of Hawai'i and 3-m IRTF telescopes which will provide higher Strehl ratios, sharper imaging, ~0.07", and correction to {\\lambda} = 400 nm.

  13. Características produtivas, agronômicas e nutricionais do capim-tanzânia em cinco diferentes idades ao corte Productivity, agronomical and nutritional traits of Tanzânia grass cut on five different ages

    G.H.F. Castro; N.M. Rodriguez; L.C. Gonçalves; R.M. Maurício

    2010-01-01

    Avaliou-se o capim-tanzânia (Panicum maximum cv Tanzânia) cortado aos 42, 63, 84, 107 e 126 dias quanto à produtividade, às características agronômicas, à composição bromatológica e à digestibilidade in vitro. Observou-se aumento na altura da planta do capim-tanzânia até os 84 dias, com aumento da produção de massa verde de forragem e aumento na produção de matéria seca com o avançar da idade ao corte. O aumento da idade ao corte resultou em diminuição do percentual de folhas e em aumento no ...

  14. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  15. Diffraction-limited Visible Light Images of Orion Trapezium Cluster With the Magellan Adaptive Secondary AO System (MagAO)

    Close, L M; Morzinski, K; Kopon, D; Follette, K; Rodigas, T J; Hinz, P; Wu, Y-L; Puglisi, A; Esposito, S; Riccardi, A; Pinna, E; Xompero, M; Briguglio, R; Uomoto, A; Hare, T

    2013-01-01

    We utilized the new high-order (250-378 mode) Magellan Adaptive Optics system (MagAO) to obtain very high spatial resolution observations in "visible light" with MagAO's VisAO CCD camera. In the good-median seeing conditions of Magellan (0.5-0.7") we find MagAO delivers individual short exposure images as good as 19 mas optical resolution. Due to telescope vibrations, long exposure (60s) r' (0.63 micron) images are slightly coarser at FWHM=23-29 mas (Strehl ~28%) with bright (R<9 mag) guide stars. These are the highest resolution filled-aperture images published to date. Images of the young (~1 Myr) Orion Trapezium Theta 1 Ori A, B, and C cluster members were obtained with VisAO. In particular, the 32 mas binary Theta 1 Ori C1/C2 was easily resolved in non-interferometric images for the first time. Relative positions of the bright trapezium binary stars were measured with ~0.6-5 mas accuracy. We now are sensitive to relative proper motions of just ~0.2 mas/yr (~0.4 km/s at 414 pc) - this is a ~2-10x improv...

  16. All About Portugal - Website dedicado ao turismo externo em Portugal

    Martins, Rui Manuel da Silva

    2015-01-01

    Grande parte do tráfego online tem origem em páginas de resultados de motores de de pesquisa. Estes constituem hoje uma ferramenta fundamental de que os turistas se socorrem para pesquisar e filtrar a informação necessária ao planeamento das suas viagens, sendo, por isso, bastante tidos em conta pelas entidades ligadas ao turismo no momento da definição das suas estratégias de marketing. No presente documento é descrita a investigação feita em torno do modo de funcionamento ...

  17. Relação entre o ruído e as variáveis do processo produtivo na indústria extractiva a céu aberto

    Matos, Maria Luísa Ferreira; Baptista, João Santos; Diogo, M. Tato

    2011-01-01

    O ruído está intimamente associado a todos os processos industriais, sendo os ligados à indústria extractiva dos mais ruidosos. O presente artigo pretende equacionar o estado da arte relativamente a relações entre a variável ocupacional – Ruído e as inerentes ao processo produtivo. Teve por base uma pesquisa bibliográfica, desenvolvida através da combinação de um conjunto de palavras-chave, pré-definidas, diretamente ligadas às varáveis a tratar. Da pesquiza efectuada pode-se conc...

  18. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  19. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    -Instruments multi-collector Noblesse noble gas mass spectrometer configured with a faraday detector and three ion-counting electron multipliers. The instrument has the capability to measure several noble gas isotopes simultaneously and to change measurement configurations instantaneously by the use of QUAD lenses......New generation, high resolution, multi-collector noble gas mass spectrometers equipped with ion-counting electron multipliers provide opportunities for improved accuracy and precision in 40Ar/39Ar dating. Here we report analytical protocols and age cross-calibration studies using a NU...... (zoom optics). The Noblesse offer several advantages over previous generation noble gas mass spectrometers and is particularly suited for single crystal 40Ar/39Ar dating because of: (i) improved source sensitivity (ii) ion-counting electron multipliers, which have much lower signal to noise ratios than...

  20. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  1. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  2. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  3. Evolution of the northern Sierra Nevada metamorphic belt: Petrological, structural, and Ar/Ar constraints

    Hacker, B.R. [Stanford Univ., CA (United States)

    1993-05-01

    The Sierra Nevada metamorphic belt constitutes an important record of the growth of continental crust from essentially oceanic materials. In the northern Sierra, the central part of the belt is made up of volcanoplutonic arcs and sediment-dominated units inferred to be accretionary wedges or closed ocean basins. The latter are broken formation and melange composed of radiolarian chert, lava, and volcanogenic and continental turbidites. Sedimentary detritus in the largest of these units can be plausibly linked to sources farther east in the Sierra, suggesting that deposition occurred near the eastern Sierran arc. Isoclinal folds, steeply dipping foliations, and steeply plunging down-dip lineations are characteristics structures. The westernmost unit is only feebly recrystallized, and deformation was accomplished principally by stress solution and local redeposition in veins. More easterly, inboard units are compositionally similar, but they recrystallized at pumpellyite-actinolite-and blueschist-facies conditions and deformed via solution-transfer and dislocation creep. Phengite silica contents, the degree of quartz veining, and the locations of pseudo-isograds support an eastward increase in metamorphic pressure and temperature. Metamorphic conditions during the growth of pumpellyite and actinolite ranged from {approximately}150-350 {degrees}C and 200-400 MPa, compatible with recrystallization and deformation in subduction zones or the deeper levels of magmatic arcs. Ar/Ar ages of volcanisclastic rocks and crosscutting plutons constrain the age of deformation and metamorphism in the western part of the region to 174-165 Ma. Deformation and recrystallization in more easterly units may have been coeval or begun as early as Triassic time. 58 refs., 14 figs., 4 tabs.

  4. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  5. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  6. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  7. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  8. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  9. Dicty_cDB: FC-AR20 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  10. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  11. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  12. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  13. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  14. Mass spectrometric measurements in inductively coupled CF4/Ar plasmas

    Positive ion fluxes, mean ion energies and ion energy distribution functions in low pressure CF4/Ar plasmas have been measured. The experiments were conducted in a Gaseous Electronics Conference cell using an inductively coupled plasma device powered by a 13.56 MHz radiofrequency (rf) power source. The measurements were made at 200 and 300 W of input rf power and at 10, 20, 30 and 50 mTorr gas pressures for three gas mixtures: (i) 20% CF4 : 80% Ar, (ii) 50% CF4 : 50% Ar and (iii) 80% CF4 : 20% Ar. A Langmuir probe was also used to measure plasma parameters such as ne, ni+ and electron energy distribution functions (EEDF) which were subsequently used to reconcile the mass spectrometer data. CF3+ is the most dominant fluorocarbon ion product of the plasma, followed by CF2+ and CF+. Ar+ is also detected in significant amounts with its relative flux increasing with the increase in Ar content in the gas mixture. Significant amounts of etch products, SiFx+/COF+x (x = 0-3), of the quartz window were also detected. The fluorocarbon ions are produced by direct electron impact and by ion-molecule reactions between Ar+ and CF4 as well as between CF3+ and CF4. However, the concentrations of CF2+ and CF+ are much larger than that which can be possibly produced from these two processes. The available cross-section data suggest that the direct electron impact ionization of the fragment neutrals and negative ion production by electron attachment may be responsible for the increase in the concentrations of the minor ions. F- densities, estimated by using the measured EEDF and positive ion flux data and the available cross-section data, agree well with the published experimental data

  15. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  16. On some Polychaetous Annelids from Curaçao

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for identificati

  17. A IMPORTÂNCIA DO TRABALHO DO PSICÓLOGO ESCOLAR AOS DOCENTES EM ESCOLAS PÚBLICAS

    Marlúcia Silva Garcia Antunes Costa

    2014-12-01

    Full Text Available Este trabalho tem por objetivo mostrar a importância do trabalho do psicólogo educacional aos docentes em escolas públicas. Diante dos relatos cada vez mais frequentes de professores agredidos, afastados de seu ofício por estresse, fadiga, doenças psicossomáticas ou simplesmente por desmotivação, faz-se necessário lançar um olhar mais atento sobre a docência. É importante destacar que os problemas socioeconômicos que assolam a sociedade brasileira são cada vez mais complexos. Nesse sentido, este estudo se propõe a apontar que o professor em sua jornada de trabalho precisa de apoio e orientação da área da psicologia possibilitando assim numa melhoria no ensino-aprendizagem e na relação professor-aluno. A partir de uma pesquisa bibliográfica busca-se compreender os benefícios do trabalho do psicólogo educacional ao docente, sejam eles tanto em qualidade de vida quanto em relação às atividades que realiza na escola. Os resultados demonstraram que diante da violência no cotidiano das escolas e o descaso de modo geral com a profissão do docente, o psicólogo deve ser inserido no ambiente escolar de forma sistemática e urgente com vistas a melhores condições de trabalho aos professores e maior valorização da classe, e, por conseguinte, da educação como um todo.

  18. Isochronic K-Ar age and helium isotopes of hyperbasite dike, Mossel peninsula, New Frisland (Spitsbergen)

    The age of a series of ultrabasic rocks and minerals, forming a hyperbasite dike in Mossel peninsula, Spitsbergen, was estimated by the isochronous K-Ar method using 40Ar/36Ar-40K/36Ar coordinates. The age of three peridotite samples and one olivine sample is found to be 1870±52 Ma

  19. Potential and opportunities for 40Ar-39Ar geochronology and thermochronology research in India. PD-3-4

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. For slowly cooled rocks, the K-Ar system yields ages that generally reflect the time elapsed since cooling below the closure temperature for argon of the mineral being analyzed and therefore becomes an extremely powerful tool for thermochronologic studies of orogenic systems. In recent years application of laser microprobe heating has enhanced the capabilities of this technique. Conventional 40Ar-39Ar step-heating experiments are designed to determine the bulk closure ages of aggregates of minerals like hornblende, muscovite, and biotite. The use of multidomain diffusion (MDD) modeling of K-feldspar developed by Lovera et al.,1989, has today become a very powerful tool for thermochronologic studies which provide constraints on the unroofing history of orogenic belts. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in polydeformed specimens

  20. High-resolution Auger spectroscopy on 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions after excitation by helium

    In this thesis the atomic structure of highly excited Ar6+ and Ar7+ ions was studied. For this 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions of a heavy ion accelerator were excited by a He gas target to autoionizing states and the Auger electrons emitted in the decay were measured in highly-resolving state. The spectra were taken under an observational angle of zero degree relative to the beam axis in order to minimize the kinematical broadening of the Auger lines. (orig./HSI)

  1. Fission-fragment nuclear lasing of Ar/He/-Xe

    De Young, R. J.; Shiu, Y. J.; Williams, M. D.

    1980-01-01

    Nuclear-pumped lasing of Ar-Xe and He-Xe has been demonstrated using (U-235)F6 fission-fragment excitation. Fission fragments were created by absorption of thermal neutrons in a combination of gaseous (U-235)F6 and laser-tube wall coatings formed from UF6 chemical reaction products. At a pressure of 600 torr Ar-(3%)Xe, lasing occurred at 2.65 microns in Xe. Up to 3 torr of gaseous (U-235)F6 was added to 600 torr Ar-Xe before serious laser quenching occurred. With 3 torr of (U-235)F6 added, 38% of the energy deposition came from gaseous UF6 and the remainder from the uranium wall coating. The neutron flux at lasing threshold was found to be 4 x 10 to the 15th n/sq cm sec.

  2. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  3. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  4. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  5. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  6. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  7. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  8. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  9. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  10. Two-proton emission in the decay of 31Ar

    Several beta-delayed two-proton branches were observed in the decay of 31Ar, the most intense ones proceeding through the isobaric analogue state (IAS) in 31Cl. The mechanism of the two-proton emission is studied via the energy and angular distributions of the two protons. Simultaneous emission of the two protons fits the present data well, sequential decays might also describe them. Independent of the decay mechanism, a spin of 5/2 for the IAS is suggested. An improved limit on the direct two-proton emission from the ground state of 31Ar is presented. (orig.)

  11. Efeito dos incêndios florestais na qualidade do ar

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  12. Axenfeld-Rieger syndrome (ARS): A review and case report.

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  13. Effects of Ar+ ion implantation on tribological behaviour of UHMWPE

    Ultra-high molecular weight polyethylene (UHMWPE) was implanted with Ar+. The modified surfaces were characterized by OM, AFM and NTM and FT-IR. And, tribological behaviour of UHMWPE was evaluated using a tribometer. The results show that alterations in surface colour, morphology and microstructure of UHMWPE were induced by Ar+ implantation, and the mechanical properties in terms of microhardness and elastic modulus were improved. The wear properties of modified UHMWPE were enhanced significantly, both in dry friction and under deionized water lubrication. The degree of property improvement increased with the implantation dose, with increasing friction coefficient, though. (authors)

  14. Development of a low-level Ar-37 calibration standard

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  15. Arándano rojo I (Vaccinium macrocarpon Ait.)

    Garrido Conejero, M. Victoria; Pérez-Urria Carril, Elena

    2014-01-01

    El arándano rojo o arándano rojo americano (Vaccinium macrocarpon Ait.) es una fruta muy consumida y apreciada que ha ganado popularidad con los años debido en parte a su contenido en compuestos beneficiosos para la salud humana. En el trabajo se consideran aspectos botánicos, composición nutricional y contenido en compuestos fitoquímicos, datos históricos y culturales e información sobre el cultivo de esta especie vegetal y sus variedades. También se considera su importancia económica y algu...

  16. Adsorption of Ar on a nonuniform MgO surface

    Hinman, D. C.; Halsey, G. D.

    1976-01-01

    Data are presented for the adsorption of Ar and N2 on a strongly heterogeneous MgO surface at 84 K and for Ar at a range of temperatures between 130 and 250 K. The high-temperature data are analyzed according to a model which separates the contributions to the potential into bulk and surface terms, providing a method for the determination of the surface area from parameters characteristic of the bulk material. A solid-gas energy parameter and parameters indicating the strength of the impurity sites are also evaluated.

  17. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  18. Web authentic and similar texts detection using AR digital signature

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  19. Medidas da umidade relativa do ar em um ambiente fechado

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  20. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  1. Inorganic arsenic and human prostate cancer Arsênico inorgânico e câncer de próstata humano

    Lamia Benbrahim-Tallaa

    2009-02-01

    Full Text Available We critically evaluated the etiologic role of inorganic arsenic in human prostate cancer. We assessed data from relevant epidemiologic studies concerning environmental inorganic arsenic exposure. Whole animal studies were evaluated as were in vitro model systems of inorganic arsenic carcinogenesis in the prostate. Multiple studies in humans reveal an association between environmental inorganic arsenic exposure and prostate cancer mortality or incidence. Many of these human studies provide clear evidence of a dose-response relationship. Relevant whole animal models showing a relationship between inorganic arsenic and prostate cancer are not available. However, cellular model systems indicate arsenic can induce malignant transformation of human prostate epithelial cells in vitro. Arsenic also appears to impact prostate cancer cell progression by precipitating events leading to androgen independence in vitro. Available evidence in human populations and human cells in vitro indicates that the prostate is a target for inorganic arsenic carcinogenesis. A role for this common environmental contaminant in human prostate cancer initiation and/or progression would be very important.Realizamos uma avaliação crítica do papel etiológico do arsênico inorgânico no câncer de próstata humano. Avaliamos dados de estudos epidemiológicos relevantes referentes à exposição ao arsênico inorgânico ambiental. Foram avaliados estudos com animais completos, bem como sistemas de modelo in vitro de carcinogênese decorrente de arsênico inorgânico na próstata. Estudos múltiplos em seres humanos revelaram uma associação entre exposição ao arsênico inorgânico ambiental e mortalidade por ou incidência de câncer de próstata. Muitos desses estudos em seres humanos oferecem indícios claros de uma relação dose-resposta. Não se encontram disponíveis modelos animais completos relevantes que mostrem uma relação entre arsênico inorgânico e câncer de

  2. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  3. Sobre a viagem de Enrico Fermi ao Brasil em 1934

    Caruso, Francisco

    2014-01-01

    Enrico Fermi was one of the greater physicists of the XX century. In 1934, he gave several lectures in Brazil. Invited by Theodoro Ramos to work in S\\~ao Paulo, he preferred to stay in Rome and went to the USA in 1938. However, Fermi recommended Gleb Wataghin to come in his place. Wataghin made history in Brazil, becoming one of the first Professors of the future S\\~ao Paulo University. Besides his relevance to the History of Science, Fermi eventually leaved an indelible mark on the creation and institutionalization of national scientific research due to the indication of Wataghin. Despite this fact, very little is known about Fermi's trip to Brazil. This work tries to reconstruct the fullest possible steps of the famous Italian physicist in our lands.

  4. O prazer associado ao consumo de alimentos e factores influenciadores

    Gomes, Filipe Gonçalo Ferreira

    2013-01-01

    Os indivíduos quando sujeitos a várias sensações transmitem respostas que surgem de reacções fisiológicas resultantes de certos estímulos, gerando a interpretação das propriedades intrínsecas aos alimentos, sendo a análise sensorial realizada em função dessas respostas individuais. As sensações são medidas por efeitos psicológicos, podendo dimensionar a intensidade, extensão, qualidade, duração, gosto ou desgosto em relação ao alimento avaliado, e os estímulos são medidos por processos físico...

  5. Diffraction limited operation with ARGOS: a hybrid AO system

    Bonaglia, M.; Busoni, L.; Quirós-Pacheco, F.; Esposito, S.

    2010-07-01

    ARGOS, the Laser Guide Star (LGS) facility of the Large Binocular Telescope (LBT), implements a Ground Layer Adaptive Optics (GLAO) system, using 3 low-altitude beacons, to improve the resolution over the 4'×4' FoV of the imager and Multi Object Spectrograph (MOS) LUCIFER. In this paper we discuss the performance and the reconstruction scheme of an hybrid AO system using the ARGOS Rayleigh beacons complemented with a single faint high-altitude star (NGS or sodium beacon) to sense the turbulence of the upper atmosphere allowing an high degree of on-axis correction. With the ARGOS system, the NGS-upgrade can be immediately implemented at LBT using the already existing Pyramid WFS offering performance similar to the NGS AO system with the advantage of a larger sky coverage.

  6. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  7. Pneumonia lipoide secundária ao uso prolongado de óleo de prímula Lipoid pneumonia secondary to long-term use of evening primrose oil

    Marcelo Fouad Rabahi

    2010-10-01

    Full Text Available A pneumonia lipoide é uma doença pouco diagnosticada, causada pela aspiração de partículas oleosas para dentro dos pulmões. Os casos relatados têm sido relacionados ao uso de óleo mineral como laxativo, mas outras soluções oleosas também podem causar a doença. Relatamos o caso de uma paciente de 50 anos com queixa de tosse produtiva, sendo diagnosticada inicialmente com hiper-reatividade brônquica e doença do refluxo gastroesofágico (DRGE. A paciente foi submetida a tratamento para DRGE. Devido à persistência da tosse, a paciente foi submetida a TC de tórax, fibrobroncoscopia e biópsia pulmonar a céu aberto, sendo diagnosticada com pneumonia lipoide. A paciente foi questionada quanto ao uso de substâncias oleosas, relatando o uso crônico de óleo de prímula. Com a suspensão do uso da substância e a continuidade do tratamento para DRGE, houve melhora do quadro.Lipoid pneumonia is an underdiagnosed disease that is caused by the aspiration of lipid particles into the lungs. Although most of the reported cases have been associated with the use of mineral oil as a laxative, other lipid substances can also cause the disease. We report the case of a 50-year-old female patient with a complaint of productive cough who was initially diagnosed with bronchial hyperresponsiveness and gastroesophageal reflux disease (GERD. The patient was treated for GERD. Because the productive cough persisted, the patient underwent chest CT, fiberoptic bronchoscopy, and open lung biopsy. She was diagnosed with lipoid pneumonia. The patient was questioned regarding the use of lipid substances, and she reported the chronic use of evening primrose oil. After the discontinuation of the substance and the maintenance of GERD treatment, her condition improved.

  8. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  9. Late Cretaceous remagnetization of Proterozoic mafic dikes, southern Highland Mountains, southwestern Montana: A paleomagnetic and 40Ar/39Ar study

    Harlan, S.S.; Geissman, J.W.; Snee, L.W.; Reynolds, R.L.

    1996-01-01

    Paleomagnetic results from Early Proterozoic metabasite sills and Middle Proterozoic diabase dikes from the southern Highland Mountains of southwestern Montana give well-defined, dual-polarity magnetizations that are statistically identical to those from a small Late Cretaceous pluton that cuts the dikes. The concordance of paleomagnetic directions from rocks of three widely separated ages indicates that the Proterozoic rocks were remagnetized, probably during Late Cretaceous time. Paleomagnetic, rock magnetic, and petrographic observations from the metabasite and diabase samples indicate that remanence is carried primarily by low-Ti magnetite. Combining virtual geomagnetic poles from metabasite sills, diabase dikes, and the Late Cretaceous pluton, we obtain a paleomagnetic pole at 85.5??N, 310.7??E (K = 19.9, A95 = 9.1??, N = 14 sites) that is similar to a reference pole from the 74 Ma Adel Mountain Volcanics of western Montana. Biotite and hornblende 40Ar/39Ar isotopic dates from host basement geneiss and a hornblende from a remagnetized metabasite sill yield ages of ca. 1800 Ma; these dates probably record cooling of the southern Highland Mountains following high-grade metamorphism at 1.9-1.8 Ga. The gneiss and metabasite age spectra show virtually no evidence of disturbance, indicating that the basement rocks were never heated to temperatures sufficient to cause even partial resetting of their argon systems. Thus, the overprint magnetization of the Highland Mountains rocks is not a thermoremanent magnetization acquired during conductive cooling of nearby Late Cretaceous plutons. Remagnetization of the metabasite sills and diabase dikes was probably caused by localized thermochemical and thermoviscous effects during circulation of Late Cretaceous hydrothermal fluids related to epithermal mineralization. The absence of significant disturbance to the 40Ar/39Ar age spectrum from the remagnetized metabasite hornblende indicates that some secondary magnetizations may

  10. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  11. Resposta ao estresse: I. Homeostase e teoria da alostase

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  12. LDEF results for polymer-matrix composite experiment AO 180

    This report represents a summary of the results obtained to-date on a polymer matrix composite experiment (AO 180) located at station D-12, about 82 deg off the 'ram' direction. Different material systems comprised of graphite, boron, and aramid (Kevlar) fiber reinforcements were studied. Although previous results were presented on in-situ thermal-vacuum cycling effects, particularly dimensional changes associated with outgassing, additional comparative data will be shown from ground-based tests on control and flight samples. The system employed was fully automated for thermal-vacuum cycling using a laser interferometer for monitoring displacements. Erosion of all three classes of materials due to atomic oxygen (AO) will also be discussed, including angle of incidence effects. Data from this experiment will be compared to published results for similar materials in other LDEF experiments. Composite materials' erosion yields will be presented on an AO design nomogram useful for estimating total material loss for given exposure conditions in low Earth orbit (LEO). Optical properties of these materials will also be compared with control samples. A survey of the damage caused by micrometeoroids/debris impacts will be addressed as they relate to polymer matrix composites. Correlations between hole size and damage pattern will be given. Reference to a new nomogram for estimating the number distribution of micrometeoroid/debris impacts for a given space structure as a function of time in LEO will be addressed based on LDEF data

  13. Laboratory demonstration of real time frame selection with Magellan AO

    Males, Jared R.; Close, Laird M.; Kopon, Derek; Quiros-Pacheco, Fernando; Riccardi, Armando; Xompero, Marco; Puglisi, Alfio; Gasho, Victor; Morzinski, Katie M.; Follette, Katherine B.

    2012-07-01

    The Magellan AO system combines a pyramid wavefront sensor and high-order adaptive secondary mirror, and will see first light on the Magellan Clay telescope in November 2012. With a 24 cm projected actuator pitch, this powerful system will enable good correction in the optical (0.5 to 1 μm). Realistic laboratory testing has produced Strehl ratios greater than 40% in i’ (0.765 μm) on bright simulated stars. On fainter stars our visible AO camera, VisAO, will work in the partially corrected regime with only short moments of good correction. We have developed a form of lucky imaging, called real time frame selection, which uses a fast shutter to block moments of bad correction, and quickly opens the shutter when the correction is good, enabling long integrations on a conventional CCD while maximizing Strehl ratio and resolution. The decision to open or shut is currently based on reconstructed WFS telemetry. Here we report on our implementation and testing of this technique in the Arcetri test tower in Florence, Italy, where we showed that long exposure i’ Strehl could be improved from 16% to 26% when the selection threshold was set to the best 10% of instantaneous Strehl.

  14. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    , although they note that further age dating of all the stones is required to test this hypothesis. We received a split of Dhofar 961 from R. Zeigler consisting of a large clast of IM Lithology B, with some light-colored, friable matrix clinging to the external margins of the impact-melt clast. This lithology was not present in the samples investigated by Joy et al. and thus does not have corresponding U-Pb ages on it. We created multiple subsplits of both the IM and matrix lithologies, each weighing several tens of micrograms. We conducted Ar-40 Ar-39 dating of this candidate SPA material by high-resolution step heating and comparing it with the regolith that surrounds it.

  15. 39Ar/40Ar dating of the trans-Himalayan calc-alkaline magmatism of southern Tibet

    The results are reported of an 39Ar-40Ar age determination investigation which show that the earlier basic plutons of the southern edge of the trans-Himalayan belt have ages of 90-110 Myr (Albian to Cenomanian), whereas the lavas of the upper unconformable series are clearly younger (60 Myr, Palaeocene). Comparing the present results with those obtained from the Ladakh and Kohistan magmatic belts further west it is concluded that a subduction zone has been active during the Cretaceous between India and Asia. (U.K.)

  16. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  17. 40Ar/39Ar ages (600-570 Ma of the Serra do Azeite transtensional shear zone: evidence for syncontractional extension in the Cajati area, southern Ribeira belt

    Rômulo Machado

    2007-12-01

    Full Text Available This paper presents 40Ar/39Ar ages of the rocks from the Serra do Azeite transtensional shear zone in the southern part of the Ribeira belt, between the States of São Paulo and Paraná, and also discusses the regional correlations and the tectonic implications for other parts of the belt. The geochronological data suggest that transtensional deformation was active between 600 and 580 Ma (hornblende and muscovite apparent ages, respectively. This time span is considerably older than previous proposals for the period of activity of these structures (520-480 Ma in the northern segment of this belt and in the Araçuaí belt. Kinematic analysis of the dated mylonites shows extensional structures with top-down movement to ESE compatible with structures found in other tectonic segments in the eastern portion of the Quadrilátero Ferrífero and in the Rio Doce Valley region. Our ages are situated in the same time interval defined for the alkaline magmatism of the Serra do Mar suite. We suggest that the regional tectonic framework was developed during continental-scale extension. This process has been coeval with convergent strain in the adjacent Neoproterozoic shear zones of the Apiaí/Ribeira and Araçuaí belts, which make up significant segments of these belts. The available data show that these structures may not be simply related to post-orogenic gravitational collapse, but must involve a more complex process probably related to dynamic balance between crustal thickening and thinning during tectonic convergence, basin formation and exhumation processes.Este trabalho apresenta idades 40Ar/39Ar de rochas da Zona de Cisalhamento Transtrativa Sinistral da Serra do Azeite, situada na parte sul do cinturão Ribeira, entre os Estados de São Paulo e Paraná, bem como discute a correlação regional e as implicações tectônicas com outras partes do cinturão. Os dados geocronológicos sugerem que a deformação extensional foi ativa entre 600 e 580 Ma

  18. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  19. Pulsed electric field (PEF)research at USDA, ARS, ERRC

    This article summarizes the effects of pulsed electric fields on the microbiological safety and quality aspects of various liquid food matrices, obtained at USDA, ARS, Eastern Regional Research Center under CRIS Project No. 1935-41420-013-00D, Processing Intervention Technologies for Enhancing the S...

  20. Magnetic Energy and Helicity Budgets in NOAA AR 11158

    Tziotziou, Kostas; Liu, Yang

    2013-01-01

    In previous works we introduced a nonlinear force-free method that self-consistently calculates the instantaneous budgets of free magnetic energy and relative magnetic helicity in solar active regions (ARs). Calculation is expedient and practical, using only a single vector magnetogram per computation. We apply this method to a timeseries of 600 high-cadence vector magnetograms of the eruptive NOAA AR 11158 acquired by the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory over a five-day observing interval. Besides testing our method extensively, we use it to interpret the dynamical evolution in the AR, including eruptions. We find that the AR builds large budgets of both free magnetic energy and relative magnetic helicity, sufficient to power many more eruptions than the ones it gave within the interval of interest. For each of these major eruptions, we find eruption-related decreases and subsequent free-energy and helicity budgets that are consistent with the observed eruption (flare a...

  1. Atom trap trace analysis of {sup 39}Ar

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  2. Expansion of the USDA ARS Aerial Application spray atomization models

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  3. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  4. Important authorship clarification for arXiv:1010.2709

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  5. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  6. Quantum vibrational dynamics of the Ar2ICl cluster

    Valdés, Álvaro; Prosmiti, Rita

    2016-03-01

    Quantum mechanical multiconfiguration time-dependent Hartree (MCTDH) calculations are presented for the Ar2ICl cluster. The Hamiltonian operator is expressed in satellite coordinates, with its potential term being represented as a sum of the three-body ArICl ab initio parameterized interactions plus the Ar-Ar ones. The potential surface shows different type of low-lying minima (global and local), that influence the vibrational dynamics of the system. The vibrational ground state properties and specific vibrationally excited states are obtained from improved relaxation MCTDH calculations employing a large number of basis set functions, especially for the angular part, to achieve convergence. By analyzing the spatial density distributions of the vibrational states we are able to characterize the corresponding states to different isomers, such as tetrahedral, linear, bending type ones. The binding energy of each isomer is also computed, and they contribute to evaluate their relative stability, as well as the importance of the underlying multiple minima of the potential surface.

  7. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  8. Immune epitope database analysis resource (IEDB-AR)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total of...

  9. Precision lifetime measurements of Ar II 4p doublet levels

    The lifetimes of the Ar II 4p doublet fine-structure levels 4p 2D05/2, 4p' 2F05/2 and 4p' 2F07/2 were measured by beam-dye laser spectroscopy. The experimental uncertainty was reduced to below 1%. (orig.)

  10. Global properties of the white dwarf pulsar AR Scorpii

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  11. K-Ar geochronology of the southwestern Brooks Range, Alaska

    The southern Brooks Range schist belt is characterized by metasediments with subordinate metabasites and metafelsites. Blueschists occur within the schist belt from the Chandalar Quadrangle westward to the Baird Mountains Quadrangle. We report 76 new 40K-40Ar mineral ages from 47 metamorphic and igneous rocks in the southwestern Brooks Range. The pattern of radiometric ages provide evidence that the schist belt has, at least in part, undergone a Late Precambrian blueschist facies metamorphism. Silurian to Devonian carbonates and Middle Devonian felsic volcanics were later deposited on this Precambrian basement. Subsequent deformations produced the present pattern of isoclinal, recumbent folds, resulting in the interlayering of rocks of markedly different ages and lithologies. The entire schist terrane was metamorphosed to greenchist facies in Mesozoic time, probably as a result of Jurassic-Cretaceous northward overthrusting of oceanic crust and upper mantle, resulting in the resetting of most K-Ar mica ages to the mid-Cretaceous. A series of apparent 40K-40Ar ages intermediate between Late Precambrian and mid-Cretaceous are interpreted as indicating varying amounts of partial argon loss from older rocks during the Mesozoic metamorphism. Some glaucophanes contain excess radiogenic 40Ar. (auth)

  12. Nano-hardness estimation by means of Ar+ ion etching

    When the coatings are in nano-scale, the mechanical properties cannot be easily estimated by means of the conventional methods due to: tip shape, instrument resolution, roughness, and substrate effect. In this paper, we proposed a semi-empirical method to evaluate the mechanical properties of thin films based on the sputtering rate induced by bombardment of Ar+ ion. The Ar+ ion bombardment was induced by ion gun implemented in Auger electron spectroscopy (AES). This procedure has been applied on a series of coatings with different structure (carbon films) and a series of coating with a different density (ZnO thin films). The coatings were deposited on Silicon substrates by RF sputtering plasma. The results show that, as predicted by Insepov et al., there is a correlation between hardness and sputtering rate. Using reference materials and a simple power law equation the estimation of the nano-hardness using an Ar+ beam is possible. - Highlights: • ZnO film and Carbon films were grown on silicon using PVD. • The growth temperature was room temperature. • The hardness of the coatings was estimated by means of nanoindentation. • Evaluation of resistance of materials to the mechanical damage induced by an Ar+ ion gun (AES). • The hardness have been studied and a power law with the erosion rate has been found

  13. The ARS Culture Collection and Developments in Biotechnology

    The ARS Culture Collection (NRRL) has played a prominent role in the development of biotechnology since its founding in 1940 when the Northern Regional Research Laboratory opened. Early discoveries included selection of production strains for penicillin, dextran blood extender, xanthan gum and the v...

  14. 75 FR 12163 - Class E Airspace; Mountain View, AR

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  15. Strong-field nonsequential double ionization of Ar and Ne

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  16. Near-contact Binaries IZ Monocerotis and AR Draconis

    Yang, Yuan-Gui; Dai, Hai-Feng; Zhou, Zheng; Li, Qun

    2016-05-01

    We present multi-color photometric observations for two neglected near-contact binaries, IZ Mon (P=0\\_\\_AMP\\_\\_fd;77980) and AR Dra (P=0\\_\\_AMP\\_\\_fd;67584). By the aid of the updated W-D analysis code, the photometric solutions were deduced from the multi-color light curves (LCs). IZ Mon is a semi-detached binary with a mass ratio of q=0.388(+/- 0.002), while AR Dra is a detached star with a mass ratio of q=0.652(+/- 0.002). The asymmetric LCs of IZ Mon were modeled by a hot spot on the secondary’s surface, which may be attributed to mass transfer from the primary. Based on all collected eclipse times for two systems, we constructed their timing residual curves. The orbital period for IZ Mon may be continuously decreasing at a rate of {dP}/{dt}=-2.06(+/- 0.04) {days} {{yr}}-1, which may result from mass and angular momentum loss from the central system. For AR Dra, there exists a cyclic variation with a period of {P}3=104.9(+/- 2.9) {yr} due to light-time orbit effect via the presence of the third body, whose mass is more than 0.28(+/- 0.02) {M}⊙ . Finally, two near-contact binaries, IZ Mon and AR Dra, will evolve into contact binaries.

  17. Tirgošanās ar ietekmi

    Skujiņa, Līva

    2016-01-01

    Bakalaura darba tēma ir „Tirgošanās ar ietekmi”. Par tirgošanos ar ietekmi Latvijā ir noteikta kriminālatbildība jau vairāk nekā desmit gadus, lai arī tiesu prakse attiecībā uz šo noziedzīgo nodarījumu nav izveidojusies. Bakalaura darba mērķis ir veikt Krimināllikuma 326.1 pantā ietvertā noziedzīgā nodarījuma sastāva teorētisko analīzi un izpētīt kvalifikācijas problēmjautājumus. Lai sasniegtu mērķi, autore aplūkoja tirgošanās ar ietekmi jēdzienu un tiesisko regulējumu Latvijas Republikā. Ti...

  18. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.; Fernández, Berta

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  19. 75 FR 12162 - Class E Airspace; Manila, AR

    2010-03-15

    ... Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant preparation of... read as follows: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Manila, AR AGENCY: Federal...

  20. Big data computing: Building a vision for ARS information management

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  1. K-Ar ages of the Hattholmen anorthosite, northern Sweden

    Hornblendite together with anorthositic and pegmatitic dikes forms the bedrock of islet of Hattholmen (20 km south of the town of Umeaa, Sweden). These rocks have been analyses chemically. The K-Ar age of the anorthositic and pegmatite dikes is 1676 24 Ma and 1663 24Ma. (author)

  2. Resposta de cultivares de arroz irrigado ao nitrogênio

    Freitas José Guilherme de

    2001-01-01

    Full Text Available Genótipos de arroz irrigado por inundação (Oryza sativa L. podem apresentar variabilidade de resposta ao nitrogênio. O objetivo deste trabalho foi avaliar a resposta de três cultivares de arroz ao nitrogênio. Os experimentos foram realizados em Mococa, SP, em 1997/98 e 1998/99, em Cambissolo Háplico Tb Eutrófico gleico. O delineamento estatístico foi em blocos ao acaso, em esquema de parcelas subdivididas, com quatro repetições. Nas parcelas foram aplicadas doses de N (0, 50, 100 e 150 kg ha-1 e nas subparcelas foram transplantadas mudas dos cultivares de arroz (IAC 101, IAC 102 e IAC 104. O nitrogênio foi aplicado parceladamente sendo 1/3 da dose no transplantio das mudas, 1/3 aos 20 dias e 1/3 aos 40 dias, após o transplantio. Os cultivares responderam significativamente à aplicação de N e a média de produtividade de grãos dos três cultivares na maior dose de N foi superior a 8 t ha-1. Os cultivares IAC 104 e IAC 101 apresentaram maiores rendimentos de grãos (4863 e 5015 kg ha-1, na ausência da aplicação de N do que o IAC 102, com resposta quadrática para os dois primeiros e linear para o último. As doses adequadas de N foram 140 kg ha-1 para o 'IAC 101' e 150 kg ha-1 para 'IAC 102' e 'IAC 104'. O cultivar IAC 104 apresentou maior rendimento de grãos inteiros e, embora não tenha sido o mais produtivo nos dois anos do estudo, gerou maior produção de grãos inteiros por unidade de área. O comprimento da panícula foi o componente que melhor se correlacionou com o rendimento de grãos.

  3. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  4. Behaviour of AR glass fibre for building structural applications

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  5. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    where potassium-bearing phenocrysts may contain relatively small amounts of radiogenic 40Ar. In 2005, the Quaternary Dating Laboratory, Roskilde University, installed a Nu-Instruments multi-collector Noblesse noble gas mass spectrometer, which is configured with a Faraday detector and three ion......The recent availability of commercial high-resolution, multi-collector, noble gas mass spectrometers equipped with ion-counting electron multipliers provides new opportunities for improved precision in 40Ar/39Ar dating. This is particularly true for single crystal dating of Quaternary aged samples...... for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii...

  6. Precision angle-resolved autoionization resonances in Ar and Ne

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  7. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  8. Microclima e produção da uva de mesa 'Niagara Rosada' conduzida em espaldeira a céu aberto e em manjedoura na forma de "Y" sob cobertura de telado plástico

    Mário José Pedro Júnior

    2011-10-01

    Full Text Available Foi desenvolvido um experimento em vinhedos de 'Niagara Rosada', conduzidos em espaldeira e em manjedoura na forma de Y com cobertura de telado plástico, visando a comparar as alterações microclimáticas induzidas pelo sistema de condução e uso de telado plástico, e o efeito na produtividade das videiras. Entre os parâmetros microclimáticos avaliados, apenas a radiação solar foi atenuada pelo telado plástico em cerca de 20%, acima do dossel, tendo sido transmitido para a altura do cacho, cerca de 41% da radiação solar no sistema em Y sob telado plástico e 21% no espaldeira. As temperaturas máximas e mínimas foram semelhantes em ambos os sistemas. A produção por planta e a massa dos cachos foram mais elevadas no sistema em Y sob telado plástico, em comparação ao espaldeira.

  9. Status Update and Closed-Loop Performance of the Magellan Adaptive Optics VisAO Camera

    Kopon, Derek; Close, Laird M.; Males, Jared; Gasho, Victor; Morzinski, Katie; Follette, Katherine

    2014-01-01

    We present laboratory results of the closed-loop performance of the Magellan Adaptive Optics (AO) Adaptive Secondary Mirror (ASM), pyramid wavefront sensor (PWFS), and VisAO visible adaptive optics camera. The Magellan AO system is a 585-actuator low-emissivity high-throughput system scheduled for first light on the 6.5 meter Magellan Clay telescope in November 2012. Using a dichroic beamsplitter near the telescope focal plane, the AO system will be able to simultaneously perform visible (500...

  10. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  11. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  12. A detailed 40Ar/39Ar age study of an Abitibi dike from the Canadian Superior Province

    40Ar/39Ar step-heating analyses were performed on 11 felsic and mafic mineral separates from a 90m wide Precambrian Shield. Deuterically altered minerals from the dike interior define a primary age of 2150 +- 25 Ma. Updated ages, obtained from felsic separates within 30, and mafic within 1.5 m of the dike border, are evidence of a previously undetected Hudsonian (1.7-1.8 Ga) hydrothermal event in the area. It is possible to distinguish the deuteric from the later hydrothermal alteration by both dating and petrographic methods. The data from this study demonstrate the successful application of 40Ar/39Ar dating to early Proterozoic dikes which have suffered low grade metamorphism. The ages support a north to south sense of motion of the Track 5 apparent polar wander path (APWP). A monotonic decrease in apparent age of felsic spectra indicates reactor induced recoil effects which are correlated with the fine-grained saussurite in the feldspar. (auth)

  13. 40Ar/39Ar ages and tectonic setting of ophiolite from the Neyriz area, southeast Zagros range, Iran

    An ophiolite, considered to be an allochthonous fragment of Tethyan oceanic crust and mantle, crops out near Neyriz in the Zagros Range, Iran. 40Ar/39Ar ages ranging from 76.8+-23.8 Ma to 105+-23.3 Ma were measured on hornblende from five samples of plagiogranite and diabase from the ophiolite. The most precise ages are 85.9+-3.8 Ma for a diabase and 83.6+-8.4 Ma for a plagiogranite. The weighted mean age of hornblende from the five samples is 87.5+-7.2 Ma which indicates that the igneous part of the Neyriz ophiolite formed during the early part of the Late Cretaceous. Pargasite from amphibolite below peridotite of the Neyriz ophiolite has a 40Ar/39Ar age of 94.9+-7.6 Ma. The pargasite age agrees within analytical uncertainty with the ages measured on diabase and plagiogranite. Comparable ages have been measured on igneous rocks from the Samail ophiolite of Oman and on amphibolite below peridotite of the Samail ophiolite. (orig.)

  14. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  15. Classification of the Apollo-11 mare basalts according to /Ar-39/-/Ar-40/ ages and petrological properties

    Previously unpublished (Ar-39)-(Ar-40) ages and exposure ages are presented for Apollo 11 whole rocks and mineral separates. The age data for the Apollo 11 mare basalts in general are discussed in relation to their textural and petrological properties. The oldest rocks (10003, 10029) belong to the low-K group and crystallized at 3.90 + or - 0.03 AE. Three other low-K groups are defined in relation to the petrological classification of Beaty and Albee (1978) and to information on the rock crystallization ages, exposure ages and normative quartz contents. These groups have ages of 3.84 + or - 0.04 AE (10062), 3.75 + or - 0.03 AE (10050) and 3.72 + or - 0.04 AE (10044, 10047, 10058). The best defined (Ar-39)-(Ar-40) age for the high-K basalts is 3.62 + or - 0.05 AE (for mineral separates from 10072). At least four distinct, fairly thin flows of low-K basalt are believed to have been erupted over a 200-my period, followed by either one or several, as yet indistinguishable, very thin flows of high-K basalt. It is not possible to decide whether the earliest dated of the mare basalt eruptions at Mare Tranquillitatis pre-dated, post-dated, or were contemporary with the Imbrian impact event

  16. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  17. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  18. Origin of the Mile Tilek Tuff, South Andaman: evidence from 40Ar-39Ar chronology and geochemistry

    The Mile Tilek Tuff is one of several consolidated volcanic ash deposits in the Andaman and Nicobar Islands that has preserved evidence of a large-scale volcanic eruption in Southeast Asia. Assumed to be of Mio-Pliocene age (∼ 25-2 Ma), the tuff was thought to have been generated by the Andaman-Indonesia volcanic arc. Little was known about its source volcano because of absence of critical isotope data. To provide accurate age information and determine its source, we dated the tuff by 40Ar-39Ar method and measured its trace element contents and Sr-Nd isotopic ratios. The 40Ar-39Ar plateau age for the whole rock is 0.73 ± 0.16 (2σ) Ma, which suggests that the tuff got deposited much later than previously believed. Chemically, the tuff possesses typical characteristics of subduction zone magmatism. Its Sr-Nd isotopic compositions (87Sr/86Sr = 0.7073 and εNd ≤ 0.9) suggest substantial continental crustal contamination of its source magma, which points to a source volcano in Sumatra. Based on available age information on large-scale volcanic eruptions in Indonesia, we speculate that the Ranau volcano in south Sumatra could have been the source of the Mile Tilek Tuff. (author)

  19. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  20. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  1. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  2. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    .054/-0.087) Ga and 3.63 (+0.058/-0.096) Ga. We also find seismic (miniscule ejecta blanket from Rheasilvia) resurfacing events in the time frame of ~3.56 to ~3.59 Ga at several areas in the northern hemisphere, indicative for a major seismic activity probably connected to the Rheasilvia formation. An antipodal activity is also suggested by hydrocode modeling [9]. By summation of age probability curves of measurements we link to the Rheasilvia formation, we find 3.58 (+0.07/-0.12) Ga. Using a similar attempt we find 3.75 (+0.05/-0.21) Ga for the Veneneia formation. Both crater retention ages correspond within the error bars with prominent peaks of independent Ar-Ar ages of Vesta related HED meteorites [10]. Acknowledgement: This work has been supported by the German Space Agency (DLR) on behalf of the Federal Ministry of Economics and Technology, grants 50OW1101(NS,TK), 50QM1001 (GM) and 50OW1102 (OR,HH). References: [1] Russell et al. (2007): Advances in Space Research 40(2): pp193-201, 2007. [2] Neukum and Ivanov: In: Gehrels T (ed) "Hazards due to comets and asteroids". University of Arizona Press, Tucson, 359-416, 1994. [3] O'Brien and Greenberg (2005): Icarus 178(1): 179-212. [4] Nesvorny et al. (2009): Icarus 200(2): 698-701. [5] Ivanov (2001): Chronology and Evolution of Mars 96, 87-104, 2001. [6] Schmedemann et al. (2012): 43.LPSC, The Woodlands, #1659. [7] Morbidelli et al. (2003): Icarus 162, 328-336. [8] Marchi et al. (2012): Science 336, 690. [9] Bowling et al. (2012): 75th Annual Meeting of the Meteoritical Society, 2012, Cairns, Australia. Meteoritics and Planetary Science Supplement, id.5256. [10] Bogard, D. D. (2011): Chemie der Erde - Geochemistry, vol. 71, issue 3: 207-226.

  3. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  4. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  5. Development of a Low-Level Ar-37 Calibration Standard

    Williams, Richard M.; Aalseth, Craig E.; Bowyer, Ted W.; Day, Anthony R.; Fuller, Erin S.; Haas, Derek A.; Hayes, James C.; Hoppe, Eric W.; Humble, Paul H.; Keillor, Martin E.; LaFerriere, Brian D.; Mace, Emily K.; McIntyre, Justin I.; Miley, Harry S.; Myers, Allan W.; Orrell, John L.; Overman, Cory T.; Panisko, Mark E.; Seifert, Allen

    2016-03-07

    Argon-37 is an important environmental signature of an underground nuclear explosion. Producing and quantifying low-level 37Ar standards is an important step in the development of sensitive field measurement instruments for use during an On-Site Inspection, a key provision of the Comprehensive Nuclear-Test-Ban Treaty. This paper describes progress at Pacific Northwest National Laboratory (PNNL) in the development of a process to generate and quantify low-level 37Ar standard material, which can then be used to calibrate sensitive field systems at activities consistent with soil background levels. The 37Ar used for our work was generated using a laboratory-scale, high-energy neutron source to irradiate powdered samples of calcium carbonate. Small aliquots of 37Ar were then extracted from the head space of the irradiated samples. The specific activity of the head space samples, mixed with P10 (90% stable argon:10% methane by mole fraction) count gas, is then derived using the accepted Length-Compensated Internal-Source Proportional Counting method. Due to the low activity of the samples, a set of three Ultra-Low Background Proportional-Counters designed and fabricated at PNNL from radio-pure electroformed copper was used to make the measurements in PNNL’s shallow underground counting laboratory. Very low background levels (<10 counts/day) have been observed in the spectral region near the 37Ar emission feature at 2.8 keV. Two separate samples from the same irradiation were measured. The first sample was counted for 12 days beginning 28 days after irradiation, the second sample was counted for 24 days beginning 70 days after irradiation (the half-life of 37Ar is 35.0 days). Both sets of measurements were analyzed and yielded very similar results for the starting activity (~0.1 Bq) and activity concentration (0.15 mBq/ccSTP argon) after P10 count gas was added. A detailed uncertainty model was developed based on the ISO Guide to the Expression of Uncertainty in

  6. Integrando a retórica ao game design

    Moroni, Leonardo Mendes

    2013-01-01

    Resumo: O potencial dos jogos eletrônicos como mídia que atinge camadas cada vez mais extensas da população, com reflexos sociais, culturais e econômicos, é evidente. No entanto, jogos que alcançam grande sucesso comercial objetivam, essencialmente, propiciar diversão aos seus usuários. Com base nesta premissa, tanto usuários quanto avaliadores desta mídia acabam por desconsiderar o potencial que os jogos oferecem em termos de veicular mensagens com conteúdo relevante para a vida real, como, ...

  7. Mudança organizacional : do prescrito ao real

    Sinval, Jorge Fernando Pereira

    2011-01-01

    As organizações dos dias de hoje enfrentam um ambiente cada vez mais dinâmico e em constante mudança. Necessitam de adaptar-se aos novos desafios. Com as crescentes evoluções tecnológicas, que ocorrem em quase todos os sectores de atividade, a maior parte dos trabalhadores é confrontada, em algum momento do seu percurso profissional, com a introdução de mudanças no seu posto de trabalho, mudanças com as quais terão de lidar. A mudança organizacional influencia quer a empresa, quer o trabalhad...

  8. Impacto dos incentivos fiscais e parafiscais no apoio ao emprego

    Ferreira, Licínia Isabel dos Santos

    2011-01-01

    A presente investigação tem como objectivo analisar “o impacto dos incentivos fiscais e parafiscais no apoio ao emprego”; identificar os “incentivos ficais e as isenções no âmbito do apoio às empresas” , assim como verificar os seus “reflexos na contratação de trabalhadores”. Para tal, tentou-se perceber quais as políticas e legislação que estão subjacentes a estes incentivos e de que forma se colocam em prática, fomentando a contratação dos trabalhadores. A metodologia a...

  9. da prevenção aos cuidados paliativos

    Nogueira, Ana Rita Cardoso

    2013-01-01

    Objetivo: Efetuar uma revisão tradicional da literatura sobre o papel que a alimentação/nutrição tem, quer na prevenção quer na progressão da demência incluindo a fase final da vida. Metodologia: Foi realizada pesquisa bibliográfica no PubMed e na B-On, entre fevereiro e julho de 2013, que abarcou todas as publicações relativas aos últimos 5 anos. Utilizaram-se, para isso, as seguintes palavras-chave “palliative care AND dementia” e “nutrition AND dementia”. Resultados: As vitaminas dos...

  10. Titanium alloys (AoN) and their involvement in osseointegration

    Matteo Danza; Ilaria Zollino; Valentina Candotto; Francesca Cura; Francesco Carinci

    2012-01-01

    Background: Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. Materials and Methods: The expression levels of some bone-related (A...

  11. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  12. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Ney Procópio Lopes

    2011-12-01

    Full Text Available A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvaziamento da rede interligada ao ramal, a sobremedição pode atingir até 21% em condições de pressão máxima na rede de distribuição (500 kPa. Por fim, verificou-se que a menor vazão afluente associa-se ao maior volume de ar aferido pelo hidrômetro. Dessa forma, é possível supor que os consumidores situados na menor faixa de consumo sejam os mais prejudicados pela situação de desabastecimento.The purpose of the present work is to evaluate the volume of air measured in domestic water supply pipe connections. Tests were performed to evaluate the efficiency and applicability of air reducing valves in domestic water supply connections. The results obtained under regular water supply conditions showed that the volume of air in the water measured by the hydrometers is comparable to the one found in natural waters. On the other hand, other tests, right after emptying the network connected to the domestic water supply pipe, revealed that the volume of water which gets to the gauged reservoir comprehends up to 21% of the total air-water volume recorded by the hydrometer for the experiments performed under pressure of 500 kPa.

  13. Valence-shell photoionization of chlorinelike Ar+ ions

    Absolute cross-section measurements for valence-shell photoionization of Ar+ ions are reported for photon energies ranging from 27.4 to 60.0 eV. The data, taken by merging beams of ions and synchrotron radiation at a photon energy resolution of 10 meV, indicate that the primary ion beam was a statistically weighted mixture of the 2P3/2o ground state and the 2P1/2o metastable state of Ar+. Photoionization of this Cl-like ion is characterized by multiple Rydberg series of autoionizing resonances superimposed on a direct photoionization continuum. Observed resonance line shapes indicate interference between indirect and direct photoionization channels. Resonance features are spectroscopically assigned and their energies and quantum defects are tabulated. The measurements are satisfactorily reproduced by theoretical calculations based on an intermediate coupling semirelativistic Breit-Pauli approximation.

  14. Simulation of Carbon Nanotube Welding through Ar bombardment

    Kucukkal, Mustafa U

    2014-01-01

    Single-walled carbon nanotubes show promise as nanoscale transistors, for nanocomputing applications. This use will require appropriate methods for creating electrical connections between distinct nanotubes, analogous to welding of metallic wires at larger length scales, but methods for performing nanoscale chemical welding are not yet sufficiently understood. This study examined the effect of Ar bombardment on the junction of two crossed single-walled carbon nanotubes, to understand the value and limitations of this method for generating connections between nanotubes. A geometric criterion was used to assess the quality of the junctions formed, with the goal of identifying the most productive conditions for experimental ion bombardment. In particular, the effects of nanotube chirality, Ar impact kinetic energy, impact particle flux and fluence, and annealing temperature were considered. The most productive bombardment conditions, leading to the most crosslinking of the tubes with the smallest loss of graphit...

  15. Progreso y retos de la geocronología 40Ar/39Ar en Costa Rica y Nicaragua Progress and Challenges Using 40Ar/39Ar Geochronology in Costa Rica and Nicaragua

    Ian Saginor¹

    2011-12-01

    Full Text Available Con el principal objetivo de realizar mejores cálculos de la producción volcánica, en el Arco Volcánico de América Central, realizamos 61 dataciones 40Ar/39Ar en tefras y lavas en localidades de frente volcánico de Costa Rica y Nicaragua por medio de varias campañas de campo y análisis de laboratorio (preparación de muestras, envió al reactor nuclear, espectroscopía de masas de las muestras radiactivas, al laboratorio de gases nobles del Departamento de Ciencias de la Tierra y Planetarias de la Universidad Rutgers del 2002-2008. En este artículo presentamos diferentes observaciones que resultaron de este estudio donde se describe la precisión, exactitud y la confiabilidad de las edades 40Ar/39Ar. El primer resultado muestra las limitaciones de esta técnica en muestras baja en K2O con edades To better estimate the extrusive flux of the Central American Arc, from 2002-2008, we obtained sixty one high precision 40Ar/39Ar ages on geographically well-situated lavas and tephra from Costa Rica and Nicaragua. Here, we describe a number of observations encountered during this study using four examples that well document the precision, accuracy and general reliability of the 40Ar/39Ar ages. First, low K2O values, particularly in samples from Nicaragua, is a major limitation in or attempts to obtain reliable dates on samples under 1 My. Second, extensive weathering of samples due to the tropical climate of Central America has resulted in various levels of argon loss even when the hand sample appeared unaltered. Third, our field and geochronological data lead us to conclude that eruptive rates have not been constant over the past 15 to 20 My, but rather appears punctuated by gaps of up to several million years. We attempted to address the temporal gaps in several ways. First, geochemical analyses were used to identify samples that may have erupted during time periods without known volcanism. For example, U/Th values in the active Central

  16. Ryoji Ikeda, Data Artist - Prix Ars Electronica Collide@CERN

    CERN. Geneva; Koek, Ariane; Heuer, Rolf; Ikeda, Ryoji; Mr. Horst, Hoertner

    2014-01-01

    at the CERN Globe of Science and Innovation, CERN. You are very warmly invited to the opening presentation of Data Artist, Ryoji Ikeda’s residency at CERN. Ryoji Ikeda, one of the world’s leading electronic composers and visual artists, is the new Prix Ars Electronica Collide@CERN award winner. Ryoji Ikeda and his science inspiration partner, Theoretical Physicist, Dr. Tom Melia will talk about their work in arts and science. They are at the beginning of their creative journey together at CERN. A little about Ryoji Ikeda – the new Prix Ars Electronica Collide@CERN artist in residence. Ryoji Ikeda focuses on the essential characteristics of sound itself and that of visuals as light by means of both mathematical precision and mathematical aesthetics. Ikeda has gained a reputation as one of the few international artists working convincingly across both visual ...

  17. Infrared spectrum and predissociation dynamics of H2O+ -Ar.

    Dopfer, O; Engel, V

    2004-12-22

    The infrared (IR) spectrum and vibrational predissociation of the proton-bound H(2)O(+)-Ar ionic complex are investigated within an ab initio and quantum dynamical study. For this purpose, a two-dimensional potential energy surface (2D PES) is determined as a function of the HO-H and OH-Ar coordinates. This PES is then employed in a wave-packet calculation to determine spectral properties of the system and to calculate the IR absorption spectrum. The vibrational energy levels and relative IR intensities agree well with the experimental spectrum reported earlier. On the other hand, the predissociation lifetimes in the nanosecond regime derived from the 2D PES are in disagreement with the experimental observations, indicating the importance of the neglected degrees of freedom for a correct description of the dynamics of the complex. PMID:15606253

  18. Medidas da umidade relativa do ar em um ambiente fechado

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  19. Four-state model of optical collisions: Sr + Ar

    The semiclassical theory of electronic excitation of an atom in a strong nonresonant laser field due to a collision with another atom is presented. It is shown that in the presence of asymptotic degeneracy of the excited state the Landau-Zener two-state model is inaccurate, the exact solution of a two-state model is inaccurate, and both differ qualitatively from the accurate solutions of the equations when all (four) states are included. With parameters chosen to model the process Sr(1S) + Ar + hω → Sr(1P) + Ar, cross sections on the order of 10-14 cm2 are obtained for h (ω - ω0) approx. 17 cm-1 over a large range of the Rabi frequency. Depolarization predominates at high field strengths

  20. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  1. AR-based Method for ECG Classification and Patient Recognition

    Branislav Vuksanovic; Mustafa Alhamdi

    2013-01-01

    The electrocardiogram (ECG) is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR) signal parameters used to characterise ECG signal. Extracted paramet...

  2. AR-based Method for ECG Classification and Patient Recognition

    Branislav Vuksanovic

    2013-09-01

    Full Text Available The electrocardiogram (ECG is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR signal parameters used to characterise ECG signal. Extracted parameters are in this work used to accomplish two tasks. Firstly, AR features belonging to each ECG signal are classified in groups corresponding to three different heart conditions – normal, arrhythmia and ventricular arrhythmia. Obtained classification results indicate accurate, zero-error classification of patients according to their heart condition using the proposed method. Sets of extracted AR coefficients are then extended by adding an additional parameter – power of AR modelling error and a suitability of developed technique for individual patient identification is investigated. Individual feature sets for each group of detected QRS sections are classified in p clusters where p represents the number of patients in each group. Developed system has been tested using ECG signals available in MIT/BIH and Politecnico of Milano VCG/ECG database. Achieved recognition rates indicate that patient identification using ECG signals could be considered as a possible approach in some applications using the system developed in this work. Pre-processing stages, applied parameter extraction techniques and some intermediate and final classification results are described and presented in this paper.

  3. Review of the neutron data for Cl, Ar

    Many experimental data, such as the total cross section, (n,2n), (n,p), (n,α), (n,γ) cross section and so on have been published for Cl as well as its isotope 35Cl, 37Cl since 1966. All the experimental data up to 1988 were collected in present review. The data were carefully analysed, corrected and fitted with spline function to give the new evaluated cross sections. The neutron data for Ar is also evaluated

  4. BUSINESS ETHICS: THE CASE OF AR CONSULTORIA LTD A

    Fernando Fantoni Bencke

    2014-03-01

    business: the significant taxes, lack of incentives and credit available and the opportunity to “make a little extra” through informal sales. AR Consultoria’s entry to the market was marked by these and other difficulties. This case aims at presenting a real situation that can be found in some organizational sectors areas, which demands readers to take a decision and an ethical stance when faced with moral challenges.

  5. arXiv in the classical Russian literature

    Z. K. Silagadze

    2012-01-01

    The creation of arXiv, a highly democratic open access repository of research papers in high-energy physics more than twenty years ago was undoubtedly the most spectacular and landmark event for the high-energy physics community. However, we report a curious observation which indicates that the general cultural significance of this event extends far beyond the boundaries assumed at the beginning.

  6. Modification of surface properties of polyethylene by Ar plasma discharge

    Švorčík, V.; Kotál, V.; Slepička, P.; Bláhová, O.; Špírková, Milena; Sajdl, P.; Hnatowicz, Vladimír

    2006-01-01

    Roč. 244, č. 2 (2006), s. 365-372. ISSN 0168-583X R&D Projects: GA ČR GA106/03/0514; GA AV ČR IAA5011301; GA AV ČR IAA400500505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : polyethylene * Ar plasma discharge * chemical structure Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.946, year: 2006

  7. Electrical properties and dielectric spectroscopy of Ar+ implanted polycarbonate

    The aim of the present paper is to study the effect of argon ion implantation on electrical and dielectric properties of polycarbonate. Specimens were implanted with 130 keV Ar+ ions in the fluence ranging from 1×1014 to 1×1016 ions cm−2. The beam current used was ∼0.40 µA cm−2. The electrical conduction behaviour of virgin and Ar+ implanted polycarbonate specimens have been studied through current-voltage (I-V characteristic) measurements. It has been observed that after implantation conductivity increases with increasing ion fluence. The dielectric spectroscopy of these specimens has been done in the frequency range of 100 kHz-100 MHz. Relaxation processes were studied by Cole-Cole plot of complex permittivity (real part of complex permittivity, ε′ vs. imaginary part of complex permittivity, ε″). The Cole-Cole plots have also been used to determine static dielectric constant (εs), optical dielectric constant (ε∞), spreading factor (α), average relaxation time (τ0) and molecular relaxation time (τ). The dielectric behaviour has been found to be significantly affected due to Ar+ implantation. The possible correlation between this behaviour and the changes induced by the implantation has been discussed

  8. Transfer ionization of the isocharge sequence ion and Ar collisions

    Cai Xiao-Hong; Yu De-Yang; Cao Zhu-Rong; Lu Rong-Chun; Yang Wei; Shao Cao-Jie; Chen Xi-Meng

    2004-01-01

    The ratios of transfer ionization to single capture for isocharge Cq+, Nq+, Oq+, Neq+ ions on Ar atoms are measured by using position-sensitive and time-of-flight techniques. It is found that the ratio R1 increases with nuclear charge Z in a q=4 sequence, and the ratio R1 sequences have the minimum values at Z=7 and Z=8 in q=5 and q=6 sequences, respectively, and the ratio R1 decreases with the increase in the nuclear charge Z in a q=7 sequence. The results may be explained within the frame of the statistical model. It may be concluded that the transfer ionization depends remarkably upon the electronic structure of the projectile. The projectiles used in this study have the same charge state and velocity, but different electronic structures. The dependence of the ratio R1 on q is studied for Neq+-Ar collisions. The ratio R1 is found to increase as q increases for Neq+-Ar collisions. The measured dependence of the ratio R1 on q is compared with the calculation using the molecular Coulomb over-barrier model.

  9. Atomic data and spectral line intensities for Ar XIII

    The energy levels, oscillator strengths, spontaneous radiative decay rates, and electron impact collision strengths are calculated for Ar XIII using the recently developed Flexible Atomic Code (FAC). These data pertain to the 224 levels belonging to the following configurations: 2s22p2, 2s2p3, 2p4, 2s22p3l, 2s2p23l, 2s22p4l (l = s, p, d, f), 2s22p5s, 2s22p5p, and 2s22p5d. Effective collision strengths are obtained at five electron temperatures: log Te (K) = 5.0, 5.5, 6.0, 6.5, and 7.0 by integrating the collision strengths over a Maxwellian electron distribution. These atomic data are generated to support the interpretation of astrophysical objects as well as fusion plasmas, which frequently contain emission lines from Ar XIII. This work supplements previous work published by Bhatia by extending the calculation of effective collision strengths and radiative decay rates to n = 5 configurations. Level populations and spectral line intensities are obtained by solving the rate equations of the 224 energy levels at densities of 108, 109, 1010, 1011, and 1012 cm-3 and a temperature of 2.51 x 106 K. This temperature is typical for Ar XIII when formed at equilibrium by collisional ionization and recombination

  10. Utilization of 40An/39Ar method in policyclic rocks

    This work presents the results of twelve radiometric analyses by the 40Ar/39Ar method in biotites, anphiboles and plagio classes of rock of the Penhinha region. Nine determinations were made by the techniques of stepwise heating and three by metting of the sample. The different apparent ages of the minerals (515-1200 My), obtained by the technique of stepwise heating, seem to imply a a complex geologic history for the region, and confirms the existence of older emplacement nuclei, pre-Brazilians, affected by two orogenic cycles, at least, the first pre-Brazilian and the cycles, at least, the first pre-Brazilian and the second, Brazilian. On the other hand, the age determinations obtained by melting of plagioclasses (∼ 730 My), agreed with the conventional K-ar apparent ages, a fact with no geological meaning. The preliminary results show that the stepwise heating technique may become a valuable tool in the study of policyclic samples, because it permits to distinguish between disturbed and undisturbed rocks. The same cannot be said of the melting technique. In this latter case the results can be used only comparatively. (author)

  11. Dicty_cDB: FC-AO01 [Dicty_cDB

    Full Text Available 3 AY961548_1( AY961548 |pid:none) Lysiphlebus testaceipes ribosomal ... 210 2e-53 AP003943_18( AP003943 |pid...FC-AO01Z (Link to Original site) Representative DNA sequence >FC-AO01 (FC-AO01Q) /CSM/FC/FC-AO/FC-AO01Q.Seq..... 48 5e-11 3 dna update 2003. 7.11 Homology vs Protein Score E Sequences producing significant alignments: (bit...nk to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15674-1 Original site URL http:/...FC (Link to library) FC-AO01 (Link to dictyBase) - - - Contig-U15674-1 FC-AO01Z (Link to Original site

  12. Drosophila ARSs contain the yeast ARS consensus sequence and a replication enhancer.

    Mills, J S; Kingsman, A J; Kingsman, S M

    1986-01-01

    A number of restriction fragments that function as autonomously replicating sequences (ARSs) in yeast have been isolated from Drosophila melanogaster DNA. The behaviour in yeast of plasmids containing Drosophila ARS elements was studied and compared to that exhibited by the archetypal yeast ARS-1 plasmid. ARS functions were localised by subcloning and BAL-31 deletion analysis. These studies demonstrated the structural and functional complexity of Drosophila ARSs. Each Drosophila ARS element h...

  13. Resistência ao estresse e crescimento de larvas de peixes neotropicais alimentadas com diferentes dietas Stress resistance and growth of larvae of neotropical fish feed with different diets

    Ronald Kennedy Luz

    2007-01-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da alimentação na resistência ao estresse e no crescimento de larvas das espécies de peixes neotropicais: Astronotus ocellatus (Oscar, Piaractus mesopotamicus (pacu e Pseudoplatystoma coruscans (pintado. As larvas receberam diferentes tipos de alimentos (Artemia sp., larvas de Colossoma macropomum e dieta artificial Fry Feed Kyowa. Foram realizados testes de exposição ao ar e a taxa de sobrevivência, determinada 24 horas depois. A fim de avaliar o crescimento, medidas de peso foram realizadas em larvas dos diferentes tratamentos. Larvas de A. ocellatus alimentadas com náuplios de Artemia sp. apresentaram tendência de maior peso e resistência ao estresse, quando comparadas com o uso de dieta artificial. Larvas de P. mesopotamicus apresentaram melhores valores de peso e taxas de resistência ao estresse, quando alimentadas com Artemia sp. ou alimentação mista (Artemia sp. + dieta artificial. Em P. coruscans, o uso de larvas forrageiras resultou em indivíduos mais resistentes aos testes de exposição ao ar do que os que receberam apenas Artemia sp. Valores de peso, nos dois manejos alimentares, foram semelhantes entre si. O alimento vivo desempenha importante atuação no crescimento em peso e na melhora da resistência ao estresse das espécies estudadas.The objective of this work was to evaluate the effect of feeding on stress resistance and growth in larvae of neotropical fish of the species: Astronotus ocellatus, Piaractus mesopotamicus, and Pseudoplatystoma coruscans. Larvae received different types of food (Artemia sp., Colossoma macropomum larvae and artificial microdiet Fry Feed Kyowa. Resistance tests to air exposure were applied, and larvae survival was determined after 24 hours. To evaluate the growth, weight measures were performed during the different treatments. A. ocellatus larvae fed on Artemia sp. nauplii tended to better resistant and weight than others that received

  14. A comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas for dry etching applications

    The effect of the O2/Ar mixing ratio in CF4/O2/Ar and C4F8/O2/Ar inductively coupled plasmas with a 50% fluorocarbon gas content on plasma parameters and active species densities, which influence dry etching mechanisms, was analyzed. The investigation combined plasma diagnostics using Langmuir probes and zero-dimensional plasma modeling. It was found that, in both gas systems, the substitution of Ar for O2 results in a similar change in the ion energy flux but causes the opposite behavior for the F atom flux. The mechanisms of these phenomena are discussed with regards to plasma chemistry. - Highlights: • The goal was to conduct a comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas. • The focus was on the parameters directly influencing dry etching mechanisms. • Model-based analysis for neutral species was used in this paper

  15. Fatores relacionados à fidelidade ao tratamento do glaucoma: opiniões de pacientes de um hospital universitário Factors related to glaucoma treatment compliance: patients' opinions from a University Hospital

    Lucas Ravagnani Silva

    2010-04-01

    Full Text Available OBJETIVO: Considerando que a não-adesão ao tratamento do glaucoma é um dos fatores de risco para a sua progressão, o objetivo do presente trabalho foi coletar informações sobre: 1 conhecimento e sentimentos dos pacientes sobre a doença; 2 a não-fidelidade ao tratamento e fatores relacionados; e 3 eventual influência da doença no estilo de vida participantes. MÉTODOS: Foram realizadas entrevistas, utilizando questionário semiestruturado, com 50 pacientes com glaucoma primário de ângulo aberto. A análise das respostas foi feita utilizando a técnica do ''Discurso do Sujeito Coletivo'' (DSC (qualitativa/quantitativa. RESULTADOS: Trinta e oito por cento dos pacientes não se consideraram bem informados sobre o glaucoma. A porcentagem de pacientes que declararam nãofidelidade ao tratamento foi de 20%. Os principais fatores relacionados foram: efeitos colaterais dos medicamentos (24%; falta de informação sobre a doença (22%; dificuldade de comunicação com o médico (14%; dificuldades na administração do tratamento (14%; falta de recursos financeiros para adquirir medicamentos (10%; atitudes e crenças (10%. Dezoito por cento dos participantes afirmaram que a doença alterou a qualidade de vida. CONCLUSÃO: Na população estudada, os fatores relacionados à não-adesão ao tratamento de glaucoma, abrangem desde o desconhecimento do que é a doença até atitudes, valores e crenças. Na sua maioria, podem causar a progressão da doença. A influência desses fatores pode ser diminuída com medidas educacionais, intervenções sobre comportamentos e atitudes, melhora da relação médico-paciente e suprimento de medicamentos.PURPOSE: Considering that noncompliance to glaucoma treatment is one of the risk factors associated with disease´s progression, the purpose of the present study was to evaluate: 1 knowledge and feelings about the disease; 2 self-reported noncompliance to treatment and related factors; and 3 influence of

  16. Chromosomal context and replication properties of ARS plasmids in Schizosaccharomyces pombe

    Aditya S Pratihar; Vishnu P Tripathi; Mukesh P Yadav; Dharani D Dubey

    2015-12-01

    Short, specific DNA sequences called as Autonomously Replicating Sequence (ARS) elements function as plasmid as well as chromosomal replication origins in yeasts. As compared to ARSs, different chromosomal origins vary greatly in their efficiency and timing of replication probably due to their wider chromosomal context. The two Schizosaccharomyces pombe ARS elements, ars727 and ars2OO4, represent two extremities in their chromosomal origin activity - ars727 is inactive and late replicating, while ars2OO4 is a highly active, early-firing origin. To determine the effect of chromosomal context on the activity of these ARS elements, we have cloned them with their extended chromosomal context as well as in the context of each other in both orientations and analysed their replication efficiency by ARS and plasmid stability assays. We found that these ARS elements retain their origin activity in their extended/altered context. However, deletion of a 133-bp region of the previously reported ars727-associated late replication enforcing element (LRE) caused advancement in replication timing of the resulting plasmid. These results confirm the role of LRE in directing plasmid replication timing and suggest that the plasmid origin efficiency of ars2OO4 or ars727 remains unaltered by the extended chromosomal context.

  17. Interatomic Coulombic decay of NeAr dimers following Auger decay

    Using momentum-resolved electron-ion multicoincidence, we have investigated interatomic Coulombic decay (ICD). We observed ICD processes in NeAr dimers following Ar LMM and Ne KLL Auger decay. From Auger final state of Ar2+(3s−2), we observed ICD where three electrons participate in.

  18. File list: Oth.ALL.20.AR.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.20.AR.AllCell hg19 TFs and others AR All cell types SRX595676,SRX595671,SRX...736053,SRX502068,SRX092448,SRX092447,SRX861678,SRX147604,SRX1033268 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.20.AR.AllCell.bed ...

  19. File list: Oth.Brs.05.AR.AllCell [Chip-atlas[Archive

    Full Text Available Oth.Brs.05.AR.AllCell hg19 TFs and others AR Breast SRX1339020,SRX1339018,SRX250092...,SRX1339019,SRX1339016,SRX1339017,SRX1339015 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Brs.05.AR.AllCell.bed ...

  20. Contribuição ao estudo do problema alimentar da Amazônia

    João de Barros Barreto

    1947-12-01

    Full Text Available Salientando os diversos aspectos a atender, para a solução racional do problema da alimentação na Amazônia, aliás já fixados em 1941 pela Comissão que traçou as linhas gerais de um plano de saneamento dessa vasta região, aludem os A.A. às realizações já empreendidas dentro do programa traçado, e que versaram apenas sôbre os hábitos alimentares de um grande núcleo de população e sôbre o valor nutritivo de alguns elementos pouco conhecidos da fauna e da flora locais. Abordam, à guisa de ensaio, neste trabalho, o ponto concernente ao planejamento de regimes adequados, que se adaptem tanto às exigências, como as possibilidades regionais. Frisam, então, de início, as bases racionais a que devem eles obedecer respeito não só à redução do total de calorias, fornecidas, nos seus 2/3, por hidratos de carbono e ao qual se subordinam as cotas das três principais vitaminas do complexo B,* como também a restrição, igualmente indicada, da taxa de proteínas; respeito, ainda, as cotas recomendáveis das vitaminas A e C e de cálcio, dando aí especial atenção ao detalhe da sua aproveitabilidade. Referem, de passagem, à conveniência de não se descurar do problema do ferro alimentar, em face das endemias reinantes na região e das dificuldades para fazer, artificialmente, o enriquecimento marcial dos regimes, já que, para instituí-los, partem do principio de ser vantajoso lançar mão de recursos de produção local, sem ficar em marcada dependência de grandes centres distribuidores regionais. Mostrando as dificuldades para a utilização, na escala desejada, da carne e leite de vaca, como artigos básicos de regime — e apontam, entre os percalços, os inerentes ao transporte e conservação desses alimentos — apresentam uma tabela básica, para o adulto em trabalho moderado, a qual lhe fornece 2.600 calorias diárias e obedece aos pontos fundamentais já aludidos. Nela figuram: os peixes, cujas variedades de

  1. Repression of Runx2 by Androgen Receptor (AR) in Osteoblasts and Prostate Cancer Cells: AR Binds Runx2 and Abrogates Its Recruitment to DNA

    Baniwal, Sanjeev K.; Khalid, Omar; Sir, Donna; Buchanan, Grant; Coetzee, Gerhard A.; Frenkel, Baruch

    2009-01-01

    Runx2 and androgen receptor (AR) are master transcription factors with pivotal roles in bone metabolism and prostate cancer (PCa). We dissected AR-mediated repression of Runx2 in dihydrotestosterone (DHT)-treated osteoblastic and PCa cells using reporter assays and endogenous Runx2 target genes. Repression required DHT, but not AR’s transactivation function, and was associated with nuclear colocalization of the two proteins. Runx2 and AR coimmunoprecipitated and interacted directly in glutath...

  2. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology

    Jyotiranjan S Ray; Kanchan Pande; T R Venkatesan

    2000-03-01

    40Ar-39Ar analyses of three fresh alkaline rock samples and a phlogopite separate from a carbonatite from Amba Dongar carbonatite-alkaline complex of the Deccan Flood Basalt Province, India, yield indistinguishable precise plateau ages of 64.8 ± 0.6, 64.7 ± 0.5, 65.5 ± 0.8 and 65.3 ± 0.6 Ma, giving a mean plateau age of 65.0 ± 0.3 Ma, which is the age of emplacement of this complex. This age implies contemporaneity of Amba Dongar with several other carbonatite-alkaline activities of Chhota Udaipur subprovince and is consistent with their Reunion-Deccan plume origin hypothesis. The emplacement of these complexes at 65 Ma makes them very significant in the ongoing debate on the K/T extinctions owing to their capacity to rapidly inject a substantial amount of CO2 and SO2 into the atmosphere.

  3. Charge-exchange, ionization and excitation in low-energy Li$^{+}-$ Ar, K$^{+}-$ Ar, and Na$^{+}-$He collisions

    Lomsadze, Ramaz A; Kezerashvili, RomanYa; Schulz, Michael

    2016-01-01

    Absolute cross sections are measured for charge-exchange, ionization, and excitation within the same experimental setup for the Li$^{+}-$Ar, K$^{+}-$ Ar, and Na$^{+}-$ He collisions in the ion energy range $0.5-10$ keV. Results of our measurements along with existing experimental data and the schematic correlation diagrams are used to analyze and determine the mechanisms for these processes. The experimental results show that the charge-exchange processes are realized with high probabilities and electrons are predominately captured in ground states. The cross section ratio for charge exchange, ionization and excitation processes roughly attains the value $10:2:1$, respectively. The contributions of various partial inelastic channels to the total ionization cross sections are estimated and a primary mechanism for the process is defined. The energy-loss spectrum, in addition, is applied to estimate the relative contribution of different inelastic channels and to determine the mechanisms for the ionization and f...

  4. Timing of gold mineralisation in the Ballarat goldfields, central Victoria: constraints from 40Ar/39Ar results

    40Ar/39Ar data for muscovite separates and hydrothermally altered whole-rock samples from the Ballarat West and the Ballarat East goldfields indicate that mesothermal gold mineralisation at Ballarat occurred during several episodic pulses, ranging in age from the Late Ordovician to the Early Devonian, initial formation of auriferous structures in the Ballarat goldfields coincided with folding and thrusting associated with the development of the western Lachlan Fold Belt between 460 and 440 Ma. Subsequent fault reactivation and magmatism resulted in remobilisation and additional mineralisation between 410 and 380 Ma, and around 370 Ma. The results presented herein are in agreement with findings for other major gold deposits in central Victoria and further constrain the history of deformation, metamorphism and mineralisation in the western subprovince of the Lachlan Fold Belt. Copyright (1999) Geological Society of Australia

  5. Dating quartz: Ar/Ar analyses of coexisting muscovite and fluid inclusion - rich quartz from paleocene amorphic aureole

    We present Ar/Ar total fusion and step-heating data for coexisting muscovite and white quartz from the metamorphic aureole of the Lower Paleocene La Copiapina Pluton, 6 km south of Inca de Oro, III Region, Chile. The pluton intrudes the upper clastic sedimentary member of the Punta del Cobre Group (Upper Jurassic - Lower Cretaceous) and the calcareous sedimentary rocks of the Chanarcillo Group (Neocomian), and comprises fine to coarse grained pyroxene-hornblende-biotite quartz diorites and monzodiorites. Its emplacement was controlled on its north-western side by a subvertical NE-trending fault, along which were developed vertically banded skarns (skarn mylonite), suggesting syntectonic intrusion. Biotite K-Ar ages for the pluton fall in the range 61-63 Ma, relating it to a latest Cretaceous to Lowest Paleocene syn-compressional intrusive belt which is present in the area (Matthews and Cornejo, 2000). A metamorphic / metasomatic aureole is developed within the sandstones of the Punta del Cobre Group, on the extreme northern limit of the pluton. In this area, the sedimentary rocks have been replaced by quartz-sericite and quartz-muscovite assemblages, with minor hematite and tourmaline, and late supergene kaolinite and pyrophyllite. A coarse muscovite-quartz-tourmaline-hematite assemblage is developed in and around older (early Upper Cretaceous) andesitic dykes, in the form of replacement / fracture fill veins and replacement zones. Further from the contact with the pluton, fine-grained quartz-sericite rock with coarser muscovite-rich replacement veins represents the dominant lithology. Quartz in the coarse replacement rock is very rich in fluid inclusions. Primary inclusions are mainly of two coexisting types; bi-phase (liquid and gas bubble) and tri-phase (liquid, gas bubble and halite crystal), indicating that the quartz formed in the presence of a boiling fluid. Some inclusions also contain sylvite and occasional hematite daughter crystals. Secondary inclusions

  6. Avaliação da exposição ocupacional ao chumbo: proposta de uma estratégia de monitoramento para prevenção dos efeitos clínicos e subclínicos

    Araujo Ulisses C.; Pivetta Fatima R.; Moreira Josino C

    1999-01-01

    A produção de baterias chumbo-ácidas representa um dos segmentos industriais de maior consumo de chumbo, estando os trabalhadores expostos a riscos elevados. Neste trabalho são discutidos os resultados obtidos na avaliação da exposição ao chumbo de trabalhadores de uma fábrica de baterias da cidade do Rio de Janeiro, de acordo com as normas vigentes da legislação brasileira e com dados científicos atualizados. Os métodos empregados neste estudo foram a amostragem de ar-pessoal e a determinaçã...

  7. A comunidade como espaço de produção de saúde mental: contribuições da Psicologia Comunitária ao processo de desinstitucionalização

    Dayane Silva Rodrigues; Maria Aparecida Alves Sobreira de Carvallho; Verônica Morais Ximenes

    2011-01-01

    No contexto de implantação da reforma psiquiátrica brasileira, importantes conquistas foram obtidas com a proposição de serviços substitutivos ao manicômio. Contudo, a desinstitucionalização da loucura ultrapassa a esfera da desospitalização e se constitui, ainda, em um desafio cada vez mais atual. Para avançar nessa problemática, a comunidade tem sido crescentemente destacada como espaço potencialmente rico na produção coletiva da saúde mental. Contudo, observam-se poucos questionamentos e d...

  8. Anatomia foliar comparativa das cultivares de Nicotiana tabacum L. (Solanaceae) sensível e tolerante ao ozônio Comparative leaf anatomy of Nicotiana tabacum L. (Solanaceae) cultivars sensitive and tolerant to ozone

    Andrea Nunes Vaz Pedroso; Edenise Segala Alves

    2008-01-01

    O ozônio troposférico causa necroses foliares em Nicotiana tabacum. Cultivares de tabaco são muito utilizadas como bioindicadoras de ozônio, em programas de biomonitoramento da qualidade do ar. Dentre elas destacam-se as cultivares Bel-W3 (sensível) e Bel-B (tolerante). Este estudo teve como objetivo verificar se as duas cultivares apresentam variações na estrutura foliar que possam ajudar a explicar a diferença na sensibilidade ao ozônio que ambas apresentam. Em plantas que cresceram em ambi...

  9. 40Ar/39Ar Age Constraints on Caldera Formation of the Emmons Lake Volcanic Center, Alaska Peninsula, Alaska

    Drake, J.; Layer, P. W.; Mangan, M. T.; Miller, T. P.; Waythomas, C. F.

    2001-12-01

    The Emmons Lake Volcanic Center located on the Alaska Peninsula is a large shield/stratovolcano complex composed of basaltic to andesitic lava flows and dacite to rhyolite pyroclastic flows, domes and ashfall. Two caldera forming eruptions in Pleistocene time each produced more than 50 cubic kilometers of silicic ejecta and created a nested depression measuring 20 km long and 10 km wide. We conducted 40Ar/39Ar whole rock dating of units associated with the first caldera forming event, which because of broad geochemical similarities, has been suggested as a possible source of the Old Crow Tephra, dated throughout interior Alaska and the Yukon at about 140 ka. Samples dated ranged in composition from ~62 to 69 wt % SiO2 and contained 2 - 3 wt % K2O. For each sample, 15 specimens, consisting of small ( ~1 mm) whole rock chips, were fused with an argon ion laser. From these analyses, weighted mean and isochron ages were calculated. For all samples, the initial 40Ar/36Ar ratio was indistinguishable from that of the present-day atmosphere (295.5), indicating that these samples do not contain significant quantities of excess argon. The age of a welded tuff interpreted to be from the opening plinian phase of the eruption is 233 +/- 6 ka, and is identical to the age of a post-collapse rheomorphic tuff (234 +/- 5 ka). A lithic fragment from a syn-collapse lag breccia has an age of 419 +/- 9 ka, which we interpret as representing incorporation of older material. Younger tuffs and domes were dated at 99 +/- 7 ka and 16 +/- 10 ka and imply that the complex was active throughout the late Quaternary. Based on these new age data, and subtle but significant trace element differences in glass and Fe-Ti oxide composition, we conclude that the first major caldera building event occurred at approximately 230 ka, and is probably not responsible for the deposition of the Old Crow tephra.

  10. Benchmark calculations with correlated molecular wave functions. IX. The weakly bound complexes Ar - H2 and Ar - HCl

    The interaction of Ar with H2 and HCl has been studied using Moeller - Plesset perturbation theory (MP2, MP3, MP4) and coupled-cluster [CCSD, CCSD(T)] methods with augmented correlation consistent basis sets. Basis sets as large as triply augmented quadruple zeta quality were used to investigate the convergence trends. Interaction energies were determined using the supermolecule approach with the counterpoise correction to account for basis set superposition error. Comparison with the available empirical potentials finds excellent agreement for both binding energies and transition state. For Ar - H2, the estimated complete basis set (CBS) limits for the binding energies of the two equivalent minima and the connecting transition state (TS) are, respectively, 55 and 47cm-1 at the MP4 level and 54 and 46cm-1 at the CCSD(T) level, respectively [the XC(fit) empirical potential of Bissonnette et al. [J. Chem. Phys. 105, 2639 (1996)] yields 56.6 and 47.8cm-1 for H2 (v=0)]. The estimated CBS limits for the binding energies of the two minima and transition state of Ar - HCl are 185, 155, and 109cm-1 at the MP4 level and 176, 147, and 105cm-1 at the CCSD(T) level, respectively [the H6(4,3,0) empirical potential of Hutson [J. Phys. Chem. 96, 4237 (1992)] yields 176.0, 148.3, and 103.3cm-1 for HCl (v=0)]. Basis sets containing diffuse functions of (dfg) symmetries were found to be essential for accurately modeling these two complexes, which are largely bound by dispersion and induction forces. Highly correlated wave functions were also required for accurate results. This was found to be particularly true for ArHCl, where significant differences in calculated binding energies were observed between MP2, MP4, and CCSD(T). copyright 1998 American Institute of Physics

  11. Empirical Likelihood Inference for AR(p) Model%AR(p)模型的经验似然推断

    陈燕红; 赵世舜; 宋立新

    2008-01-01

    In this article we study the empirical likelihood inference for AR(p) model.We propose the moment restrictions, by which we get the empirical likelihood estimator of the model parametric, and we also propose an empirical log-likelihood ratio base on this estimator.Our result shows that the EL estimator is asymptotically normal, and the empirical log-likelihood ratio is proved to be asymptotically standard chi-squared.

  12. Mineralogy and Ar-Ar Age of the Tarahumara IIE Iron, with Reference to the Origin of Alkali-Rich Materials

    Takeda, Hiroshi; Bogard, Donald D.; Otsuki, Mayumi; Ishii, Teruaki

    2003-01-01

    Silicate inclusions in nine known IIE irons show diversity in mineralogy, and Colomera, Kodaikanal, Elga and Miles contain alkali-rich silicate inclusions. Bogard et al. showed evidence of a complex parent body evolution for IIE irons based on Ar-39-Ar-40 ages. Colomera contained a sanidine-rich surface inclusion and the K-enrichment trends in the Na-rich inclusions are different from those of other IIEs. To elucidate the origin of K-rich materials, we studied the mineralogy and Ar-Ar age of silicate inclusions from the Tarahumara IIE iron meteorite.

  13. Atmospheric pressure plasma jet utilizing Ar and Ar/H2O mixtures and its applications to bacteria inactivation

    An atmospheric pressure plasma jet generated with Ar with H2O vapor is characterized and applied to inactivation of Bacillus subtilis spores. The emission spectra obtained from Ar/H2O plasma shows a higher intensity of OH radicals compared to pure argon at a specified H2O concentration. The gas temperature is estimated by comparing the simulated spectra of the OH band with experimental spectra. The excitation electron temperature is determined from the Boltzmann's plots and Stark broadening of the hydrogen Balmer Hβ line is applied to measure the electron density. The gas temperature, excitation electron temperature, and electron density of the plasma jet decrease with the increase of water vapor concentration at a fixed input voltage. The bacteria inactivation rate increases with the increase of OH generation reaching a maximum reduction at 2.6% (v/v) water vapor. Our results also show that the OH radicals generated by the Ar/H2O plasma jet only makes a limited contribution to spore inactivation and the shape change of the spores before and after plasma irradiation is discussed. (physics of gases, plasmas, and electric discharges)

  14. Constraints on the development of Proterozoic basins in central India from 40Ar/39Ar analysis of authigenic glauconitic minerals

    Conrad, J.E.; Hein, J.R.; Chaudhuri, A.K.; Patranabis-Deb, S.; Mukhopadhyay, J.; Deb, G.K.; Beukes, N.J.

    2011-01-01

    Ages of some key stratigraphic sequences in central Indian Proterozoic basins are based predominantly on lithostratigraphic relationships that have been constrained by only a few radioisotopic dates. To help improve age constraints, single grains of glauconitic minerals taken from sandstone and limestone in two Proterozoic sequences in the Pranhita-Godavari Valley and the Chattisgarh basin were analyzed by the 40Ar/39Ar incremental heating method. Analysis of the age spectra distinguishes between ages that are interpreted to reflect the time of glauconite formation, and anomalous ages that result from inherited argon or postcrystallization heating. The analyses indicate an age of 1686 ± 6 Ma for the Pandikunta Limestone and 1566 ± 6 Ma for the Ramgundam Sandstone, two units in the western belt of Proterozoic sequences in Pranhita-Godavari Valley. Glauconite from the Chanda Limestone, in the upper part of this sequence, contains inherited 40Ar but is interpreted to reflect an age of ca. 1200 Ma. Glauconite from the Somanpalli Group in the eastern belt of the Pranhita-Godavari Valley gives an age of 1620 ± 6 Ma. In the Chattisgarh basin, glauconite from two units gives disturbed ages that suggest a period of regional heating in the Chattisgarh basin at ca. 960–1000 Ma. These new ages indicate that these sequences are 200–400 m.y. older than previously recognized, which has important implications for geochemical studies of Mesoproterozoic ocean redox conditions in addition to providing important constraints on regional tectonics and lithostratigraphy.

  15. 40Ar/39Ar age of the Rotoiti Breccia and Rotoehu Ash, Okataina Volcanic Complex, New Zealand, and identification of heterogeneously distributed excess 40Ar in supercooled crystals

    Flude, Stephanie; Storey, Michael

    2016-01-01

    Co-magmatic granitoid clasts erupted as part of the Rotoiti Ignimbrite (Rotoehu Tephra) contain euhedral K-feldspar and biotite crystals that protrude into miarolytic cavities and show textural evidence for growth in super-cooled conditions and are thus interpreted as growing during eruption. 40Ar....../39Ar stepped heating experiments on single K-feldspar crystals reveal the presence of heterogeneously distributed excess 40Ar, preferentially released at lower temperature steps (most likely from fluid/melt inclusions), which cannot reliably be characterised by, or corrected for using isotope...... correlation diagrams due to mixing between three reservoirs of 40Ar (radiogenic, atmospheric and excess). This excess 40Ar component is common, but not ubiquitous, and an age population unmixing algorithm applied to single-crystal fusion data identifies a younger group of K-feldspar and biotite crystals that...

  16. Tratamento preservativo de Bambusa tuldoides Munro para sua utilizaçao na indústria de móveis

    Penna, Jose Eduardo

    2013-01-01

    Resumo: São apresentados tratamentos com preservativo à "base de CCB para evitar o ataque de Lyotus brunneus Steph. Usaram-se bambus nos estados verde e parcialmente seco ao ar. Efetuaram-se tratamentos no campo (imersão-difusão), na linha de produção da industria (vaporização-imersão/difusão à temperatura ambiente) e no laboratório (imersão-difusão a temperatura controlada). Usaram-se colmos com os septos nodais perfurados e não perfurados. Procedeu-se a estudos anatômicos, de penetração , r...

  17. Study on high pressure plasma produced by ArF laser

    Tsuda, Norio; Yamada, Jun

    2004-01-01

    When an ArF excimer laser beam was focused in a high pressure argon gas from 50 to 130 atm, the plasma development is observed by streak camera from side window of chamber. The high pressure ArF laser plasma develops symmetrically and the plasma produced by ArF excimer laser hardly develops as compared with the plasma produced by XeCl. The photon energy of ArF laser light is higher than the XeCl laser. The transmittance of ArF laser light was measured. Almost all the laser light is transmitte...

  18. High-Energy Ions Emitted from Ar Clusters Irradiated by Intense Femtosecond Laser Pulses

    LI Zhong; LEI An-Le; NI Guo-Quan; XU Zhi-Zhan

    2000-01-01

    We have experimentally studied the energy spectra of Ar ions emitted from Ar clusters irradiated by intense femtosecond laser pulses. The Ar clusters were produced in the adiabatic expansion of Ar gas into vacuum at high backing pressures. The laser peak intensity was about 2×106 W/cm2 with a pulse duration of 45 fs. The maximum and the average energies of Ar ions are 0.2 MeV and 15kev at a backing pressure of 2. S MPa, respectively. They are almost independent of the backing pressures in the range of 0.6 to 4.5 MPa.

  19. Comparison of Ne and Ar seeded radiative divertor plasmas in JT-60U

    Nakano, T., E-mail: nakano.tomohide@jaea.go.jp

    2015-08-15

    In H-mode plasmas with Ne, Ar and a mixture of Ne and Ar injection, the divertor radiation power fractions amongst these impurities in addition to an intrinsic impurity, C, are investigated. In plasmas with the inner divertor plasma attached, carbon is the biggest radiator, whichever impurity, Ne, Ar or a mixture of Ar and Ne is injected. In contrast, in plasmas with the inner divertor plasma detached, Ne is the biggest radiator due to a significantly high recombination radiation from Ne VIII. Ar is always a minor contributor in plasmas with the inner divertor both attached and detached.

  20. Characteristics of violent collisions in Ar-induced reactions at intermediaire energies

    We report on two experiments performed with the Ganil facility using the 27 MeV/u Ar beam. The first one concerns an intermediate mass system, Ar + Ag. For the second one a heavier fissile system, Ar + U, was chosen. For Ar + Ag information about fusion requires the measurements of evaporation residues and fission. In the Ar + U reaction, most of the collisions lead to fission. The violence of the collision is therefore determined from the correlation angle of the coincidence fission fragments