WorldWideScience

Sample records for aberto ao ar

  1. Fatores ambientais sobre a idade ao primeiro parto, dias abertos e intervalo entre partos em vacas da raça holandesa na Bacia Leiteira de Castrolanda, estado do Paraná

    Wolff, Maria Cândida Córdova

    2012-01-01

    Dados provenientes do Programa de Análises de Rebanhos Leiteiros do Paraná (PARLPR) da Associação Paranaense de Criadores de Bovinos Leiteiros da Raça Holandesa (APCBRH) foram analisados para estudar os fatores do meio ambiente (rebanho, ano de parto, mês de parto, grupo genético, idade ao parto e efeito vaca) que estariam influenciando as características reprodutivas: idade ao primeiro parto (IPP) em meses, .dias abertos (DA) e intervalo entre partos (IEP) em dias, nas vacas da raça Holandes...

  2. EFEITOS DO CAPITAL INTELECTUAL SOBRE O DESEMPENHO FINANCEIRO EM COMPANHIAS DE CAPITAL ABERTO

    Maria Margarete Baccin Brizolla; Salete Turra

    2015-01-01

    O objetivo deste estudo foi identificar a influência do Capital Intelectual, medido pelo Valor agregado do Capital Intelectual (VACI) sobre o desempenho financeiro em companhias de capital aberto. A classificação do estudo no que se refere aos objetivos é uma pesquisa descritiva, em relação aos procedimentos classifica-se como documental e a abordagem refere-se à análise quantitativa. A investigação que permeia este estudo envolve as características relacionadas ao capital inte...

  3. Teste de provocação oral aberto na confirmação de alergia ao leite de vaca mediada por IgE: qual seu valor na prática clínica? Open oral food challenge in the confirmation of cow's milk allergy mediated by IgE: what is its value in the clinical practice?

    Raquel Bicudo Mendonça

    2011-09-01

    Full Text Available OBJETIVO: Revisar os principais protocolos de padronização para o teste de provocação oral aberto aplicado a crianças com suspeita de alergia ao leite de vaca mediada por imunoglobulina E. FONTES DE DADOS: Foram selecionados artigos publicados, nos últimos dez anos, nas bases de dados Medline, Lilacs e SciELO, utilizando-se os descritores de assunto: "hipersensibilidade alimentar", "leite de vaca", "alergia ao leite de vaca", "teste de provocação oral", "crianças" e "diagnóstico". SÍNTESE DOS DADOS: O teste de provocação oral é o método mais fidedigno para estabelecer ou excluir o diagnóstico de alergia alimentar e sua forma aberta pode ser a primeira opção, quando apenas reações objetivas são esperadas. O local para realizar o teste deve possuir todos os recursos para tratamento de emergência. Como preparo, o paciente deve seguir dieta de exclusão do alimento suspeito e descontinuar o uso de medicamentos que possam interferir no resultado do teste. Habitualmente, utilizam-se 8 a 10g de leite em pó ou 100mL de leite fluido, oferecidos em volumes progressivos, a intervalos de dez a 60 minutos. Apesar da rigidez do método, ainda existem situações em que há dificuldade de interpretação dos resultados; por isso, médicos bem treinados devem aplicar o teste, sendo cautelosos ao julgarem as reações. CONCLUSÕES: Mesmo considerando as limitações que dificultam a aplicação do teste de provocação oral na prática clínica, a implementação do teste nos serviços de saúde poderia reduzir diagnósticos falsos-positivos de alergias.OBJECTIVE: To review the main standardization protocols of the open oral food challenge applied to children with suspicion of cow's milk allergy mediated by immunoglobulin E. DATA SOURCE: Medline, Lilacs and SciELO databases were searched for articles published in the last ten years using the following descriptors: "food hypersensitivity", "cow's milk", "cow's milk allergy", "oral food

  4. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Solange Diccini

    1999-12-01

    Full Text Available No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp-Hospital São Paulo, no período de julho de 1995 a fevereiro de 1997. TIPO DE ESTUDO: Aberto, randomizado, paralelo. Alta da emergência determinada pelo VEF1 e PFE > 60% do previsto. CASUÍSTICA E MÉTODOS: Cento e vinte pacientes em crise de asma foram divididos em dois grupos (N = 60: fenoterol (F e brometo de ipratrópio + fenoterol (BIF com VEF1 e PFE Repeated dosis of inhaled b2-agonists have been used in the treatment of acute asthma. The effect of added ipratropium bromide (IB to b2-agonist is controversial in adults. OBJECTIVE: To evaluate if addition of IB to fenoterol, in repeated doses, induces a greater bronchodilation, a greater reversion of the attack, and discharge from emergency unit in adults with acute severe asthma. SETTING: Pneumology Emergency Department, Unifesp-Hospital São Paulo, in the period from July 1995 to February 1997. TYPE OF STUDY: Open, randomized and parallel study. Discharge from the hospital: FEV1 and PEF > 60% of the predicted value. METHODS: 120 patients with FEV1 and PEF < 50% of the predicted value were divided into two groups (N = 60: fenoterol (F and ipratropium bromide + fenoterol (IBF. Each group received inhalation treatment through a metered-dose inhaler (MDI attached to a holding chamber, administered at 30-minute interval, for a total of three treatments. In the group F four puffs of fenoterol (400 mg were administered, and in the IBF group, 160 mg of BI and 400 mg of fenoterol (four puffs

  5. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    Rogério Atem de Carvalho

    2009-12-01

    Full Text Available Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP. Porém verifica-se que este tipo de sistema ainda não é suficientemente explorado, mesmo no meio acadêmico. Este artigo relata alguns trabalhos publicados sobre o assunto e levanta questões que devem ser tratadas por pesquisadores e demais interessados para adequar e viabilizar o uso desses sistemas conforme a realidade nacional. Assim, após uma introdução ao tema, são apresentadas algumas diferenças entre o FOS-ERP e seus equivalentes proprietários (Proprietary ERP ou P-ERP em termos de modelos de negócios, seleção, customização e evolução. Em seguida são elencados alguns desafios e oportunidades que o FOS-ERP pode oferecer a usuários, fornecedores, pesquisadores e colaboradores individuais. Concluindo, este artigo busca ampliar a discussão sobre FOS-ERP, destacando fatores tais como seu potencial de inovação tecnológica e estratégias de negócios.Enterprise Resources Planning (ERP enables the processing of information required in an enterprise, using a single database. Much has been written about this type of software, addressing issues such as the high cost of licenses acquisitions, and the dependence on consultants for its adaptation and implementation in companies. Currently the development and use of ERP Free Open Source (FOS-ERP has increased. However, this type of system is still not sufficiently explored, even in academia. This article analyses some papers on the subject, and raises questions that must be addressed by researchers and other stakeholders

  6. A eficácia do milnaciprano em pacientes ambulatoriais com transtorno depressivo maior não respondedores ao tratamento com ISRSs: um estudo aberto de 12 semanas Efficacy of milnacipran in outpatients experiencing major depression non respondent to SSRIs: a 12-week open study

    Marcelo P. Fleck

    2010-01-01

    Full Text Available CONTEXTO: O objetivo deste estudo é avaliar a eficácia do milnaciprano em pacientes ambulatoriais com depressão maior grave que não respondem em tempo e em dosagem adequados à terapia com ISRSs. MÉTODOS: Um estudo aberto multicêntrico com a duração de 12 semanas foi elaborado para avaliar a eficácia do milnaciprano após falha em um experimento com ISRS. Remissão completa (HAMD-17 50%, CGI e avaliação da qualidade de vida (WHOQOL-Bref. RESULTADOS: O escore HAMD-17 médio da amostra foi de 27 (7,2. As taxas de remissão com o milnaciprano foram de 17,5%, e as de resposta, 61,3%. Na linha de base, 70,9% dos pacientes foram classificados como gravemente sintomáticos. Ao final do tratamento, 48,1% dos pacientes foram classificados como normais assintomáticos ou sintomáticos limítrofes e 20,2% eram moderadamente sintomáticos. Além disso, os quatro domínios do WHOQOL-Bref, um instrumento genérico de mensuração de qualidade de vida, apresentou diferenças clínicas e estatísticas: CONCLUSÃO: Nossos resultados sugerem que o milnaciprano é uma possível opção para pacientes que não respondem a ISRSs. Uma vez que não há evidências na literatura de um antidepressivo que seja a melhor opção quando um ISRS falha, o uso do milnaciprano deveria ser considerado em casos de pacientes com depressão severa.BACKGROUND: The objective of this study is to evaluate the efficacy of milnacipran in outpatients experiencing severe MDD non-respondent to adequate time and dosing of SSRI therapy. METHODS: A 12 week multi-centric study open study was designed to evaluate the efficacy of milnacipran after a SRRI trial failure. Complete remission (HAMD-17 50%, CGI and quality of life measure (WHOQOL-Bref. RESULTS: The mean HAMD-17 score of the sample was 27 (7.2. The remission rates for minalcipran were 17.5% and response 61.3%. At baseline, 70.9% of the patients were markedly or severely ill. At treatment end, 48.1% of the patients were normal

  7. EFEITOS DO CAPITAL INTELECTUAL SOBRE O DESEMPENHO FINANCEIRO EM COMPANHIAS DE CAPITAL ABERTO

    Maria Margarete Baccin Brizolla

    2015-06-01

    Full Text Available O objetivo deste estudo foi identificar a influência do Capital Intelectual, medido pelo Valor agregado do Capital Intelectual (VACI sobre o desempenho financeiro em companhias de capital aberto. A classificação do estudo no que se refere aos objetivos é uma pesquisa descritiva, em relação aos procedimentos classifica-se como documental e a abordagem refere-se à análise quantitativa. A investigação que permeia este estudo envolve as características relacionadas ao capital intelectual, em 166 companhias listadas na BM&FBovespa, compondo a amostra no período de 2013. Os dados foram coletados na base de dados Economática®. Quanto à técnica estatística foi utilizada a Correlação Canônica. Os resultados da pesquisa demonstram que o capital intelectual influência significativamente o desempenho financeiro, em companhias de capital aberto.

  8. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    Rogério Atem de Carvalho; Renato Campos

    2009-01-01

    Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP). Porém verifica-se que este tipo de sistem...

  9. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Solange Diccini; Clystenes Odyr Soares Silva; Jorge Nakatani; Carlos Alberto de Castro Pereira

    1999-01-01

    No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI) ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp...

  10. Processing and extracting data from Dicionário Aberto

    Simões, Alberto; Almeida, J. J.; Farinha, Rita

    2010-01-01

    Synonyms dictionaries are useful resources for natural language processing. Unfortunately their availability in digital format is limited, as publishing companies do not release their dictionaries in open digital formats. Dicionário-Aberto is an open and free digital synonyms dictionary for the Portuguese language. It is under public domain which makes it usable for any task. Synonyms dictionaries are commonly used for the extraction of relations between words, constructing structures similar...

  11. Determinação analítica da performance da irrigação por sulcos abertos e em declive

    Aristides Fraga Lima Filho

    2015-06-01

    Full Text Available Uma solução analítica foi desenvolvida, para avaliar sulcos abertos e em declive, com base na teoria de Balanço de Volume de Walker e Skogerboe (1987. Essa metodologia é capaz de obter, matematicamente, a performance de um sistema, dispensando a construção de gráficos que definem os parâmetros de avaliação. A solução matemática é baseada no ajuste de equações ao modelo potencial, no cálculo das áreas sob as curvas definidas no ajuste e na intercessão de curvas, obtendo-se, assim, a performance de sistemas de irrigação por sulcos abertos e em declive. Para validação da metodologia, foi realizado um experimento de campo, na Fazenda Experimental da Universidade Federal do Ceará, situada no município de Pentecoste, pertencente ao Centro de Ciências Agrárias. Os dados de campo foram submetidos à análise pelas duas metodologias. Os resultados mostraram que a metodologia analítica pode ser usada para avaliar a irrigação por sulcos abertos e em declive.

  12. Educação ao ar livre pela aventura: o aprendizado de valores morais em expedições à natureza Education outdoors through adventure: learning moral values in nature expeditions

    Flavio Theodor Kunreuther

    2012-06-01

    Full Text Available A educação ao ar livre, por meio de cursos no formato expedição, ainda acontece de forma tímida no Brasil. Entende-se por expedição uma experiência educacional contínua, de múltiplos dias, em que alunos e instrutores aventuram-se em um trajeto em área remota da natureza de forma autossuficiente. O presente estudo analisa os cursos desse tipo. Por meio de entrevistas e questionários semiestruturados, investigou-se a aprendizagem dos alunos segundo suas próprias percepções e as dos educadores da instituição, com ênfase no desenvolvimento moral do indivíduo. Como parte do estudo de caso sobre um aluno adolescente participante de um dos cursos, entrevistou-se também uma psicóloga que coordena um abrigo para menores. Os resultados encontrados indicam que os cursos de educação ao ar livre caracterizam-se por experiências que estimulam trabalhos em grupo, debates sobre justiça e solidariedade, e reflexões sobre valores e princípios como coragem, esforço pessoal, disciplina, respeito e superação de limites. Os resultados também indicam que tal proposta educacional aufere experiências sensíveis e de conexão do ser humano com a natureza. Muito embora haja potencial educacional para a educação ao ar livre, a atuação do educador perante seus alunos é fundamental para que as experiências sejam física e psicologicamente seguras, alcancem seus potenciais pedagógicos de desenvolvimento da moralidade e ajudem as pessoas a desenvolverem uma consciência ambiental, manifestada por meio de ações concretas ao retornarem dos cursos para suas comunidades.Open air education through courses organized as expeditions is still incipient in Brazil. We understand an expedition as a continued educational experience taking several days in which students and instructors venture into a remote natural area in a self-sufficient way. The present study analyzes courses of this type. Using interviews and semi-structured questionnaires, it

  13. Julgamento de colinearidade e percepção de distância exocêntrica em campo aberto

    Javier Enrique Santillán

    2011-01-01

    Full Text Available O propósito foi investigar experimentalmente o desempenho dos observadores numa original tarefa de julgamento de colinearidade em campo aberto (dimensões 20 x 30 m. Participaram do experimento 30 observadores. Os estímulos foram estacas verticais de alturas variáveis, quatro fixos e quatro móveis. A tarefa consistiu em ajustar os dois estímulos móveis (mediante controle à distância para que ficassem colineares aos dos estímulos fixos nos extremos de cada diagonal. Foi realizada uma análise de variância (ANOVA fatorial sobre os erros de colinearidade, revelando somente efeito significativo para o fator ‘Estímulo Móvel’ (F(3,473=69,86 p<0,001 notando-se uma sistemática na distribuição dos erros. As pequenas variações na distância exocêntrica percebida (com erros constantes dez vezes menores que os encontrados ao avaliar as distâncias egocêntricas e a relação dos erros cometidos com as distâncias egocêntricas indicariam que o marco de referência eliciado por esta tarefa de colinearidade, embora possa estar baseado nos indícios exocêntricos, é escalado por um fator egocêntrico.

  14. Otimização econômica de explotações a céu aberto

    Frederico Augusto Rosa do Carmo

    2006-09-01

    Full Text Available A determinação dos limites da cava final de qualquer projeto de mineração é um dos maiores desafios de um projeto de mineração. Tais limites precisam ser definidos já no início dos trabalhos de planejamento de lavra e devem ser reconsiderados, novamente e rotineiramente, durante toda a vida útil da mina. Um dos propósitos do plano de exaustão de minas a céu aberto é determinar a cava final ótima, baseando-se em um modelo econômico sujeito a restrições técnicas e visando à maximização do valor atual líquido do projeto. O primeiro algoritmo específico relacionado ao tema foi publicado por Lerchs e Grossmann (1965. O algoritmo de Lerchs e Grossmann tem sido aceito como padrão de teste em comparação com outros algoritmos equivalentes, que têm sido propostos, porque ele resolve o problema correspondente, segundo a teoria dos grafos, ao corte mínimo e fluxo máximo. Outros algoritmos de otimização de cavas finais de minas a céu aberto também são apresentados nesse trabalho. Além disto, um programa acadêmico para a otimização de cavas foi desenvolvido pelos autores sendo que os fundamentos deste são apresentados no presente artigo.The determination of the final pit limits of any mining project is one of the most important challenges in a mining project. Such limits need to be defined at the beginning of the mine planning and should be reconsidered, again and routinely, during all the useful life of a mine. One of the purposes of the open pit mine exhaustion plan is the determination of the optimal final pit, based on an economic model subject to technical restrictions and aimed to maximize the net present value. LERCHS e GROSSMANN (1965 published the first specific algorithm related to the theme. This algorithm has been accepted as standard in comparison to other equivalent algorithms which have been proposed, because it solves the corresponding problem, according to the graph theory, of the minimum cut and

  15. Análise eletromiográfica de músculos do membro inferior em exercícios proprioceptivos realizados com olhos abertos e fechados

    Daniela Cristina Silveira de Oliveira

    2012-08-01

    Full Text Available INTRODUÇÃO: A propriocepção é um termo utilizado para descrever todas as informações neurais originadas nos proprioceptores das articulações, músculos, tendões, cápsulas e ligamentos, que são enviadas por meio das vias aferentes ao sistema nervoso central. A eletromiografia (EMG é o estudo da função muscular por meio da averiguação do sinal elétrico que emana do músculo, sendo também, o estudo da atividade da unidade motora. OBJETIVO: Realizar uma análise eletromiográfica dos músculos reto femoral (RF e tibial anterior (TA, em diferentes exercícios proprioceptivos (disco de Freeman-DIS e balancim-BAL com os olhos abertos (OA e fechados (OF. MÉTODOS: A análise foi realizada com 10 indivíduos do gênero masculino, fisicamente ativos, em um tempo de coleta de 10 segundos em cada aparelho tanto com olhos abertos como fechados. RESULTADOS: De acordo com nossos achados, observamos uma diferença significativa quando os exercícios proprioceptivos são realizados com olhos abertos e olhos fechados, obtendo uma ativação muscular maior, de acordo com a análise eletromiográfica, nos exercícios com olhos fechados, ressaltando a importância do sistema visual e como ele interfere na posição do corpo quando este é submetido a variações de equilíbrio causadas pelos aparelhos pesquisados. CONCLUSÃO: Concluímos que o músculo reto femoral não apresentou diferenças significativas evidentes entre os aparelhos balancim e disco de Freeman, assim como quando o exercício era realizado com os olhos abertos ou fechados. A diferença significativa ocorrida foi entre o balancim OA e OF e entre balancim OA e disco de Freeman OF. Já o músculo tibial anterior, apresentou diferenças significativas maiores, principalmente com os olhos fechados, independente do aparelho, os quais não apresentaram diferenças significativas entre eles.

  16. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Laerte Francisco Filippsen; Denyse Maria Galvão Leite; Aparecido da Silva; Gilberto Alexandre Vargas

    2001-01-01

    O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames soro...

  17. Ars disyecta Ars disyecta

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  18. Exposição ao mercúrio e ao arsênio em Estados da Amazônia: síntese dos estudos do Instituto Evandro Chagas/FUNASA Exposure to mercury and arsenic in Amazon States: a summary of studies by the Evandro Chagas Institute/FUNASA

    Elisabeth C. de Oliveira Santos

    2003-06-01

    Full Text Available Este artigo é uma revisão das pesquisas da Seção de Meio Ambiente do Instituto Evandro Chagas/FUNASA sobre exposição ao mercúrio (Hg no vale do rio Tapajós e Estado do Acre, e exposição ao arsênio (As através de resíduos da exploração de manganês (Mn realizada pela ICOMI deixados no Porto de Santana-AP. Em relação ao mercúrio, têm sido pesquisadas populações sob risco através da via respiratória ou alimentar. No primeiro caso, os trabalhadores de casas de compra e venda de ouro têm apresentado teores mais elevados de Hg em urina do que os garimpeiros estudados. No segundo caso, as populações ribeirinhas têm mostrado níveis diferenciados de exposição (Hg em cabelo. Comunidades ribeirinhas situadas em áreas não afetadas pelo mercúrio da garimpagem e com hábitos alimentares semelhantes às de área de risco têm sido avaliadas, visando a construção de parâmetros de normalidade regional. São também pesquisados os teores de Hg em materiais ambientais e na biota aquática. Os estudos de saúde humana e ambiente na cidade de Santana-AP objetivaram avaliar as fontes e possíveis vias de exposição da população da comunidade do Elesbão ao arsênio. Verificou-se a existência de fonte de risco através dos rejeitos de Mn, porém os níveis de As na água consumida pela população mostraram-se dentro dos parâmetros de normalidade. As médias encontradas em sangue e cabelo coincidem com médias de normalidade referidas na literatura, em populações não expostas, e as associações entre variáveis epidemiológicas, avaliação clínico-laboratorial e os teores de arsênio não mostraram significância estatística.This article is a review of the studies carried out by Environmental Section of the Evandro Chagas Institute/FUNASA on mercury (Hg exposure in the Tapajós river basin, and arsenic exposure (As due to residues of the manganese (Mn exploration, performed by ICOMI and left at the port of Santana

  19. Estratégia da Estrutura de Capital sob os Efeitos das Fusões: Estudo de Caso das Instituições de Ensino Superior Brasileiras de Capital Aberto

    Raul Carlos de Mello

    2010-11-01

    Full Text Available O objetivo deste artigo foi identificar os reflexos produzidos por uma estratégia de crescimento, que se utiliza das fusões, aquisições ou incorporações, sobre a estrutura de capital das instituições de ensino superior brasileiras de capital aberto. A pesquisa utilizada foi de caráter descritivo e o método empregado foi o dedutivo, tendo como meio de investigação o estudo de caso múltiplo. Desse modo, ao elaborar um mapeamento, para o período de 2004 a 2008, de todas as aquisições desenvolvidas pelas instituições de ensino superior brasileiras de capital aberto e dos indicadores relacionados às estruturas de capital, identificou-se uma influência da estratégia de aquisições sobre a estrutura de capital em duas fases: na própria definição da estratégia, ao identificar e usufruir das fontes necessárias para a implantação, e na sua implantação, ao decidir pela agregação das dívidas da empresa adquirida.

  20. CNPq e o acesso aberto à informação científica

    José Donizetti Freire

    2015-01-01

    Nesta tese se discute o processo formal de comunicação científica por meio de artigos publicados em revistas científicas nacionais e internacionais e a acessibilidade dessas informações em canais de acesso aberto. Descrevem-se os modelos de negócios das editoras científicas e elabora-se uma proposta de sistema de gestão da produção científica financiada pelo Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) em repositório digital de acesso aberto. A pesquisa envolveu várias...

  1. Influência do DNA mitocondrial no glaucoma primário de ângulo aberto sob a visão da cienciometria

    Leonardo Mariano Reis

    2013-10-01

    Full Text Available OBJETIVO: O glaucoma primário de ângulo aberto é uma doença degenerativa do nervo óptico que se encontra entre as principais causas de cegueira no mundo. Aspectos familiares já foram implicados como fatores importantes e comprovados em inúmeros estudos. Nesse artigo, apresentamos uma revisão sistemática dos trabalhos sobre glaucoma primário de ângulo aberto e DNA mitocondrial e fazemos uma análise estatística à luz dos conceitos da cienciometria. MÉTODOS: A pesquisa bibliográfica de trabalhos envolvendo DNA mitocondrial e glaucoma primário de ângulo aberto foi realizada por meio da base de dados do sítio Scopus. Foi feito o levantamento a partir das palavras-chaves "Mitochondrial DNA" e "Glaucoma" em todos os campos para publicações no período compreendido de 1992 até agosto de 2012. Finalmente, foi realizada a estatística e cienciometria com os principais dados: autores que publicaram sobre o assunto DNA mitocondrial e glaucoma; revistas e outras publicações que tiveram trabalhos relacionados com o tema; Centros de Pesquisa e Universidades que mais publicaram e países onde foram realizados os estudos sobre DNA mitocondrial e glaucoma. RESULTADOS: Identificamos que esses estudos têm aumentado sobremaneira ao longo dos últimos anos, mas ainda se encontram confinados, na maior parte, a alguns centros de pesquisa e concentrados em seletos grupos de autores na área da oftalmologia em países desenvolvidos. No Brasil, ainda não temos pesquisas publicadas sobre o assunto até o momento. CONCLUSÃO: Esses estudos são de fundamental importância para a elucidação das causas genéticas do glaucoma e para o desenvolvimento de novas terapias que não visem tão somente a diminuição da pressão intraocular.

  2. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L.) sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L.) under air exposure stress

    Roberta Dias da Silva; Laudicéia Oliveira Rocha; Bruno Duarte Alves Fortes; Dirson Vieira; Maria Clorinda Soares Fioravanti

    2012-01-01

    No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus) sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM), a hemoglobina corpuscular média (HCM), a concentração de hemoglobina corpuscular média (CHCM), o leucograma, contagem diferencial de l...

  3. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Laerte Francisco Filippsen

    2001-04-01

    Full Text Available O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames sorológicos para Aujeszky, parvovirose, leptospirose e brucelose. Foram coletadas amostras de fezes dos leitões com diarréia para realização de exames bacteriológicos. A principal causa de mortalidade em leitões lactentes criados ao ar livre foi o esmagamento. A prevalência de doenças infecciosas não foi elevada. A ocorrência mais freqüente foi diarréia em leitões lactentes. O índice de pneumonia no rebanho de suínos criados ao ar livre foi baixo. Não houve ocorrência de doenças infecciosas da reprodução.The aim of this work was to determine the prevalence of infectious diseases in an outdoor pig herd in the South-western region of Paraná, Brazil, from October 1996 to June 1999. A total of 969 animals were examined. All infections observed were registered. All animals found dead within the period of study and one piglet of each litter sacrified on the 28th post weaning day were autopsied. Blood samples were collected for Aujeszky, parvovirus, leptospirosis and brucellosis serological tests. Faecal samples from piglets with diarrhoea were taken for bacteriological tests. Crushing was the main cause of outdoor suckling piglets mortality. The prevalence of infectious diseases was not high. The most frequent occurrence in suckling piglets was diarrhoea. The pneumonia index in the herd raised outdoors was low. There was no occurrence of reproductive infectious diseases.

  4. Frações nitrogenadas de silagens de milho "safrinha" sob diferentes tempos de exposição ao ar antes da ensilagem Nitrogenous fractions of silages from a maize crop planted late in season, under different periods of air exposure previous to ensiling

    João Pedro Velho

    2008-02-01

    Full Text Available Objetivou-se avaliar o efeito da maturidade dos grãos de milho e do tempo de exposição ao ar antes da ensilagem sobre o pH e os componentes nitrogenados de silagens de milho "safrinha". O experimento foi conduzido em delineamento completamente casualizado com arranjo fatorial 2 x 4, no qual foram testados dois estádios de maturidade (MA ao corte (grão completamente leitoso (GL ou grão ½ leitoso ½ farináceo (GF e quatro tempos de exposição ao ar (EX, sem compactação (0, 12, 24 e 36 horas antes da ensilagem em minissilos. Houve efeito significativo (PThis experiment was aimed at evaluating the effect of corn grain maturity and air exposure time prior to ensiling on the pH and nitrogenous fractions of corn silage from corn crop planted late in the season. A completely randomized 2 x 4 factorial arrangement was used to test the effect of two maturity stages at harvest (GL, milky kernel and GF, ½ milky ½ dough kernel of maize crops and the effects of four periods of air exposure of chopped materials (zero, 12, 24 and 36 hours previous to packing in mini-silos, on pH and N fractions of silages. There was a significant effect (P<0.05 related to stage of maturity and period of air exposure concerning the contents of crude protein and neutral detergent insoluble nitrogen, as well as an interaction between the main effects for ammonia nitrogen and acid detergent insoluble nitrogen. Due to the interaction, the maize silage harvested at the milky kernel stage resulted in higher pH value and ammonia nitrogen contents. A delayed packing procedure increases the insoluble nitrogen fractions and may affect negatively protein digestibility.

  5. Ars Electronica

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  6. THE AMBIGUOUS EXPERIENCE OF THE JOUISSANCE AND OF THE BODY IN THE NOVEL A CÉU ABERTO

    Marcio Markendorf

    2010-07-01

    Full Text Available Taking as its object of study the book A céu aberto, written by João Gilberto Noll, this paper discusses the theme of ambiguity in contemporary literature. The analysis is focused on the evaluation of a doppelgänger body, indeterminate in relation to sexuality, gender and jouissance.

  7. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  8. Efeitos ambientais da produção de suínos ao ar livre: evolução e distribuição espacial das formas de P no solo e perdas de P na água de drenagem Environmental impact of outdoor pig production: soil P forms evolution spatial distribution and P losses in drainage waters

    Carmo Horta

    2012-06-01

    Full Text Available A produção de suínos ao ar livre é considerada pelos consumidores como um modo de produção mais amigo do ambiente e do bem-estar animal. No entanto, os nutrientes contidos na ração e no "excreta" dos suínos são continuamente introduzidos no solo conduzindo a aumentos significativos desses nutrientes no solo, em especial do fósforo (P. Esta continua adição de P ao solo pode exceder a sua capacidade de retenção originando perdas significativas de P para as águas de drenagem e de escoamento superficial, contribuindo para a poluição difusa das águas superficiais. O principal objectivo deste trabalho foi avaliar o impacto da produção de suínos ao ar livre sobre o teor em P do solo avaliando a sua distribuição espacial e temporal, e avaliar também a perda de P através das águas de drenagem interna do solo. A unidade experimental de produção de suínos ao ar livre deste trabalho tem 2.8 ha, um declive entre 5 e 30% e uma carga animal de 9 adultos / ha. Observou-se um aumento do P do solo, quer do P biodisponível (P Olsen, P-Ol quer do P inorgânico (Pi ou orgânico (Po. No Inverno observaram-se elevadas perdas de P por erosão e escoamento superficial, mas ao longo do tempo observou-se um aumento global do P no solo. Um teor em P-Ol > 20 mg kg-1 originou um aumento significativo na perda de P para as águas de drenagem interna. Melhores práticas de maneio da unidade experimental, bem como uma escolha da área de produção menos susceptível à erosão, conduzirão a uma prevenção nos riscos de perda de P e na eutrofização das águas superficiais.When compared with intensive indoor production, outdoor pig production is considered by consumers as the production system that causes the least negative environmental effects and contributes to animal welfare. Nevertheless, the continuous input of nutrients in food or pig excretions, increases soil nutrients levels, as is the case with phosphorus (P. This continuous soil P

  9. Impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica: revisão de literatura Impact of the open and closed tracheal suctioning system on the incidence of mechanical ventilation associated pneumonia: literature review

    Fernanda Maia Lopes; Marcelo Farani López

    2009-01-01

    A pneumonia é a infecção nosocomial mais comum em unidades de terapia intensiva, sendo a ventilação mecânica um fator fortemente associado ao seu desenvolvimento. O objetivo deste estudo foi descrever o impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica. Realizou-se uma pesquisa na base de dados Pubmed para identificar tentativas controladas aleatórias, publicadas no período de 1990 a novembro de 2008. Nove estudos foram incluí...

  10. O espaço político aberto pela leitura literária

    Leonardo Pinto de Almeida

    2013-01-01

    Full Text Available O presente artigo se propõe questionar sobre o espaço político aberto pela leitura literária. Especificando a literatura como uma tentativa de compreensão de problemas relacionados à existência, sublinhamos como a leitura literária coloca em questão nossas convicções e verdades defendidas cotidianamente. Para tanto, compreendemos as relações tecidas entre a linguagem, o poder e a resistência no seio da experiência literária. Concluímos que a leitura literária é atravessada por formas de resistência às palavras de ordem que circulam de forma hegemônica em nossa sociedade, disponibilizando assim uma transformação em nossa rede afetiva e cognitiva.

  11. Open Access Serials: the High Dilution Research case. Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Publicações de acesso aberto: o caso da pesquisa em altas diluições

    Carlos Renato Zacharias

    2008-09-01

    ático, revisado por pares e de fácil acesso, capaz de alcançar parâmetros de alto impacto sem perder seu foco, onde os marcos de referência e conceitos teóricos possam ser apresentados e intensamente discutidos, abarcando do experimental ao teórico, pesquisa básica e aplicada, pesquisas clínicas, históricas e sociológicas. As características do sistema aberto se correspondem adequadamente com os requerimentos de um periódico para a comunidade ligada às altas diluições. Igualmente, o meio eletrônico permite divulgar textos e gráficos de maior tamanho, filmes, entrevistas, áudio e outros tipos de formatos multimedia. Por esse motivo, um periódico científico de acesso aberto dedicado às altas diluições seria muito bem recebido pela comunidade internacional. Palavras-chave: Acesso aberto, altas diluições, periódicos online.   Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Resumen La publicación de acceso abierto parece ser el nuevo paradigma en publicación científica, representando una tendencia creciente en todos los segmentos de la sociedad. En particular, nos interesa la aplicación de este modelo en la investigación de altas diluciones. Tal área multidisciplinar está abierta a especialistas de todas las áreas del saber, necesitando aún ensayos y modelos experimentales, así como abordajes teóricos. Sin embargo, estos investigadores deben ser reunidos en torno de un periódico temático, revisado por pares y de fácil acceso, capaz de alcanzar parámetros de alto impacto sin perder su foco, adonde los marcos de referencia y conceptos teóricos puedan ser presentados e intensamente discutidos, abarcando desde lo experimental a lo te

  12. Análise fluido-dinâmica do escoamento em ensaio de permeabilidade ao ar de argamassas preparadas com cimento Portland de alto-forno Fluid-dynamic analysis of the flow in air permeability measurement of mortars prepared with blast-slag furnace Portland cement

    V. M. Pereira

    2008-06-01

    Full Text Available O estudo dos fenômenos fluido-dinâmicos de escoamento em meios porosos tem sido de grande interesse por diversas áreas das ciências, de forma a se avaliar não só a permeabilidade do material, mas também analisar o comportamento do fluido permeante quando no interior destes materiais. Tratando-se de compósitos à base de cimento, a mensuração da permeabilidade torna-se fundamental para que sua durabilidade possa ser estimada, pois é a permeabilidade que controla a taxa de ingresso e movimentação de agentes deletérios no interior destes materiais. Dessa forma, diversas metodologias e equacionamentos matemáticos têm sido utilizados para prever a permeabilidade de materiais à base de cimento. No entanto, várias discrepâncias e disparidades nos resultados têm sido encontradas. Dentre as metodologias empregadas para mensurar a permeabilidade de meios porosos, encontra-se a desenvolvida por Thenoz, a qual tem demonstrado bons resultados em materiais à base de cimento. Dessa forma, este trabalho visa, por meio de ensaio de permeabilidade ao ar, realizado de acordo com a metodologia de Thenoz, avaliar o comportamento fluido-dinâmico do ar durante o ensaio de permeabilidade em argamassas. Para isto, foram utilizadas argamassas preparadas com dois tipos de cimento Portland (CP II E - 32 e CP III - 32, duas relações água/cimento (0,5 e 0,6 e ensaiadas em idades de 14 e 28 dias. Por meio dos resultados obtidos foi possível observar que durante o escoamento a compressibilidade do ar pode ser ignorada e o regime de escoamento pode ser considerado como laminar, demonstrando que a metodologia proposta por Thenoz e o equacionamento matemático empregado pode resultar em coeficientes de permeabilidade ao ar confiáveis, pois fenômenos e considerações que poderiam influenciar neste tipo de escoamento podem ser negligenciados.Fluid-dynamic phenomena study in porous media flow has been of great interest for diverse areas of sciences

  13. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  14. Análise de vinte genótipos de sorgo (Sorghum bicolor (L.) Moench), de portes médio e alto, pertencentes ao ensaio nacional

    Pesce Domingos Marcelo Cenachi; Goncalves Lúcio Carlos; Rodrigues José Avelino Santos; Rodriguez Norberto Mario; Borges Iran

    2000-01-01

    Os vinte genótipos de sorgo estudados foram cultivados e ensilados aos 104 dias de idade, em estádio de grão pastoso, em silos de laboratório de "PVC", com 10 cm de diâmetro e 40 cm de comprimento. Os silos foram abertos aos 150 dias após a ensilagem. O delineamento adotado foi o inteiramente casualizado. No material estudado (verde e ensilado), foram determinados os valores de fibra em detergente neutro (FDN), fibra em detergente ácido (FDA), hemicelulose, celulose, lignina, cinzas totais, m...

  15. MINERÍA A CÉU ABERTO: OS EMBATES DA COMUNA AFRODESCENDENTE PLAYA DE ORO, ESMERALDAS - EQUADOR

    Janaina Lobo

    2014-01-01

    Antes de iniciar a narrativa sobre o caso da minería a céu aberto e seus efeitos na Comuna afrodescendente de Playa de Oro, eu gostaria de fazer alguns breves apontamentos sobre a eleição do lugar dessa pesquisa. Ou melhor, gostaria de situar o leitor nessa incursão etnográfica pelo Equador. Explico essa escolha: não é por acaso o meu deslocamento para uma comunidade negra na parte setentrional deste país que sequer faz fronteira com o Brasil. Por pelo menos dez anos eu estive envolvida entre...

  16. REGULARIDADE NO PAGAMENTO DE DIVIDENDOS E GOVERNANÇA CORPORATIVA: ESTUDO EM COMPANHIAS DE CAPITAL ABERTO LISTADAS NA BM&FBOVESPA

    Ramon Kael Benassi Bachmann

    2012-08-01

    Full Text Available O objetivo deste estudo é verificar qual a relação entre nível de governança corporativa e regularidade do pagamento de dividendos das companhias de capital aberto listadas na BM&FBOVESPA, entre 2001 e 2010. Empresas listadas na bolsa compuseram três amostras, segregadas conforme (i pagamento de dividendos a acionistas ordinários, (ii preferenciais ou (iii dividendos totais pagos pela companhia. Para representar regularidade admitiu-se como métrica os coeficientes de variação (CV das séries de pagamento de dividendos das companhias, no período analisado. Para os níveis de governança corporativa foram atribuídas duas métricas: uma simples (NG, atribuindo 1 ponto por ano de enquadramento em algum dos níveis, o que considera-os em termos de tempo de enquadramento; e outra ponderada (NGP, atribuindo 1 ponto por ano de enquadramento no Nível 1 (N1, 2 pontos por ano no Nível 2 (N2 e 3 pontos por ano no Novo Mercado (NM, considerando tempo de enquadramento no nível de governança e tipo de nível. Na análise dos dados utilizou-se correlações de Pearson para verificar qual o tipo de relação entre CV e NG e entre CV e NGP, ambos para as 3 amostras. Os resultados indicam que o tempo de enquadramento em qualquer nível de governança, exceto o tradicional, tem relação inversa com regularidade de pagamento de dividendos, reafirmando possíveis gerenciamentos de resultados (income smoothing em companhias não enquadradas ou com pouco tempo de enquadramento. Constatou-se também que o tipo de nível de governança corporativa guarda relação apenas com a regularidade de pagamento de dividendos aos acionistas preferenciais.

  17. Produção e tolerância ao pendoamento de alface-romana em diferentes ambientes

    Cárita Rodrigues de Aquino

    2014-08-01

    Full Text Available O experimento foi conduzido na área experimental da Universidade do Estado de Mato Grosso, localizada no município de Cáceres-MT, no período de maio a agosto de 2011, com o objetivo de avaliar a influência de diferentes ambientes e espaçamentos na produção e tolerância ao pendoamento de alface-romana cultivar Sophia. O delineamento experimental foi em blocos casualizados, arranjados em esquema fatorial 2 x 5, composto por dois espaçamentos (30 x 30 cm e 25 x 25 cm e cinco ambientes de cultivo (tela de sombreamento 30 e 50% , tela termorrefletora de 30 e 50% e ambiente aberto, perfazendo 10 tratamentos com quatro repetições cada. As parcelas experimentais foram constituídas por quatro linhas, com cinco plantas cada, totalizando 20 plantas por parcela. Consideraram-se como área útil para avaliação da produção as seis plantas centrais. As parcelas em que foi utilizado o espaçamento 30 x 30 cm apresentavam 1,8 m² cada, e as com o espaçamento 25 x 25 cm, 1,5 m² cada. As mudas foram transplantadas com 26 dias e a colheita realizada aos 46 dias após o transplantio. Observou-se que o espaçamento de 25 x 25 cm entre plantas e o ambiente aberto proporcionaram maior produtividade da alface-romana. Porém, o tempo para pendoamento das plantas no ambiente aberto foi menor que nos ambientes com as telas de sombreamento ou termorrefletora.

  18. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    Anna Luiza de Fátima Pinho Lins Gryschek; José Claudio Domingos; Cássio Rogério Dias Lemos Figueiredo; Lúcia Yasuko Izumi Nichiata; Leonida Maria Osório

    2000-01-01

    Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como ne...

  19. Metodologia para validar IPS’s de código-fonte aberto

    Trentin, Marco Antônio S; Linden, Gustavo S; Zandoná, Tomás Damo

    2004-01-01

    O presente trabalho tem por objetivo descrever uma metodologia para realizar testes com ferramentas IPS (Intrusion Prevention Systems). Essas ferramentas são mecanismos que são implementados como gateways (in-line) em uma rede de computadores para receber, analisar e encaminhar o tráfego para o seu destino. A análise é feita através da procura por pacotes que contenham assinaturas de ataques aos computadores da rede. Como se trata de uma nova tecnologia é necessário determinar métricas para a...

  20. Qualidade do ar interior em instalações desportivas

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  1. Exigências nutricionais da grápia ao fósforo e enxofre em Argissolo Vermelho distrófico arênico: efeito da adubação no crescimento Nutritional demand of grápia to phophorus and sulfur in paleaudalf soil: fertilization effects on growth

    Evandro Luiz Missio

    2004-08-01

    Full Text Available A grápia (Apuleia leiocarpa Vog. Macbride é uma espécie de grande interesse madeireiro, encontrando-se, atualmente, bastante dizimada devido à exploração extrativista, sem haver reposição através de reflorestamento. O objetivo deste trabalho foi determinar os níveis ótimos de adubação de fósforo e enxofre no crescimento de plantas jovens de grápia. As plantas foram cultivadas em vasos contendo 3,5kg de solo Argissolo Vermelho distrófico arênico, sob condições de casa de vegetação não climatizada. O delineamento experimental foi o inteiramente casualizado com seis repetições. Foram avaliados 16 tratamentos em esquema bifatorial completo (4x4, representados pela combinação de quatro doses de P (0, 60, 120 e 180mg kg-1 e quatro de enxofre (0, 10, 20 e 30mg kg-1. A análise do crescimento das plantas foi realizada mensalmente através da altura da planta, diâmetro do caule e número de folhas remanescentes. Aos 130 dias após a emergência das plantas, avaliaram-se ainda o número de folhas caídas, matéria seca das folhas, caule, raízes e total da planta e a relação entre a matéria seca das raízes e da parte aérea. A produção de matéria seca total das plantas jovens de grápia respondeu positivamente à adubação conjunta de P e S, com dose de máxima eficiência técnica estimada de, respectivamente, 204 e 16mg kg-1 de solo. A adubação fosfatada na dose igual ou acima de 120mg kg-1 de solo induziu o aparecimento de clorose foliar típica da deficiência de Fe. A alta disponibilidade de P no solo favoreceu o crescimento da parte aérea em detrimento das raízes.Grápia (Apuleia leiocarpa Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to determine the optimum levels of phosphorus and sulfur fertilization on the initial growth of grápia. Grápia plants were cultivated in pots containing 3.5kg of a Paleudalf soil, under unclimatized glasshouse

  2. Correlação entre a necrose de frutos associada ao Colletotrichum spp. com as características frutos por nó e produtividade entre genótipos de café arábica Correlation between fruit necrosis associated to Colletotrichum spp. with the fruits per node and yield traits of arabic coffee

    Gustavo Hiroshi Sera

    2008-02-01

    Full Text Available O fungo Colletotrichum spp. vem sendo associado à graves perdas para a cafeicultura brasileira. Objetivou-se neste trabalho verificar a existência de relação entre a variável necrose de frutos associada ao Colletotrichum spp. ("COL" com a quantidade média de frutos por nó produtivo ("FN" e com a produção ("PRD" em genótipos de café arábica. O ensaio de campo foi realizado no IAPAR (Londrina, PR, Brasil em dezembro de 2004 e em cafeeiros com três anos de idade. A variável "COL" foi avaliada atribuindo-se notas de 1 a 5, onde 1 representam plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação visual subjetiva da produção foi estimada em litros de frutos em estádio cereja, por planta. A correlação de Pearson foi estimada para avaliar a existência de associações entre as variáveis. Foram observadas correlações positivas e significativas a 1 % entre "COL" e "FN" e entre "COL" e "PRD". A necrose de frutos foi mais intensa em cafeeiros com mais produção e com mais frutos por nó produtivo. Sugere-se que a avaliação da resistência de campo à necrose dos frutos associada à presença de Colletotrichum spp. seja realizada em cafeeiros com alta produção e com alta quantidade de frutos por nó produtivo.Different fungi species of genus Colletotrichum has been associated with losses to the Brazilian coffee crop. The aim of this research was to evaluate the association between the variable fruit necrosis associated to Colletotrichum spp. ("COL" with the fruits per productive node average ("FN" and between "COL" and the yield ("PRD" in Coffea arabica L. genotypes. The field assay was evaluated at IAPAR (Londrina, PR, Brazil, in December 2004 and on coffee trees with three years old. The "COL" variable was evaluated attributing scores from 1 to 5, where score 1 represents plants

  3. Aprendizagem ao ar livre: o ensino da física e da química no 3º ciclo e a formação do indivíduo através do projeto "Escola na natureza"

    Gomes, Raquel das Chagas Franco de Abreu

    2014-01-01

    Este relatório apresenta uma descrição detalhada do percurso académico e da experiência profissional da autora, ao longo de doze anos, enquanto docente de Física e de Química. Descreve-se a prática letiva desenvolvida, atividades e projetos dinamizados, cargos desempenhados e a formação realizada. Procede-se, ainda, ao desenvolvimento de um tema relacionado com o papel assumido pelo professor na dinamização de um ambiente de aprendizagem saudável e proveitoso. Recorre-se à experiê...

  4. Uma análise da correlação entre o EVA® e o MVA® no contexto das empresas brasileiras de capital aberto Correlation between Economic Value Added and Market Value Added for publicly owned Brazilian companies

    José Odálio dos Santos

    2005-03-01

    Full Text Available Este artigo trata do tema da criação de valor, da forma como é medida pelo EVA® (Valor Econômico Adicionado e pelo MVA® (Valor de Mercado Agregado, duas metodologias desenvolvidas no final dos anos 80 pela empresa americana de consultoria Stern Stewart & Co. O EVA® é definido como a diferença entre o lucro operacional líquido depois de impostos e o custo do capital investido na empresa, enquanto o MVA® é determinado pela diferença entre o valor de mercado da empresa e o capital total nela investido. Um estudo realizado por G. Bennett Stewart III, que idealizou essas metodologias juntamente com o seu sócio Joel M. Stern, encontrou uma forte correlação entre o EVA® e o MVA®. Visando averiguar se tal resultado se aplica também ao caso das empresas brasileiras, os autores deste artigo realizaram uma pesquisa semelhante, baseada numa amostra formada por empresas de capital aberto cujas ações foram negociadas na Bovespa (Bolsa de Valores de São Paulo durante o período de 1996 a 2001.This article deals with value creation as measured by Economic Value Added (EVA® and Market Value (MVA® which are methods developed by an American consultant, Stern Stewart & Co, in the late l980's. Economic Value Added is defined as the difference between net operating profit after taxes and the cost of capital invested in a company, while Market Value Added is the difference between market value and the total capital invested in a company. G. Bennett Stewart III, who conceived this approach together with his partner Joel M. Stern, found a strong correlation between Economic Value Added and Market Value Added. Our research investigated whether this also applies to a sample of publicly owned Brazilian companies traded on the São Paulo Stock Exchange between 1996 and 2001.

  5. Superdeformation of Ar hypernuclei

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  6. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L.) com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.)

    Rilvaynia Dantas Soares; Modesto Antonio Chaves; Arienilmar Araujo Lopes da Silva; Marcondes Viana da Silva; Betânia dos Santos Souza

    2007-01-01

    Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC), em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s) sobre o teor de linalol do manjericão (Ocimum basilicum L). Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, u...

  7. Custo-utilidade do tratamento do glaucoma primário de ângulo aberto no Brasil

    Ricardo Augusto Paletta Guedes

    2016-02-01

    Full Text Available RESUMO Objetivo: Determinar a estratégia mais custo-efetiva para o tratamento do glaucoma primário de ângulo aberto em fase inicial, comparando-se as seguintes alternativas: observação, tratamento clínico ou tratamento com laser. Métodos: Por meio de um modelo de Markov, sob a perspectiva do Sistema Único de Saúde (SUS e um horizonte da expectativa de vida média da população brasileira. Comparou-se a razão de custo-utilidade incremental (ICUR entre 3 alternativas de tratamento, assim como seus custos e o ganho em qualidade de vida, medido em QALY (Quality-adjusted life years. Resultados: A ICUR do tratamento inicial com laser e do tratamento inicial com colírios, em relação a não tratar foi de R$ 2.811,39/QALY e R$ 3.450,47/QALY, respectivamente. Ambas as estratégias foram custo-efetivas, com uma discreta vantagem para o tratamento a laser. Esta diferença diminui ainda mais quando se aumenta a idade de entrada no modelo. As duas alternativas propiciaram ganhos significativos de qualidade de vida (em torno de 2,5 QALYs para o tratamento com laser e de 5,0 QALYs para o tratamento com colírios. Conclusão: Tanto o tratamento primário com trabeculoplastia a laser quanto com medicações foram custo-efetivos e proporcionaram ganhos reais de qualidade de vida quando comparados com o não tratamento do GPAA.

  8. Evidências sobre as estruturas de propriedade de capital e de voto das empresas de capital aberto no Brasil

    Dante Mendes Aldrighi

    2007-06-01

    Full Text Available Este artigo analisa a evolução da estrutura de propriedade de capital e de votos das empresas de capital aberto no Brasil no período 1997-2002. Sua principal contribuição reside em estimar a magnitude dos direitos de voto e de fluxo de caixa do acionista último com a maior parcela do capital votante de cada empresa. Examinam-se, também, as fontes da discrepância entre direitos de votos e de fluxo de caixa, avaliando-se a importância relativa da emissão de ações preferenciais sem direito a voto, acordos de votos, estruturas piramidais de propriedade, e posse cruzada de ações. A base de dados compreende 4478 relatórios que as empresas, cumprindo uma exigência legal, submeteram à CVM nesse período.This paper focuses on the ownership and voting structures of limited liability companies in Brazil over the period 1997-2002. Its main contribution lies in measuring the magnitude of deviations between control rights and cash-flow rights for the ultimate shareholder with the largest voting rights. Furthermore, it pinpoints how these discrepancies are generated, evaluating the relative importance of the issuance of preferred stocks with no voting rights, voting agreements, pyramidal arrangements of ownership, and cross-shareholdings. The data set embraces 4,478 reports that companies, complying with a mandatory requirement, filed to the CVM over that period.

  9. do parasita ao ecossistema

    Balazeiro, Clementina Furtado

    2011-01-01

    A triquinose é uma zoonose parasitária, cujo agente causal, um nemátode, pertence ao género Trichinella. Foram já identificadas e caracterizadas várias espécies pertencentes a este género, como T. spiralis, T. nativa, T. britovi, T. nelsoni, T. murreli, T. pseudospiralis, T. papuae e T. zimbabwensis bem como alguns genótipos, T6, T8, T9, e T12. A triquinose é uma doença transmitida por carnivorismo entre os seus hospedeiros. No Homem, a principal fonte de infecção é o consumo de carne infecta...

  10. Do conhecimento ao saber

    Almeida, Maria Cristina Pereira dos Santos

    2013-01-01

    O relatório surge como documento final do percurso iniciado aquando do ingresso no 4º Curso de Pós – Licenciatura em Enfermagem Médico-Cirúrgica da Universidade Católica do Porto, no ano letivo 2010/2011. No decurso deste trabalho pretendemos fazer uma súmula das experiências que este período de formação nos proporcionou, dando visibilidade à unidade curricular estágio, pela sua importância na aquisição de competências na área da Enfermagem Médico-Cirúrgica, na abordagem ao ...

  11. ARS Culture Collection

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  12. ARS Biodiesel Research Initiatives

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  13. Das políticas ao cotidiano: entraves e possibilidades para a educação do campo alcançar as escolas no rural De las políticas a la vida cotidiana: obstáculos y oportunidades para que la educación del campo alcance las escuelas rurales From policies to everyday life: barriers and opportunities for country education to access the rural schools

    Ludmila Oliveira Holanda Cavalcante

    2010-09-01

    Full Text Available O presente artigo visa a trazer para o debate os questionamentos em torno da viabilidade das políticas de educação do campo nos territórios do rural brasileiro. Entre a política de direitos e a cultura de direitos, vale a reflexão de como a "educação do campo", ao alcançar o universo retórico e legalista das políticas educacionais brasileiras já no século XXI, pode de fato ser apropriada pelos (significativos pedaços do rural que não se encontram em "movimento" (este rural ainda sob a lógica da produção capitalista, muitas vezes inerte ao mundo de lutas e labutas dos movimentos sociais em diferentes cantos do Brasil nos últimos vinte anos. O texto aponta para a necessidade de aguçar o debate sobre questões importantes que circundam a educação do rural que se transforma em "campo" e que, ironicamente, pode estar ainda longe de ser implementada entre a noção de um campo ou outro.Este artículo pretende aportar al debate de los planteos relacionados con la viabilidad de las políticas de educación del campo en las zonas rurales de Brasil. Entre la política de derechos y la cultura de derechos vale la reflexión de cómo la "Educación del campo", al alcanzar el universo retórico y legalista de la política educativa brasileña ya en el siglo XXI, puede, de hecho, ser apropiada por partes (significativas de la población rural que no están en "movimiento" (este mundo rural, todavía bajo la lógica de la producción capitalista, muchas veces, ajeno al mundo de los afanes y las luchas de los movimientos sociales en los distintos rincones de Brasil en los últimos veinte años . El texto señala la necesidad de estimular el debate sobre cuestiones importantes de la educación de la zona rural que se convierte en "campo" y que, irónicamente, aún puede estar lejos de ser implementada entre la noción de un campo u otro.This present article aims to discuss the viability of country education policies at the rural territories

  14. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L. com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.

    Rilvaynia Dantas Soares

    2007-08-01

    Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were

  15. Grau de exposição a praguicidas organoclorados em moradores de aterro a céu aberto Levels of exposure to organochlorine pesticides in open-air dump dwellers

    Eladio Santos Filho

    2003-08-01

    Full Text Available OBJETIVO: Estimar o grau de exposição interna aos praguicidas organoclorados (POP dos moradores de um atêrro a céu aberto. MÉTODOS: Estudo observacional, de aferição simultânea e controlado, cujo fator de estudo foi residir em área contaminada por POP e o efeito foi a concentração sanguínea dessas substâncias. A população de estudo foi de 238 pessoas residentes em um aterro a céu aberto (Pilões, no município de Cubatão, SP; e a população de controle ficou dimensionada em 258 pessoas, também residentes no mesmo município (Cota 200. Foram analisados os praguicidas HCB, p-p'DDT, p-p'DDE, p-p'DDD, o-p'DDT, a HCH; b HCH; g HCH; Aldrin; Dieldrin; Endrin; Heptaclor; Heptaclor-epoxi e Mirex. RESULTADOS: Os teores médios sangüíneos de HCB em Pilões foram de 4,66 µg/L, 155 vezes maior que a média na Cota 200 (0,03 µg/L. Em Pilões, os teores médios de DDT total foram de 3,71 µg/L, duas vezes maior do que na Cota 200 (1,85 µg/L e o HCH total apresentou concentrações sangüíneas seis vezes maiores em Pilões, 0,84 µg/L, contra 0,13 µg/L. CONCLUSÕES: Evidenciou-se associação positiva entre residir em Pilões e apresentar teores sangüíneos de POP, com risco muitas vezes maior quando comparado a localidades sem a presença desses contaminantes.OBJECTIVE: To estimate the degree of internal exposure to organochlorine pesticides (persistent organic pollutants, POP among inhabitants of an open-air dump. METHODS: This was an observational study with simultaneous measurement and control, in which the criterion for subjects was that they dwelled in an area contaminated by POP and the effect of such contamination was the concentration of such substances into the blood. The study population consisted of 238 people living on an open-air dump in Pilões, in the municipality of Cubatão, SP, Brazil, and the control population was formed by 258 people, also resident in that municipality, in the Cota 200 district. The following

  16. Fatores associados ao parto vaginal em gestantes de alto risco submetidas à indução do parto com misoprostol Factors associated with vaginal delivery in high-risk pregnant women submitted to labor induction with misoprostol

    Zuleika Studart Sampaio; Carlos Augusto Alencar Júnior; Francisco Edson de Lucena Feitosa; Melania Maria Ramos Amorim

    2004-01-01

    OBJETIVOS: determinar os principais fatores associados ao parto transpelvino em gestantes de alto-risco submetidas à indução do parto com misoprostol vaginal (50 µg). MÉTODOS: trata-se da análise secundária de um ensaio clínico aberto, não randomizado, incluindo 61 gestantes de alto-risco internadas na Enfermaria de Patologia Obstétrica da Maternidade Escola Assis Chateaubriand, em Fortaleza (CE). Todas tinham idade gestacional de mais de 37 semanas, feto único com boa vitalidade e escores de...

  17. Ars Electronica tulekul / Rael Artel

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  18. ARABIC LIGHT STEMMER (ARS

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  19. Práticas de responsabilidade socioambiental nas empresas de capital aberto de Santa Catarina listadas na BM&FBOVESPA = Social responsibility practices in open capital companies from Santa Catarina listed on BM&FBOVESPA

    Daniela Di Domenico

    2015-08-01

    Full Text Available Este artigo tem como objetivo identificar as práticas de ações de responsabilidade social corporativa das sociedades anônimas de capital aberto de Santa Catarina listadas na BM&FBovespa. A justificativa da pesquisa está atrelada à influência da evidenciação dessas informações para os investidores, pesquisadores e usuários das informações ambientais. Quanto aos procedimentos metodológicos o estudo caracteriza-se como exploratório quanto aos objetivos, documental em relação aos procedimentos e a abordagem do problema é predominantemente qualitativa. As empresas que fazem parte da amostra são: BRF S.A., BUETTNER S.A., CASAN, KARSTEN S.A e WEG S.A. Foram várias as práticas de responsabilidade social e ambiental evidenciadas, mas se pode identificar que todas têm como objetivo divulgar a empresa, além do objetivo principal da ação realizada. É possível destacar as principais práticas como sendo as ações e cuidados para o consumo consciente da água e energia, usando fontes que não sejam prejudiciais ao meio ambiente. Outra ação em destaque é o cuidado com a destinação dos resíduos sólidos e líquidos, gerados nos processos operacionais das empresas. A preocupação com a poluição da atmosfera também é evidente, por ser um dos principais problemas ambientais na atualidade.This article aims at identifying the practices of corporate social responsibility of corporations with open capital of Santa Catarina listed BM&FBovespa. The justification of this research is related to the influence of the disclosure of information for the investors, researchers and users of environmental information. In the methodological procedures, the study is characterized as exploratory as its goals, documental regarding the procedures and its approach to the problem is predominantly qualitative. The companies included in the sample are: BRF SA, BUETTNER SA, CASAN, KARSTEN SA and WEG SA. There were several social and environmental

  20. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  1. Geochronology and thermochronology by the 40Ar/39Ar method

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  2. Sistema aberto ou fechado de nutrição enteral para adultos críticos: há diferença? Open versus closed enteral nutrition systems for critically ill adults: is there a difference?

    Stella Marys Rigatti Silva

    2012-04-01

    Full Text Available OBJETIVO: Comparar o volume, calorias totais e proteínas recebidos pelos pacientes críticos quando utilizada nutrição enteral (NE por sistema aberto (SA e sistema fechado (SF; identificar os principais motivos para interrupção da NE. MÉTODOS: Estudo de coorte em que foram acompanhados adultos internados no Centro de Terapia Intensiva (CTI em dois períodos: em novembro de 2009, quando se adotava SA de NE para a totalidade dos pacientes (n = 85; e entre outubro de 2010 e abril de 2011, quando foi utilizado SF de NE (n = 170. Foram utilizados testes paramétricos e não paramétricos para comparação das variáveis respeitando-se sua distribuição. RESULTADOS: Os grupos assemelharam-se quanto às características clínicas e demográficas. Diferenças de mínima magnitude matemática e de nenhuma relevância clínica foram observadas entre os grupos: mais calorias/quilo foram prescritas ao grupo SA (p OBJECTIVE: To compare the volume, total calories, and protein received by critically ill patients between open and closed enteral nutrition (EN systems and identify the main reasons for EN discontinuation. METHODS: A cohort study in which adult patients admitted to the intensive care unit (ICU were followed-up in two periods: throughout November 2009 with all patients (n = 85 receiving EN using the open system (OS group; and from October 2010 to April 2011 with patients (n = 170 receiving EN using the closed system (CS group. Parametric and nonparametric tests were used to compare the variables, taking into account their distribution. RESULTS: Demographic and clinical characteristics were similar in both groups. There were minor differences with no statistical significance between groups: more calories/kg were prescribed to the OS group (p < 0.001, and a higher volume (mL/kg, p = 0.002 and protein (g/kg, p = 0.001 were prescribed to the CS group. Fasting, enteral feeding or gastrointestinal problems, and performance of procedures and ICU

  3. Teste de desencadeamento aberto no diagnóstico de alergia à proteína do leite de vaca Open challenge for the diagnosis of cow's milk protein allergy

    Fernanda Ferreira Correa

    2010-04-01

    Full Text Available OBJETIVO: Relatar os resultados de testes de desencadeamento aplicados em crianças alimentadas com dieta de exclusão das proteínas do leite de vaca. DESCRIÇÃO: Estudo transversal que avaliou testes de desencadeamento oral aberto, com leite de vaca, realizados sob supervisão em ambiente hospitalar por 2,5 horas e ambulatoriamente por 30 dias quando não ocorreu reação imediata. Foram incluídos 121 pacientes, com idades entre 4 e 95 meses. O teste de desencadeamento com leite de vaca foi positivo em 28 (23,1% pacientes. Manifestação clínica de alergia ao leite de vaca diferente da apresentada por ocasião da suspeita diagnóstica ocorreu em 12 (42,9% pacientes com desencadeamento positivo. O desencadeamento positivo foi mais frequente (p = 0,042 nos pacientes alimentados com fórmulas extensamente hidrolisadas ou de aminoácidos (30,3% quando comparados com os alimentados com outras dietas de exclusão (14,5%. CONCLUSÃO: O teste de desencadeamento permitiu que fosse suspensa a dieta de exclusão de grande parte dos pacientes.OBJECTIVES: To report the results of open challenge tests performed in children fed with cow's milk-free diet. DESCRIPTIONS: Cross-sectional study evaluating cow's milk open challenge performed under supervision in a hospital setting during 2.5 hours and ambulatory follow-up for 30 days when no immediate reaction occurred. One hundred and twenty-one patients were included, with ages between 4 and 95 months. Cow's milk open challenge tests were positive in 28 patients (23.1%. A clinical manifestation of cow's milk allergy different from the one presented at diagnosis occurred in 12 (24.9% patients with positive challenge. Positive challenge was more frequent (p = 0.042 in patients fed with extensively hydrolyzed formulae or amino acid-based formulae (30.3% when compared to those fed with other exclusion diets (14.5%. CONCLUSION: Open challenge allowed the interruption of exclusion diet in a significant proportion

  4. Criação intensiva de suínos em confinamento ou ao ar livre: estudo meta-analítico do desempenho zootécnico nas fases de crescimento e terminação e avaliação de carcaça e carne no Longissimus dorsi Intensive pig production in confinement or outdoor systems: a meta-analytical study of the production performance in the growing and finishing phases and carcass and meat evaluation from the Longissimus dorsi

    Alice Bogoni Demori

    2012-07-01

    Full Text Available Uma meta-análise foi realizada para avaliar o desempenho e a qualidade de carcaça e carne de suínos em função do sistema de alojamento nas fases de crescimento/terminação. Foram selecionadas publicações indexadas com resultados de experimentos comparando variáveis de desempenho e de pós-abate de suínos alojados em sistemas intensivos convencionais ou ao ar livre. A base de dados contemplou 27 artigos publicados entre 1997 e 2009. Ao total, foram considerados 2.985 animais e 701 médias na análise de dados. A meta-análise foi realizada através de duas análises sequenciais: gráfica e de variância-covariância. O sistema de criação de suínos ao ar livre aumentou em 9% (P0,05 pelo sistema de alojamento dos suínos. Concluiu-se que o sistema de criação influencia no desempenho dos suínos, mas não interfere nas características de carcaça e carne estudadas.A meta-analysis was carried out to study performance and characteristics of carcass and meat in pigs in function of housing system during the growing/finishing period. Indexed publications with results of experiments comparing performance and post-slaughter variables of pigs housed in outdoor or conventional intensive systems were selected. In total, 2.985 animals and 701 averages were considered in the data analysis. Meta-analysis followed two sequential analyses: graphic and variance. The outdoor productive system increased in 9% (P0.05 by the housing system. It is concluded that the housing system influences the pig performance, but does not interfere in characteristics of carcass and meat.

  5. Performance of cultivars of arugula under shade screens and open field /Desempenho de cultivares de rúcula sob telas de sombreamento e campo aberto

    Sérgio Batista Silva de Souza

    Full Text Available Considering the increasing economic importance and due to the lack of technical information for growing arugula in tropical regions, it was evaluated the performance of arugula cultivated under different shade screens and at open field. Eight treatments were evaluated in a 2x4 factorial design, with two cultivars (Cultivada and Folha Larga x four crop environments (open field, greenhouse shading with 30%, 40% and 50%, with four replications in randomized blocks. The evaluated were plant height, leaf number, fresh and dry matter of the above ground part. Cultivars Folha Larga and Cultivada, showed satisfactory yield: that production in the open field showed acceptable values, showing viable cultivation in the winter in Cáceres-MT, even in warm temperatures, especially for early harvest at around 37 days after sowing. However, cultivation of arugula is favored using 50% shade screen, which can increase the production about 43%.Pelo crescente aumento da importância econômica e perante a escassez de informações técnicas para o cultivo da rúcula em regiões tropicais, avaliou-se o desempenho de rúcula cultivada sob diferentes telados de sombreamento e a campo aberto. Foram avaliados oito tratamentos em esquema fatorial 2x4, sendo duas cultivares (Cultivada e Folha Larga x quatro ambientes de cultivo (campo aberto, telado com sombrite 30%, 40% e 50% com quatro repetições, em blocos casualizados. As características avaliadas foram altura da planta, número de folhas e massas de matéria fresca e de matéria seca parte aérea. Foi observado que as cultivares Folha Larga e Cultivada apresentaram produção satisfatória: a produção em campo aberto apresentou valores aceitáveis, mostrando-se viável o cultivo no período de inverno em Cáceres-MT, mesmo sob temperaturas cálidas, principalmente para colheitas antecipadas por volta dos 37 dias após a semeadura. Porém, o cultivo de rúcula é favorecido sob tela preta 50%, que pode

  6. Geological Dating by 40 Ar - 39 Ar method

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  7. 40Ar/39Ar age calibration against counted annuallayers

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  8. Progressão atípica de perda visual em paciente com glaucoma primário de ângulo aberto

    Marcelo Mendes Lavezzo

    2014-01-01

    Full Text Available A dolicoectasia da artéria carótida interna (ACI é uma condição rara que pode ser acompanhada de manifestações neuro-oftalmológicas, como perda da acuidade e alteração do campo visual decorrente da compressão do nervo óptico (NO. O objetivo é relatar um caso de paciente do sexo masculino, 67 anos, portador de glaucoma primário de ângulo aberto (GPAA com evolução atípica, assimetria de escavação, palidez da rima do NO à esquerda, devido à neuropatia óptica compressiva à esquerda, por segmento dolicoectásico da ACI. O diagnóstico foi baseado na história clínica, aspecto do NO e exames de neuroimagem.

  9. Recursos Educacionais Abertos (REA: modelos para localização e adaptação / Open educational resources (OER: models for adaptation and localization

    Tel Amiel

    2011-04-01

    Full Text Available Neste artigo apresentamos questões relativas à localização e adaptação de recursos educacionais digitais. Começamos com uma discussão sobre objetos de aprendizagem (OA e recursos educacionais abertos (REA. Apresentamos três estratégias que podem auxiliar designers, professores e usuários a refletir sobre a possibilidade de reuso, localização, e adaptação cultural de recursos educacionais digitais.AbstractIn this article we present concerns regarding localization of digital educational resources. We begin with a discussion regarding learning objects (LO and open educational resources (OER. Finally we present three strategies that can help designers, teachers, and users to think about the reuse, localization, and cultural repurposing of digital educational resources.

  10. A POTÊNCIA DIDÁTICA DOS RECURSOS EDUCACIONAIS ABERTOS PARA A DOCÊNCIA NA CONTEMPORANEIDADE. THE DIDACTICAL FRUITFULNESS OF OPEN EDUCATIONAL RESOURCES FOR TEACHING NOWADAYS

    Lucila Pesce

    2013-01-01

    O presente artigo discute sobre a fecundidade didática dos recursos educacionais abertos (REA), para a docência na contemporaneidade, trazendo uma reflexão, a partir da contextualização política e cultural, em consonância com a necessária leitura crítica das tecnologias da informação e comunicação (TIC). Inicia com um panorama do atual contexto político brasileiro sobre formação de professores para o uso pedagógico das TIC. Prossegue com um brevíssimo delineamento de alguns dispositivos digit...

  11. ANALYSIS OF THE RELATIONSHIP BETWEEN DISCLOSED VOLUME OF INVESTMENT IN INFORMATION SYSTMES AND MARKET VALUE OF OPEN CAPITAL BRAZILIAN COMPANIES IN THE ELECTRIC ENERGY SECTOR ANÁLISE DA RELAÇÃO ENTRE VOLUME DE INVESTIMENTOS EM SISTEMAS DE INFORMAÇÃO DIVULGADOS E VALOR DE MERCADO DAS EMPRESAS BRASILEIRAS DE CAPITAL ABERTO DO SETOR DE ENERGIA ELÉTRICA

    Cássia Maria Gurgel Marinho Fernandes

    2007-07-01

    2004. O investimento em sistemas de informação foi identificado no Relatório da Administração das empresas por meio dos seguintes termos: sistemas de informação, tecnologia da informação, obras de geração,distribuição e transmissão de energia elétrica, expansão, manutenção e segurança dos sistemas, telecomunicações, comércio eletrônico, e-business, Planejamento de Recursos Empresariais (ERP e treinamento e desenvolvimento do profissional. A metodologia utilizada neste trabalho envolve regressões log-lineares estimadas por Ordinary Least Squares (OLS para dados em panel data, em que há uma combinação de séries temporais com dados transversais (cross-section. Foram testados os três tipos de panel data (intercepto comum ou pooled regression, efeitos fixos e efeitos aleatórios de modo a garantir robustez aos resultados. Os resultados da pesquisa corroboram a hipótese H1, de que o valor investido em sistemas de informação, divulgado nos relatórios de administração anuais das empresas brasileiras de capital aberto do setor de energia elétrica, influencia o valor de mercado destas empresas. A hipótese H2, de que a magnitude da variação desse valor está em função da variação no investimento em sistemas de informação, foi rejeitada nesta pesquisa. Palavras-chave: Sistemas de informação. Investimentos. Valor de mercado.

  12. The 38Ar(p,d)37Ar reaction

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  13. Variants in RBP4 and AR genes modulate age at onset in familial amyloid polyneuropathy (FAP ATTRV30M).

    Santos, Diana; Coelho, Teresa; Alves-Ferreira, Miguel; Sequeiros, Jorge; Mendonça, Denisa; Alonso, Isabel; Lemos, Carolina; Sousa, Alda

    2016-05-01

    Familial amyloid polyneuropathy (FAP) ATTRV30M is a neurodegenerative disorder due to point mutations in the transthyretin gene, with V30M being the commonest. FAP ATTRV30M shows a wide variation in age at onset (AO) between clusters, families and generations. Portuguese patients also show remarkable AO differences between genders. Genes found to be associated with FAP ATTRV30M pathways may act as AO modifiers. Our aim was to further explore the role of APCS and RBP4 genes and to study for the first time the involvement of sex-linked genetic modifiers - AR and HSD17B1 genes - in AO variation in Portuguese families. We collected DNA from a sample of 318 patients, currently under follow-up. A total of 18 tagging SNPs from APCS, RBP4, AR and HSD17B1 and 5 additional SNPs from APCS and RBP4 previously studied were genotyped. To account for nonindependency of AO between members of the same family, we used generalized estimating equations (GEEs). We found that APCS and RBP4 were associated with late AO. In addition, rs11187545 of the RBP4 was associated with an early AO. For the AR, in the male group three SNPs were associated with an early AO, whereas in the female group four were associated with both an early and later AO. These results strengthened the role of APCS and RBP4 genes and revealed for the first time the contribution of AR genes as an AO modifier in both males and females. These findings may have important implications in genetic counseling and for new therapeutic strategies. PMID:26286643

  14. 40Ar-39Ar geochronology and thermochronology: principles and potential

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  15. Electron scattering from 36Ar and 40Ar

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  16. Ars Poetica : [luuletused] / Mats Traat

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  17. MEMS AO for Planet Finding

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; Jung, Paul

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  18. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  19. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias

    Marcelo Souza Hadlich

    2012-10-01

    Full Text Available FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine. Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de código aberto capaz de manipular imagens DICOM de exames de angiotomografia de coronárias. MÉTODOS: Desenvolvemos e testamos o software intitulado ImageLab na avaliação de 100 exames selecionados de forma randômica por meio de um banco de dados. Foram realizadas 600 análises divididas por dois observadores utilizando o ImageLab e um outro software comercializado junto a aparelhos de tomografia computadorizada Philips Brilliance, na avaliação da presença de lesões e placas coronarianas nos territórios do Tronco da Coronária Esquerda (TCE e na Artéria Descendente Anterior (ADA. Para avaliar as concordâncias intraobservador, interobservadores e intersoftware, utilizamos concordância simples e estatística Kappa. RESULTADOS: As concordâncias observadas entre os softwares foram em geral classificadas como substancial ou quase perfeitas na maioria das comparações. CONCLUSÃO: O software ImageLab concordou com o software Philips na avaliação de exames de angiotomografia de coronárias especialmente em pacientes sem lesões, com lesões inferiores a 50% no TCE e inferiores a 70% na ADA. A concordância para lesão >70% na ADA foi menor, porém isso também é observado quando se utiliza o padrão de referência anatômico.

  20. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  1. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  2. Analysis list: AR [Chip-atlas[Archive

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  3. Analysis list: Ar [Chip-atlas[Archive

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  4. Cometas: Das Lendas aos Fatos

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  5. Estudo terapêutico aberto com sulfato de aminosidine na leishmaniose mucosa causada for Leishmania (viannia braziliensis

    Gustavo A.S. Romero

    1996-12-01

    Full Text Available No período de setembro a novembro de 1994 foram tratados 21 pacientes com leishmaniose mucosa ativa, predominantemente adultos lavradores do sexo masculino, com sulfato de aminosidine intramuscular, I6mg/kg/dia por 20 dias. Treze pacientes eram virgens de tratamento e 8 haviam sido tratados sem sucesso com Glucantime®". O diagnóstico baseou-se inicialmente em crítêrios epidemiolôgicos, clínicos e nos resultados da intrademoireação de Montenegro e a imunofluorescência indireta para anticoipos séricos antileishmânia e durante o acompanhamento nos resultados dos estudos parasitológicos. Sessenta e sete por cento dos pacientes tiveram diagnóstico parasitológico confirmado sendo a inoculação do material de biópsia das lesões em hamsters o método mais sensível. O tempo médio de acompanhamento foi de 12,6 meses. A adesão ao tratamento foi de 100%. Os efeitos colaterais foram dor no local da injeção (86%, proteinúria leve (24%, elevação do nível sérico de creatinina (5% e perda auditiva subclínica em um dos dois pacientes que realizaram audiometria. Obsevou-se cura clínica em 48% dos pacientes e a percentagem acumulada de recidiva foi de 29% (4/14pacientes durante o acompanhamento.

  6. Restrição materna de polifenóis e dinâmica ductal fetal na gestação normal: um ensaio clínico aberto

    Paulo Zielinsky

    2013-09-01

    Full Text Available FUNDAMENTOS: Recentemente demonstramos reversão da constrição ductal fetal após redução da ingesta materna de alimentos ricos em polifenóis (ARP, por sua ação inibidora da síntese das prostaglandinas. OBJETIVOS: Testar a hipótese de que fetos normais no 3º trimestre também melhoram a dinâmica ductal após restrição materna de polifenóis. MÉTODOS: Ensaio clínico aberto com 46 fetos com idade gestacional (IG > 28 semanas submetidos a dois estudos Dopplerecocardiográficos com intervalo de duas semanas, sendo os examinadores cegados para os hábitos alimentares maternos. Um questionário de frequência alimentar validado para esse objetivo foi aplicado e uma dieta com alimentos pobres em polifenóis (< 30 mg/100 mg foi orientada. Um grupo controle de 26 fetos no 3º trimestre foi submetido ao mesmo protocolo. Utilizou-se o teste-t para amostras independentes. RESULTADOS: A IG média foi 33 ± 2 semanas. A média do consumo materno diário de polifenóis (CMDP foi 1277 mg, caindo para 126 mg após orientação (p = 0,0001. Ocorreu diminuição significativa nas Velocidades Ductais Sistólica (VSD e Diastólica (VDD e na relação dos diâmetros ventriculares (VD/VE, assim como aumento do índice de pulsatilidade (IP [VSD = 1,2 ± 0,4 m/s (0,7-1,6 para 0,9 ± 0,3 m/s (0,6-1,3 (p = 0,018;VDD = 0,21 ± 0,09 m/s (0,15-0,32 para 0,18 ± 0,06 m/s (0,11-0,25 (p = 0,016; relação VD/VE = 1,3 ± 0,2 (0,9-1,4 para 1,1 ± 0,2 (0,8 - 1,3 (p = 0,004; IP do ducto = 2,2 ± 0,03 (2,0-2,7 para 2,4 ± 0,4 (2,2-2,9 (p = 0,04]. A IG média dos controles foi de 32 ± 4 semanas, não ocorrendo diferenças significativas no CMDP, nas velocidades ductais, no IP do ducto e na relação VD/VE. CONCLUSÃO: A restrição da ingesta de alimentos ricos em polifenóis no 3º trimestre por duas semanas melhora a dinâmica do fluxo no ducto arterioso fetal e as dimensões do VD.

  7. Estudo de caso de uma pilha de milho ensacado ao ar livre

    Mexia, António; Barros, G.

    2003-01-01

    From a bag stack of stored maize, in open air, in Zimbabwe, during 30 months, samples were taken to study the influence of the factors, temperature and moisture content, in the development of stackburn in maize, seed viability and commercial grade. It was concluded that stackburned maize reduced the seed viability and the commercial grade.

  8. "Ars Electronica 2009" / Raivo Kelomees

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  9. Massagem ao bebé

    Figueiredo, Bárbara

    2007-01-01

    Apresenta-se uma revisão da investigação desenvolvida no âmbito da massagem e da estimulação táctil-cinestésica ao bebé. Descrevem-se os estudos empíricos conduzidos no sentido de avaliar os efeitos no desenvolvimento, no bem-estar e em problemas específicos do bebé de termo e prematuro. Conclui-se a respeito do impacto positivo da massagem sobre a criança, os pais e na interacção entre ambos; nomeadamente porque beneficia dois objectivos primordiais dos cuidados de ...

  10. Oldest human footprints dated by Ar/Ar

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  11. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Eneida Rejane Rabelo

    2007-02-01

    ón para el manejo de la enfermedad y el desarrollo de la capacidad de autoayuda. En este artículo revisaremos en detalle aspectos de la educación para pacientes con insuficiencia cardiaca dada por enfermeros.O principal objetivo do tratamento da insuficiência cardíaca (IC consiste em alcançar e manter a estabilidade clínica dos pacientes. Vários estudos demonstram que programas multidisciplinares para educação sistemática sobre a doença são estratégias positivas para estes pacientes. Enfermeiros engajados em clínicas de IC desempenham papel fundamental no processo de educação e acompanhamento dos pacientes. Os objetivos deste processo são ensinar, reforçar, melhorar e avaliar constantemente as habilidades dos pacientes para o autocuidado, que incluem a monitorização do peso, a restrição de sódio e de líquidos, a realização de atividade física, o uso regular das medicações, a monitorização de sinais e de sintomas de piora da doença e o contato precoce com a equipe assistencial. Desta forma, a educação para o entendimento da IC, e o desenvolvimento de habilidades para o autocuidado, são considerados chaves para melhorar a adesão, evitar crises de descompensação e conseqüentemente manter a estabilidade clínica dos pacientes. Neste artigo nos revisamos detalhadamente os aspectos envolvidos no processo de educação dispensados aos pacientes por enfermeiros no contexto das clínicas de IC.

  12. Lévi-Strauss nos 90 voltas ao passado

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  13. AR DOC: Augmented reality documentaries

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  14. ARS - Helsinki - 2006 / Galina Balashova

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  15. Ars Industrialis, arsindustrialis.org

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  16. Aerosol Observing System (AOS) Handbook

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  17. arXiv.org and Physics Education

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  18. Efeito de níveis de água, coberturas do solo e condições ambientais na temperatura do solo e no cultivo de morangueiro em ambiente protegido e a céu aberto Effect of water levels, soil covers and enviroment in maximum soil temperature in strawberry crop in field and greenhouse

    Regina C. de M. Pires

    2004-12-01

    Full Text Available A temperatura do solo é um importante parâmetro no cultivo do morangueiro, pois interfere no desenvolvimento vegetativo, na sanidade e na produção. O objetivo do presente trabalho foi avaliar o efeito de diferentes níveis de água, coberturas de canteiro em campo aberto e em ambiente protegido, na temperatura máxima do solo no cultivo do morangueiro. Foram realizados dois experimentos: um em cultivo protegido e outro a campo aberto, em Atibaia - SP, em esquema fatorial 2 x 3 (coberturas do solo e níveis de irrigação, em blocos ao acaso, com cinco repetições. As coberturas de solo utilizadas foram filmes de polietileno preto e transparente. A irrigação localizada foi aplicada por gotejo sempre que o potencial de água no solo atingisse -0,010 (N1, -0,035 (N2 e -0,070 (N3 MPa, em tensiômetros instalados a 10 cm de profundidade. A temperatura do solo foi avaliada por termógrafos, sendo os sensores instalados a 5 cm de profundidade. Houve influência do ambiente de cultivo, da cobertura do solo e dos níveis de irrigação na temperatura máxima do solo. A temperatura do solo sob diferentes coberturas dependeu não somente das características físicas do plástico, como também da forma de instalação no canteiro. A temperatura máxima do solo aumentou com a diminuição do potencial da água no solo, no momento da irrigação.The soil temperature is an important parameter in strawberry crop, because, it interferes in vegetative development, plant health conditions and yield. The aim of this work was to evaluate the effect of different water levels, soil covers in field conditions and greenhouse in maximum soil temperature in strawberry crop. Two experiments were accomplished, one in greenhouse and other in field conditions, at Atibaia - SP, Brazil. The experimental design was a factorial 2 x 3 (soil covers and water levels, with 5 repetitions. The soil covers were clear and black plastics. The trickle irrigation was applied

  19. Acesso aberto à informação científica: políticas e iniciativas governamentais Acceso abierto a la información científica: políticas e iniciativas gobernamentales

    Adriana Rosecler Alcará

    2010-03-01

    Full Text Available Trata das políticas de acesso aberto à informação científica e das propostas de ação com ênfase para as iniciativas governamentais em diferentes países. Descreve as recomendações da Unesco e da IFLA. Identifica as principais iniciativas, ações e recomendações internacionais. Finaliza evidenciando peculiaridades de áreas e de formas de tratamento da questão nas políticas já estabelecidas.

  20. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias Free and open-source software application for the evaluation of coronary computed tomography angiography images

    Marcelo Souza Hadlich; Gláucia Maria Moraes de Oliveira; Feijóo, Raúl A.; Azevedo, Clerio F; Bernardo Rangel Tura; Paulo Gustavo Portela Ziemer; Pablo Javier Blanco; Gustavo Pina; Márcio Meira; Nelson Albuquerque de Souza e Silva

    2012-01-01

    FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine). Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de c...

  1. POTENCIAL DOS RECURSOS EDUCACIONAIS ABERTOS PARA INTEGRAÇÃO DAS TECNOLOGIAS E CONVERGÊNCIA ENTRE AS MODALIDADES NA UFSM. POTENTIAL OF OPEN EDUCATIONAL RESOURCES FOR TECHNOLOGY INTEGRATION AND CONVERGENCE BETWEEN THE MODALITIES AT UFSM

    Elena Maria Mallmann

    2013-11-01

    Full Text Available O foco de análise é a implementação e o fomento de práticas escolares, para potencializar a integração das tecnologias e a convergência entre as modalidades na Universidade Federal de Santa Maria (UFSM, Brasil, por meio de Recursos Educacionais Abertos. Objetivamos sistematizar princípios conceituais e práticas que balizam a utilização de recursos educacionais abertos, com vistas a maximizar diálogo e produção curricular mediados por tecnologias. Os procedimentos metodológicos de pesquisa-ação (planejamento participativo, observação e questionários survey geraram dados para análise referente à programação e à problematização de Recursos Educacionais Abertos, em cursos de graduação e pós-graduação mediados pelo Moodle institucional. Os resultados de acoplamento da pesquisa à ação didático-metodológica inovadora na UFSM evidenciam crescimento exponencial na programação semanal de recursos e atividades de estudo no Moodle. A afirmação conclusiva destaca que a disponibilização e o suporte técnico institucional de tecnologias em rede ampliam condições para integração e convergência entre as modalidades, especialmente no âmbito dos recursos educacionais abertos como hipertextos programados em html. The analysis focus is the implementation and the fomentation of school practices in order to enhance the technology integration and the convergence between the modalities at the Federal University of Santa Maria (UFSM, Brazil, through open educational resources. We aimed to systematize conceptual principles and practices that beacon the use of open educational resources, aspiring to maximize dialogue and curricular production mediated by technologies. The action research methodological procedures (participatory planning, observation and survey questionnaires generated analysis data relative to the programming and problematization of open educational resources, in undergraduate and graduate courses mediated

  2. Paleozoic accretionary orogenesis in the eastern Beishan orogen: constraints from zircon U-Pb and 40Ar/39Ar geochronology

    Ao, Songjian; Xiao, Wenjiao; Windley, Brian; Mao, Qigui

    2016-04-01

    The continental growth mechanism of the Altaids in Central Asia is still in controversy between models of continuous subduction-accretion versus punctuated accretion by closure of multiple oceanic basins. The Beishan orogenic belt, located in the southern Altaids, is a natural laboratory to address this controversy. Key questions that are heavily debated are: the closure time and subduction polarity of former oceans, the emplacement time of ophiolites, and the styles of accretion and collision. This paper reports new structural data, zircon ages and Ar-Ar dates from the eastern Beishan Orogen that provide information on the accretion process and tectonic affiliation of various terranes. Our geochronological and structural results show that the younging direction of accretion was northwards and the subduction zone dipped southwards under the northern margin of the Shuangyingshan micro-continent. This long-lived and continuous accretion process formed the Hanshan accretionary prism. Our field investigations show that the emplacement of the Xiaohuangshan ophiolite was controlled by oceanic crust subduction beneath the forearc accretionary prism of the Shuangyingshan-Mazongshan composite arc to the south. Moreover, we address the age and terrane affiliation of lithologies in the eastern Beishan orogen through detrital zircon geochronology of meta-sedimentary rocks. We provide new information on the ages, subduction polarities, and affiliation of constituent structural units, as well as a new model of tectonic evolution of the eastern Beishan orogen. The accretionary processes and crustal growth of Central Asia were the result of multiple sequences of accretion and collision of manifold terranes. Reference: Ao, S.J., Xiao, W., Windley, B.F., Mao, Q., Han, C., Zhang, J.e., Yang, L., Geng, J., Paleozoic accretionary orogenesis in the eastern Beishan orogen: Constraints from zircon U-Pb and 40Ar/39Ar geochronology. Gondwana Research, doi: http://dx.doi.org/10.1016/j

  3. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  4. Plântulas de soja 'Tracajá' expostas ao ozônio sob condições controladas Soybean 'Tracajá' seedlings exposed to ozone under controlled conditions

    Patricia Bulbovas; Silvia Ribeiro de Souza; Regina Maria de Moraes; Flávio Luizão; Paulo Artaxo

    2007-01-01

    O objetivo deste trabalho foi avaliar o crescimento inicial, acúmulo de biomassa, trocas gasosas e defesas antioxidativas de soja 'Tracajá', cultivada na Região Amazônica, exposta ao ozônio sob condições controladas. Sementes germinadas em vasos foram levadas para duas câmaras, uma com ar filtrado (AF) e outra com ar filtrado mais 30 ppb de ozônio (AF + O3). Aos 10 e 20 dias após a semeadura, as trocas gasosas, crescimento em altura e acúmulo de biomassa foram medidos; aos 20 dias após a seme...

  5. Conteúdos abertos e compartilhados: novas perspectivas para a educação Open and shared contents: new perspectives for education

    Osmar Mantovani

    2006-04-01

    Full Text Available Mudanças em curso no cenário de produção e divulgação de conhecimentos bem como algumas questões importantes indutoras de tais mudanças são apontadas. A principal é o desbalanceamento, cada vez maior, entre os interesses da indústria cultural e os da sociedade, em favor da primeira, provocado, em anos recentes, por mudanças sucessivas no direito de propriedade intelectual por pressão da mesma indústria cultural que tem, hoje, o seu modelo de negócio ameaçado por práticas apoiadas por novas tecnologias de informação e comunicação e, especificamente, pela Internet. Tal desbalanceamento cerceia, em particular, a escola na escolha dos recursos mais apropriados para a educação de seus alunos. Um contramovimento promove "conteúdos abertos". Um ambiente que foi desenhado para apoiar a comunidade escolar na publicação e no compartilhamento de conteúdos para, dessa forma, ajudá-la a promover uma educação com parâmetros mais democráticos e adequados às transformações em curso é apresentado.Ongoing changes in the scenario of knowledge production and dissemination as well as some of the important issues that induced them are pointed out. The main one is an increasing shift of balance from the interests of society to those of the culture industry promoted, these last years, by successive amendments to the intellectual property rights. These were passed under the pressures of that industry whose business model is nowadays threatened by the practices supported by the new information and communication technologies and the Internet in particular. Such shift of balance specifically limits schools in their choices of the most appropriate resources to educate their students. A counter-movement is promoting "open contents" through an environment, presented here, designed to support the school community in publishing and sharing tasks. It is aimed at helping that community promote an education with more democratic and better

  6. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  7. Beta decay of 31Ar

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  8. Repositório Virtual de Acesso Aberto em Agricultura & Aquicultura: compartilhar e valorizar pesquisas científicas e acadêmicas relacionadas com a agricultura, aquicultura, alimentação e meio ambiente. (http://voa3r.eu)

    Aventurier, Pascal; Le Hénaff, Diane

    2011-01-01

    VOA3R é um projeto europeu de 3 anos (2010-2012, ICT Policy Support Program, Seventh Framework Programme - FP7) que visa compartilhar conhecimentos científicos nas áreas de agricultura para alimentos, aquicultura e meio ambiente a partir de arquivos abertos de parceiros europeus e internacionais. As organizações com arquivos abertos nos temas do projeto estão convidadas a disponibilizá-los no VOA3R. O VOA3R é um consórcio constituído por 14 parceiros de 10 países : - UAH (Universidad...

  9. 40Ar/39Ar dating of the Late Cretaceous

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  10. Ars discendi, ars docendi : programme Pascal

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  11. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  12. Triaxial superdeformation in $^{40}$Ar

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  13. Ars grammatica de Dionisio Tracio

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  14. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    Anna Luiza de Fátima Pinho Lins Gryschek

    2000-09-01

    Full Text Available Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como necessidades de qualificação foram apontadas: biossegurança, preparo e administração de medicamentos específicos e assistência de enfermagem aos clientes com HIV e Aids.This study discourses about the especific training needs of the nursing teams of the Centers of Reference of Sexual Transmissible Diseases (STD and Aids from the STD/Aids Program of the Health Secretary of the Township of São Paulo for the assistance of clients with HIV and Aids. From a total of 671 nursing workers, 453 answered the questionnaire. They identified the following training needs: contents related to standard precautions, preparation and administration of specific drugs and other general nursing care to HIV + clients.

  15. Cartografar é traçar um plano comum

    Virgínia Kastrup

    2013-08-01

    Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

  16. A EDUCAÇÃO DE ADULTOS E O PROGRAMA DE COMBATE AO ANALFABETISMO EM PRESIDENTE PRUDENTE

    Cristiano A. G. Di Giorgi

    2009-12-01

    Full Text Available Neste artigo, após traçar breve quadro do histórico e da situação atual da Educação de Adultos no País, descrevemos o programa "Combate ao Analfabetismo" desenvolvido pela Prefeitura Municipal de Presidente Prudente, cuja direção pedagógica esta a cargo da FCT/UNESP - Campus de Presidente Prudente. Apontamos os principais problemas didático-pedagógicos e administrativos colocados ao programa e as soluções que foram encontradas.

  17. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  18. AoB PLANTS: origins and features

    Jackson, Michael B.

    2009-01-01

    Introduction AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Background Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access h...

  19. 244-AR Vault Interim Stabilization Project Plan

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  20. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  1. The Coronae of AR Lac

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  2. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  3. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  4. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  5. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  6. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  7. 39Ar/Ar measurements using ultra-low background proportional counters

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  8. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  9. Ilha das Flores, estatura e peso em crianças dos 6 aos 11 anos.

    Antunes, Maria A. G.

    1990-01-01

    IV Expedição Científica do Departamento de Biologia – Flores 1989. 0s estudos de crescimento físico humano têm-se revelado de grande interesse pois permitem conhecer as características de diferentes populações e a variabilidade existente intra e interpopulações. Mas um dos aspectos mais importantes destes estudos talvez o de, ao se analisar o estado de crescimento e tempo de desenvolvimento do indivíduo, permitir destrinçar factores que influenciam nefastamente o crescimento. ...

  10. arXiv.org and Physics Education

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  11. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  12. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  13. O museu aberto e comunicativo : fundamentação e proposta para estudos de públicos à luz de um enfoque info-comunicacional

    Beites, Alexandre Manuel Rodrigues

    2011-01-01

    Os estudos de públicos aplicados ao universo museológico sofreram uma evolução que transitou sem grande efectividade ate um momento - o actual, em que lhes são exigidos resultados uteis. Vive-se uma "encruzilhada" metodológica para a qual esta dissertação pretende contribuir com uma proposta. Apostar no registo e tratamento dos dados info-comunicacionais do visitante como matéria-prima será o ponto de partida para uma estratégia, que se quer qualitativa, integradora de varias disciplinas e co...

  14. Prolonged plume volcanism in the Caribbean Large Igneous Province: New insights from Curaçao and Haiti

    Loewen, Matthew W.; Duncan, Robert A.; Kent, Adam J. R.; Krawl, Kyle

    2013-10-01

    We present 36 new 40Ar-39Ar incremental heating age determinations from the Caribbean Large Igneous Province (CLIP) providing evidence for extended periods of volcanic activity and suggest a new tectonomagmatic model for the province's timing and construction. These new 40Ar-39Ar ages for the Curaçao Lava Formation (CLF) and Haiti's Dumisseau Formation show evidence for active CLIP volcanism from 94 to 63 Ma. No clear changes in geochemical character are evident over this period. The CLF has trace element signatures (e.g., Zr/Nb = 10-20) and flat rare earth element (REE) trends consistent with plume volcanism. The Dumisseau Formation also has plume-like geochemistry and steeper REE trends similar to ocean island basalts. Volcanism in the Dumisseau Formation appears to have largely ceased by 83 Ma while at Curaçao it continued until 63 Ma. A rapidly surfacing and melting plume head alone does not fit this age distribution. Instead, we propose that the residual Galapagos plume head, following initial ocean plateau construction, was advected eastward by asthenospheric flow induced by subducting oceanic lithosphere. Slab rollback at the Lesser Antilles and Central America subduction zones created an extensional regime within the Caribbean plate. Mixing of plume with upwelling asthenospheric mantle provided a source for intermittent melting and eruption through the original plateau over a ˜30 Ma period.

  15. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  16. Revis\\~ao da Constru\\c{c}\\~ao de Modelos Supersim\\'etricos

    Rodríguez, M C

    2001-01-01

    Foi com base neste estudo que fizemos a constru\\c{c}\\~ao da vers\\~ao supersim\\'etrica dos modelos de simetria $SU(3)_{C} \\otimes SU(3)_{L} \\otimes U(1)_{N}$ \\cite{susy331}, apresentado no final da minha tese de doutorado \\cite{mcr1}. Bem como dos estudos fenomenol\\'ogicos subsequente \\cite{mcr}.

  17. Into the Blue: AO Science with MagAO in the Visible

    Close, Laird M; Follette, Katherine B; Hinz, Phil; Morzinski, Katie M; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-01-01

    We review astronomical results in the visible ({\\lambda}<1{\\mu}m) with adaptive optics. Other than a brief period in the early 1990s, there has been little astronomical science done in the visible with AO until recently. The most productive visible AO system to date is our 6.5m Magellan telescope AO system (MagAO). MagAO is an advanced Adaptive Secondary system at the Magellan 6.5m in Chile. This secondary has 585 actuators with < 1 msec response times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve <30mas resolutions, 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R < 8 mag stars. These relatively high visible wavelength Strehls are made possible by our powerful combination of a next generation ASM and a Pyramid WFS with 378 controlled modes and 1000...

  18. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  19. Ao encontro do equilíbrio

    Freitas, Licínia Marisa Oliveira

    2013-01-01

    O presente Relatório apresenta as atividades desenvolvidas ao longo de todo o período de estágio referentes ao módulo I e II. O módulo I teve por base a primeira e segunda fase do Planeamento em Saúde, que se refere ao Diagnóstico de Situação de Saúde da população com patologia de Diabetes Mellitus e Priorização das Necessidades. No módulo II surgiram os projetos de intervenção nas necessidades detetadas e avaliação das mesmas com a verificação dos ganhos em saúde observados. Numa primeira...

  20. Into the blue: AO science with MagAO in the visible

    Close, Laird M.; Males, Jared R.; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-08-01

    We review astronomical results in the visible (λresponse times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve Pyramid WFS with 378 controlled modes and 1000 Hz loop frequency. We'll review the key steps to having good performance in the visible and review the exciting new AO visible science opportunities and refereed publications in both broad-band (r,i,z,Y) and at Halpha for exoplanets, protoplanetary disks, young stars, and emission line jets. These examples highlight the power of visible AO to probe circumstellar regions/spatial resolutions that would otherwise require much larger diameter telescopes with classical infrared AO cameras.

  1. "Ars Ornata" Mediterrania / Kadri Mälk

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  2. Ars ornata / Kadri Mälk

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  3. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  4. Craving decrease with topiramate in outpatient treatment for cocaine dependence: an open label trial Diminuição da fissura com topiramato no tratamento ambulatorial para dependência de cocaína: um ensaio clínico aberto

    Alessandra Diehl Reis

    2008-06-01

    Full Text Available OBJECTIVE: To evaluate anticraving action and tolerability of topiramate in cocaine user treatment. METHOD: Male users of inhaled cocaine which met criteria for cocaine dependence (Diagnostic and Statistical Manual of Mental Disorders, fourth edition were selected for outpatient 12-week, open label trial with topiramate; individual dosage ranged between 25-300 mg/day. Main clinical variables were abstinence rate, craving intensity, frequency and duration, adherence, dropouts, side effects and impulsivity measure through Barratt Impulsivity Scale. Patients received assertive strategic counseling for abstinence assistance and medication monitoring evaluation every two weeks. Comparative analysis was made with intention to treat, missing values were replaced (last observation carried forward, and significance level was 5%. RESULTS: Adherence to treatment was 57% (at least three evaluations, 32% dropped out (one evaluation. There were no severe side effects. Negative test average was 25.4% (31.2. Significant reduction in craving intensity and duration was observed in 25% of the sample. No statistical significant reduction in craving frequency was observed in 7.1%. Increase in frequency was observed in 10.7% and 82.1% did not present any variation. No significant statistical variations in Barratt Impulsivity Scale or in the total score were found in the final evaluation when compared to baseline. CONCLUSION: More randomized placebo-controlled trials with topiramate for cocaine dependants should be performed to evaluate preliminary evidence.OBJETIVO: Avaliar a ação anticraving e tolerabilidade do topiramato em usuários de cocaína. MÉTODO: Homens usuários de cocaína inalada que preenchiam critérios para dependência de cocaína (Manual Diagnóstico e Estatístico de Desordens Mentais, quarta edição foram selecionados para 12 semanas de tratamento ambulatorial, em ensaio clínico aberto com topiramato; dosagens escalonadas entre 25-300 mg

  5. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  6. The mass of 32Ar and 33Ar for fundamental tests

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  7. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  8. LÓGICA DIAGNÓSTICA EM SERVIÇOS ABERTOS DE SAÚDE MENTAL: TENSÕES ENTRE PSIQUIATRIA E PSICANÁLISE

    Fuad Kyrillos Neto

    2014-09-01

    Full Text Available O objetivo desse artigo é oferecer uma contribuição ao debate acerca da questão das lógicas diagnósticas no campo da saúde mental no Brasil. Para isso, contextualiza-se brevemente o movimento da Reforma Psiquiátrica. Posteriormente, apresentam-se fragmentos de um caso clínico atendido em um Centro de Atenção Psicossocial (CAPS. A partir desse caso, o texto se desenvolve no sentido de discutir as tensões e consequências para a condução do tratamento em referenciais diagnósticos distintos: a classificação Diagnostic and Statistical Manual of Mental Disorders (DSM e a psicopatologia psicanalítica. Um deles refere-se aos manuais estatísticos utilizados pela psiquiatria contemporânea, fundado no conceito de transtorno mental, enquanto o outro se refere ao campo da psicanálise e o diagnóstico estrutural. Dessa forma, o argumento aproxima-se da discussão sobre a utilização de uma razão diagnóstica profícua para a proposta da Reforma Psiquiátrica Brasileira. Conclui-se que a psiquiatria contemporânea se organiza em torno de uma lógica diagnóstica que leva à alienação dos sujeitos em um discurso pretensamente universal que os impossibilita de reconhecer sua singularidade no campo social. Por outro lado, observa-se a possibilidade da clínica psicanalítica manter-se em consonância com os objetivos da reforma. O diagnóstico em psicanálise serve para orientar o tratamento a fim de que o sujeito possa se posicionar de modo menos dependente no laço social, a partir de uma aposta na singularidade do sujeito e sua desalienação.

  9. 40Ar/39Ar age and thermal history of the Kirin chondrite

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  10. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  11. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  12. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    2008-01-01

    O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  13. Into the Blue: AO Science in the Visible with MagAO

    Close, Laird; Males, Jared; Morzinski, Katie; Kopon, Derek; Follette, Kate; Rodigas, Timothy; Hinz, Philip; Wu, Ya-Lin; Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Uomoto, Alan; Hare, Tison

    2013-12-01

    The Magellan Clay telescope is a 6.5m Gregorian telescope located in Chile at Las Campanas Observatory. We have fabricated an 85 cm diameter aspheric adaptive secondary with our subcontractors and partners, MagAO passed acceptance tests in spring 2012, and the entire System was commissioned from Nov 17 to Dec 7, 2012. This secondary has 585 actuators with response times (0.7 ms typically). We fabricated a high order (585 mode) pyramid wavefront sensor (similar to that of LBT's FLAO). The relatively high actuator count allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We have built an CCD science camera called "jVisAO". On-sky long exposures (60s) achieve 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R Pyramid WFS with 200-400 controlled modes and 1000 Hz loop frequencies. To minimize non-common path errors and enable visible AO the VisAO science camera is fed by an advanced triplet ADC and is piggy-backed on the WFS optical board itself. Despite the ability to make 25 mas images we still have ~4 mas of resolution loss to residual vibrations. We will discuss what the most difficult aspects are for visible AO on ELTs scaling from our experience with MagAO.

  14. Characterization of an AO-OCT system

    Evans, J W; Zawadzki, R J; Jones, S; Olivier, S; Werner, J S

    2007-07-26

    Adaptive optics (AO) and optical coherence tomography (OCT) are powerful imaging modalities that, when combined, can provide high-volumetric-resolution, images of the retina. The AO-OCT system at UC Davis has been under development for 2 years and has demonstrated the utility of this technology for microscopic, volumetric, in vivo retinal imaging [1]. The current system uses an AOptix bimorph deformable mirror (DM) for low-order, high-stroke correction [2] and a 140-actuator Boston Micromachines DM for high-order correction [3]. We are beginning to investigate the potential for increasing the image contrast in this system using higher-order wavefront correction. The first step in this analysis is to quantify the residual wavefront error (WFE) in the current system. Developing an error budget is a common tool for improved performance and system design in astronomical AO systems [4, 5]. The process for vision science systems is also discussed in several texts e.g. [6], but results from this type of analysis have rarely been included in journal articles on AO for vision science. Careful characterization of the AO system will lead to improved performance and inform the design of a future high-contrast system. In general, an AO system error budget must include an analysis of three categories of residual WFE: errors in measuring the phase, errors caused by limitations of the DM(s), and errors introduced by temporal variation. Understanding the mechanisms and relative size of these errors is critical to improving system performance. In this paper we discuss the techniques for characterizing these error sources in the AO-OCT system. It is useful to first calculate an error budget for the simpler case using a model eye, and then add the additional errors introduced for the case of a human subject. Measurement error includes calibration error, wavefront sensor (WFS) CCD noise, and sampling errors. Calibration errors must be measured by an external system. Typically this

  15. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  16. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  17. A indústria de publicação contra o acesso aberto La industria de publicación contra el acceso abierto The publishing industry against open access journals

    Kenneth Rochel de Camargo Jr

    2012-12-01

    Full Text Available A publicação em revistas de acesso aberto cresceu expressivamente nos últimos anos. As publicações de acesso fechado, por sua vez, têm custo de acesso cada vez mais elevado, por se beneficiarem de um modelo econômico peculiar: o trabalho relevante e os insumos essenciais são entregues gratuitamente a fornecedores que contam com um mercado cativo, praticamente sem concorrência. O mercado editorial é altamente oligopolizado, característico de indústrias que trabalham com o regime de copyright. Isso contribui para a elevação dos preços de seus produtos. Políticas mandatórias de acesso aberto, como a determinada pela agência National Institutes of Health, constituem-se em ameaça a esse modelo de negócios e são enfrentadas pela indústria em várias frentes, incluindo a passagem de legislação para sabotar tais iniciativas. O objetivo deste comentário foi apresentar alguns aspectos principais desse enfrentamento e sugerir possíveis estratégias de incremento da publicação de acesso aberto em nosso meio.La publicación en revistas de acceso abierto creció expresivamente en los últimos años. Las publicaciones de acceso cerrado, por su parte, tienen costo de acceso cada vez más elevado, por beneficiarse de un modelo económico peculiar: el trabajo relevante y los insumos esenciales son entregados gratuitamente a los proveedores que cuentan con un mercado cautivo, prácticamente sin concurrencia. El mercado editorial es altamente monopolizado, característico de industrias que trabajan con el régimen de copyright. Esto contribuye a la elevación de los precios de sus productos. Políticas obligatorias de acceso abierto, como la determinada por el National Institutes of Health, constituyen amenazas a este modelo de negocios y son enfrentadas por la industria en varios ángulos, incluyendo el paso de legislación para sabotear tales iniciativas. El objetivo de este comentario fue presentar algunos aspectos principales de este

  18. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  19. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  20. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  1. FATORES ASSOCIADOS AO BAIXO PESO AO NASCER NO ESTADO DE GOIÁS

    Ruth Minamisava

    2004-12-01

    Full Text Available Recém-nascidos de baixo peso ao nascer (RNBP são considerados problemas de saúde pública pela associação com altas taxas de mortalidade e morbidade. Nenhum estudo prévio sobre fatores associados ao RNBP na região central do Brasil foi encontrado na literatura. Assim, este estudo teve como objetivo identificar as prevalências e os fatores associados ao baixo peso ao nascer entre nascidos vivos no Estado de Goiás, Brasil. Foi realizado um estudo transversal tendo como fonte de dados o Sistema de Informações de Nascidos Vivos ligado ao Ministério da Saúde. Examinou-se todos os 92.745 recém-nascidos de gestação única residentes no estado de Goiás, no ano 2000. Usou-se análise de regressão logística para identificar os fatores associados ao RNBP (< 2500 g. Em Goiás, os RNBP apresentaram uma prevalência de 5,96% e os fatores associados ao baixo peso ao nascer foram: prematuridade, baixa e avançada idade materna, mulheres não casadas, menos de sete consultas de pré-natal, parto não hospitalar e neonatos do sexo feminino. Ações intersetoriais são necessárias para reduzir as desigualdades da saúde materna e infantil.

  2. Cosmologia e Representa\\c{c}\\~ao

    Ribeiro, Marcelo Byrro

    2013-01-01

    This work presents a brief and non-technical description of the main results and concepts of the modern scientific cosmology, viewing it from an epistemological perspective which allows a dialog with other modes of thinking like e.g. history, philosophy, sociology and religion. This epistemological viewpoint is based on the philosophical theses advanced by Ludwig Boltzmann (1844-1906) which states that scientific theories are nothing more than representations, or images, of nature (arXiv:phys...

  3. Experimental comparison of Wide Field AO control schemes using the Homer AO bench.

    Parisot, Amélie; Petit, Cyril; Fusco, Thierry

    2011-09-01

    Wide Field Adaptive Optics (WFAO) concepts, such as Laser Tomography AO (LTAO) or Multi-Conjugate AO (MCAO) have been developed in order to overcome the anisoplanatism limit of classical AO. Most of the future AO-assisted instruments of ELTs rely on such concepts which have raised critical challenges such as tomographic estimation and from laser and natural guide star combined with efficient DM(s) control. In that context, the experimental validation of the various clever control solutions proposed by several teams in the past years is now essential to reach a level of maturity compatible with their implementation in future WFAO developments for ELT. The ONERA wide field AO facility (HOMER bench) has been developed for these very issues. Gathering a 3D turbulence generator, laser and natural guide stars, two deformable mirrors with variable altitude positions and a PC-based flexible and user-friendly RTC , HOMER allows the implementation and comparison of control schemes from the simplest least-square to the optimal Linear Quadratic Gaussian solutions including Virtual DM and Pseudo-closed loop approaches. After a description of the bench internal calibrations and ultimate performance, all the control schemes are compared experimentally. Their evolutions as a function of wavefront sensors SNR as well as their robustness to calibration / model errors are particularly emphasised. Finally, we derive from the previous works some specific calibrations and identifications procedures ensuring both robustness and efficiency of WFAO systems and we extrapolate their applications to the future ELT AO systems.

  4. K/Ar ages from basal gneiss region

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  5. Ar-41 measurements and nuclear emergency preparedness

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  6. Online Scene Modeling for Interactive AR Applications

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  7. Improved Ar(II) transition probabilities

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  8. AR-扩增实境

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  9. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  10. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  11. Análise de Risco aplicada aos alimentos no Brasil: perspectivas e desafios Risk Analysis applied to food safety in Brazil: prospects and challenges

    Ana Virgínia de Almeida Figueiredo; Maria Spínola Miranda

    2011-01-01

    Trata-se de um estudo de caso no qual se discutiram as ideias do Comitê do Codex Alimentarius do Brasil (CCAB), coordenado pelo Instituto Nacional de Metrologia, Normalização e Qualidade Industrial (Inmetro) sobre a norma Codex Alimentarius de Análise de Risco aplicada aos alimentos (AR). Os objetivos deste trabalho foram identificar e analisar a opinião dos membros do CCAB sobre AR e levantar as propostas para a adoção desta norma no país, destacando as limitações e as potencialidades locais...

  12. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  13. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  14. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  15. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  16. Comparação entre os sistemas aberto e fechado de aspiração: revisão sistemática Comparison between open and closed suction systems: a systematic review

    Izabela Menezes Pagotto

    2008-12-01

    Full Text Available OBJETIVOS: Este estudo foi realizado para tentar esclarecer qual sistema de aspiração é mais eficiente. O objetivo foi comparar os sistemas fechado e aberto de aspiração através de revisão sistemática. MÉTODOS: A busca de artigos científicos foi realizada nas bases de dados MedLine, LILACS e Cochrane abrangendo o período entre 1997 e agosto de 2007 utilizando as palavras-chave: endotracheal suction e closed suction. Foram incluídos os estudos que compararam o sistema aberto e fechado de aspiração, realizados em adultos humanos e que eram ensaios aleatórios e controlados. RESULTADOS: Dos 78 artigos encontrados apenas 15 preencheram os critérios e foram detalhados na revisão. Dentre estes, nove artigos comparavam a incidência de pneumonia associada à ventilação mecânica entre os dois sistemas, seis comparavam a saturação de oxigênio, quatro comparavam pressão arterial e freqüência cardíaca, três comparavam volumes pulmonares, dois comparavam remoção de secreção e quatro; custos. Não houve diferença em relação às variáveis comparadas: incidência de pneumonia associada à ventilação mecânica, mortalidade, tempo de unidade de terapia intensiva, tempo de ventilação mecânica, PaCO2, PaO2, pressão arterial média, freqüência cardíaca e remoção de secreção no uso do sistema aberto e fechado de aspiração. Porém, houve sempre diminuição de SpO2 e dos volumes pulmonares com o uso do sistema aberto; e custos maiores na maioria dos trabalhos quando utilizado o sistema fechado. CONCLUSÕES: O sistema fechado de aspiração parece aumentar o risco de colonização, mas traz as vantagens de não diminuir os volumes pulmonares e não acarretar queda de saturação especialmente em pacientes com insuficiência respiratória grave e em uso de níveis mais altos de pressão expiratória final positiva.OBJECTIVES: This study attempted to identify which is the more effective suction system. The objective was

  17. Lignocellulosic Biofuels: Bioenergy Research at ARS

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  18. Hazard evaluation for 244-AR vault facility

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  19. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  20. A compilation of 40Ar-39 and K-Ar ages: report 25

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  1. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  2. The ChArMEx database

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  3. Avaliação da tolerabilidade e do controle de ciclo de dois contraceptivos orais de baixa dose: estudo comparativo aberto Assessment of the tolerability and cycle control of two low-dose oral contraceptives: an open-label study

    Edmund C. Baracat

    1998-06-01

    Full Text Available Realizou-se um estudo aberto comparativo em nove centros brasileiros para avaliar a tolerabilidade e o controle de ciclo obtido com o uso de dois contraceptivos orais de baixa dose contendo 20 mg etinilestradiol/75 mg gestodeno e 20 mg etinilestradiol/150 mg desogestrel, durante seis ciclos de tratamento. Foram selecionadas 167 mulheres saudáveis com vida sexual ativa (77 no grupo do gestodeno e 90 no grupo do desogestrel, das quais 138 completaram os seis ciclos de tratamento. Em um subgrupo de novas usuárias realizou-se também perfil lipídico e hemostático. Foram avaliados 867 ciclos no total. Ocorreu sangramento irregular em 4,6% dos ciclos com gestodeno e em 8,1% com desogestrel. A tolerabilidade a ambas preparações foi boa, mas houve significativamente mais náusea no grupo do desogestrel. O controle de ciclo foi bom com os dois contraceptivos, sendo que houve freqüência significativamente menor de sangramento irregular no grupo do gestodeno quando se leva em conta que todos os ciclos foram considerados. Não houve alterações clinicamente significativas no perfil hemostático. O perfil lipídico mostrou tendência a tornar-se mais favorável após seis ciclos de tratamento com as duas preparações. Não ocorreu alteração no peso médio das mulheres no grupo do gestodeno; no grupo do desogestrel houve aumento significativo no peso médio de aproximadamente 1 kg após seis meses de tratamento. A adesão ao tratamento foi boa com as duas preparações. Os resultados deste estudo mostram que preparações contendo baixa dose de gestodeno ou desogestrel associados a 20 mg de etinilestradiol são contraceptivos bem tolerados que permitem bom controle de ciclo, sem efeitos colaterais significantes.An open-label comparative study was conducted in nine centers in Brazil to evaluate the tolerability and cycle control of two low-dose oral contraceptives containing 20 mg ethynylestradiol/75 mg gestodene and 20 mg ethynylestradiol/150 mg

  4. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  5. AO distal radius volar plate fixation for AO type C distal radius fracture

    We applied a volar AO distal radius plate for AO type C fractures of the distal radius. The subjects included 1 man and 12 women, and their mean age at the time of surgery was 62 years. The mean follow-up period was 10 months. According to the AO classification, 3 cases were C2, 7 cases were C3-1, and 3 cases were C3-2. Union was achieved in all cases. Wrist function was evaluated using the modified Mayo wrist scoring system. The functional results were excellent in 7 cases, good in 4 cases, and fair in 2 cases. To evaluate the strength of the initial fixation and the accuracy of joint surface reduction after surgery, palmar tilt, ulnar variance, and radial inclination were measured from radiographs that were taken before surgery, immediately after surgery, and at the final follow-up examination, and from CT scan images taken at the final follow-up examination. In 3 cases, correction losses included poor initial fixation and joint surface reduction, and all 3 were AO C3-2 fractures. These cases had comminuted fragments, both volar and dorsal metaphysic, and lunate fossa fragments. A volar locking plate fixation that can support the articular surface should be applied to AO C2 and C3-1 fractures. However, in the absence of bone grafting, it should not be applied to AO C3-2 fractures because it is very difficult not only to reduce the concave lunate fossa fragments but also to fix the fragments to the volar metaphysis. (author)

  6. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  7. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  8. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  9. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  10. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  11. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  12. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  13. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  14. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Ney Procópio Lopes; Márcia Lara; Marcelo Libânio

    2011-01-01

    A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvazi...

  15. AO Observations of Three Powerful Radio Galaxies

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  16. Contribuição ao manejo sustentável do complexo ferruginoso nectandra na floresta nacional de Ibirama, SC Contribution to sustainable forest management of the nectandra ferruginous complex in the Ibirama national forest, SC, Brazil

    Fernando Campanhã Bechara

    2009-02-01

    Full Text Available Diante do mercado aberto para a produção de madeiras tropicais, o complexo ferruginoso Nectandra (CFN, formado pelo grupo de espécies Nectandra lanceolata, N. oppositifolia e N. rigida (canelas-ferrugem, possui aspectos promissores, pois apresenta madeira de alto valor mercadológico e com potencial silvicultural. Esse grupo de espécies é de difícil distinção em campo, justificando-se o manejo do complexo em conjunto. Essas são as primeiras espécies madeireiras a se tornarem abundantes em florestas secundárias na Região Sul do país, favorecidas pela abertura de pequenas clareiras. Realizaram-se estudos demográficos desse grupo, na FLONA de Ibirama, SC, objetivando alicerçar o manejo sustentável de madeira para serraria. Numa Floresta Ombrófila Densa de 38 ha, foram inventariados todos os indivíduos do CFN presentes em 14 parcelas aleatórias de 40 x 40 m. Caracterizou-se a distribuição espacial das árvores, bem como a produção de madeira. A população apresentou distribuição espacial aleatória, sendo 58% de toras de boa qualidade. Ocorreram 43 indivíduos/ha na regeneração, o que caracteriza a formação de banco de plântulas. Foi possível explorar 11 árvores/ha (com DAP > 16 cm, o que representaria 3,5 m³ de madeira/ha. Um ciclo de corte de 20 anos renderia quase 7 m³ de madeira de alta qualidade ao ano. Dez por cento das árvores adultas apresentaram três rebrotas/indivíduo, estabelecendo o potencial de segunda rotação. As árvores classificadas como toras de "baixa qualidade" (32% do total e com DAP > 40 cm podem ser deixadas como porta-sementes. Recomendam-se estudos mais detalhados de demografias espacial e temporal, autoecologia e análise econômica para alicerçar o manejo sustentável.In view of the opening of the tropical wood production market, the Nectandra ferruginous complex (NFC, defined as a group of Nectandra species - N. lanceolata, N. oppositifolia and N. rigida - offers promising

  17. K/Ar dating of diagenetic illite

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  18. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  19. Dicty_cDB: FC-AR02 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  20. Theoretical photoabsorption spectra of Ar n+ clusters

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  1. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  2. 40Ar retention in the terrestrial planets.

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  3. Ar-O2 rf plasma diagnostics by mass spectrometry

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  4. High-spin yrast levels of 38Ar

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  5. A psicologia positiva aplicada ao contexto escolar

    Ramôa, Maria Manuel Valente Braz Sepúlveda

    2016-01-01

    Relatório de estágio apresentado à Escola Superior de Educação de Paula Frassinetti para a obtenção de grau de mestre em educação pré-escolar e ensino do 1º ciclo do ensino básico A Psicologia positiva é considerada uma nova perspetiva de investigação e intervenção, promovendo o estudo das condições e processos que contribuem para o florescimento ou funcionamento ótimo das pessoas, grupos ou instituições, pretendendo debruçar-se sobre as experiências positivas tais como as emoções positiva...

  6. Cosmologia e Representa\\c{c}\\~ao

    Ribeiro, Marcelo Byrro

    2013-01-01

    This work presents a brief and non-technical description of the main results and concepts of the modern scientific cosmology, viewing it from an epistemological perspective which allows a dialog with other modes of thinking like e.g. history, philosophy, sociology and religion. This epistemological viewpoint is based on the philosophical theses advanced by Ludwig Boltzmann (1844-1906) which states that scientific theories are nothing more than representations, or images, of nature (arXiv:physics/0701308v1). By being representations one cannot know how nature really is because the intrinsic and indispensable properties that characterize nature are unreachable by science. In other words, the true essences that constitute nature are unknowable. Therefore, all answers proposed by science are partial, simplified and replaceable. Another way of putting forward this viewpoint is to state that all scientific truths are provisional, a result which naturally leads to the conclusion that the same set of phenomena, or sc...

  7. Software livre e de código aberto para avaliação de imagens de angiotomografia de coronárias Free and open-source software application for the evaluation of coronary computed tomography angiography images

    Marcelo Souza Hadlich

    2012-10-01

    Full Text Available FUNDAMENTO: A estandardização do padrão de imagens utilizada dentro da medicina foi realizada em 1993 por meio do padrão DICOM (Digital Imaging and Communications in Medicine. Diversos exames utilizam esse padrão e cada vez mais são necessários softwares capazes de manipular esse tipo de imagem, porém esses softwares geralmente não têm o formato livre e de código aberto, e isso dificulta o seu ajuste para os mais diferentes interesses. OBJETIVO: Desenvolver e validar um software livre e de código aberto capaz de manipular imagens DICOM de exames de angiotomografia de coronárias. MÉTODOS: Desenvolvemos e testamos o software intitulado ImageLab na avaliação de 100 exames selecionados de forma randômica por meio de um banco de dados. Foram realizadas 600 análises divididas por dois observadores utilizando o ImageLab e um outro software comercializado junto a aparelhos de tomografia computadorizada Philips Brilliance, na avaliação da presença de lesões e placas coronarianas nos territórios do Tronco da Coronária Esquerda (TCE e na Artéria Descendente Anterior (ADA. Para avaliar as concordâncias intraobservador, interobservadores e intersoftware, utilizamos concordância simples e estatística Kappa. RESULTADOS: As concordâncias observadas entre os softwares foram em geral classificadas como substancial ou quase perfeitas na maioria das comparações. CONCLUSÃO: O software ImageLab concordou com o software Philips na avaliação de exames de angiotomografia de coronárias especialmente em pacientes sem lesões, com lesões inferiores a 50% no TCE e inferiores a 70% na ADA. A concordância para lesão >70% na ADA foi menor, porém isso também é observado quando se utiliza o padrão de referência anatômico.BACKGROUND: The standardization of images used in Medicine in 1993 was performed using the DICOM (Digital Imaging and Communications in Medicine standard. Several tests use this standard and it is increasingly

  8. Dicty_cDB: FC-AR12 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  9. Dicty_cDB: FC-AR03 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  10. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  11. Fluvoxamina no transtorno depressivo maior: um estudo multicêntrico aberto Fluvoxamine in the treatment of major depressive disorder: an open multicentric study

    José Alberto Del Porto

    2007-01-01

    Full Text Available OBJETIVO: Este trabalho estudou a eficácia e a tolerabilidade da fluvoxamina no tratamento, de forma aberta, sem comparação com placebo ou outros agentes, por 6 semanas, de pacientes com o diagnóstico de transtorno depressivo maior (TDM. Constitui-se em objetivo secundário do estudo avaliar os efeitos da fluvoxamina sobre o sono dos pacientes. MÉTODOS: Foram incluídos 104 pacientes, maiores de 18 anos, com o diagnóstico de TDM, de acordo com os critérios do Manual Diagnóstico e Estatístico de Transtornos Mentais, 4ª edição (DSM-IV, e com escores, na Escala de Hamilton para Depressão, versão de 17 itens (HAM-D 17, de 17 pontos ou mais. Avaliou-se a eficácia da fluvoxamina por meio das Escalas HAM-D 17 e da CGI (Impressão Clínica Global. A análise dos itens 4, 5 e 6 da HAM-D 17 foi utilizada para a avaliação do sono dos pacientes. Avaliaram-se a segurança e a tolerabilidade da fluvoxamina ao longo das 6 semanas, registrando-se quaisquer eventos adversos. A fluvoxamina foi inicialmente ministrada em doses de 50 ou 100 mg/dia, podendo haver aumentos progressivos até 300 mg/dia. RESULTADOS: Dos 104 pacientes incluídos, 81 (78% concluíram o estudo. Obtiveram resposta favorável (diminuição de 50% ou mais na HAM-D 17 69% dos pacientes, e a taxa de remissão (HAM-D 17 OBJECTIVE: This research studied the efficacy and tolerability of fluvoxamine in the treatment of major depressive disorder (MDD, during 6 weeks, in an open trial, without placebo or active comparator. A secondary objective was the evaluation of the effects of fluvoxamine on the sleep of the pacients. METHODS: 104 patients were inicially included, with the diagnosis of MDD in accordance to the criteria of the Diagnostic and Statistical Manual for Mental Disorders, 4th edition (DSM-IV. Patients should have scores > 17 in the Hamilton Depression Scale for Depression 17 itens (HAM-D 17. The efficacy of fluvoxamine was studied through the HAM-D 17 and CGI (Clinical

  12. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  13. Ar + NO microwave plasmas for Escherichia coli sterilization

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  14. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  15. MEIS1 functions as a potential AR negative regulator

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  16. MEIS1 functions as a potential AR negative regulator

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  17. Argon defect complexes in low energy Ar irradiated molybdenum

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  18. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  19. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  20. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  1. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  2. SUMER-IRIS Observations of AR11875

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  3. Vaporization of the Ar+Ni system

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  4. The Spectroscopic study of 33Ar

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  5. Dicty_cDB: FC-AR10 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  6. Dicty_cDB: FC-AR05 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  7. Dicty_cDB: FC-AR16 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  8. Dicty_cDB: FC-AR17 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  9. Dicty_cDB: FC-AR01 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  10. Dicty_cDB: FC-AR23 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  11. ??Es posible ense??ar emprendimiento?

    Guti??rrez Molina, Catalina; Jaramillo ??ngel, Alejandro

    2015-01-01

    El emprendimiento se ha convertido en una de las principales oportunidades de desarrollo econ??mico para los pa??ses subdesarrollados debido a su capacidad de innovaci??n y generaci??n de empleo; por eso, en a??os recientes gobiernos, grandes corporaciones y universidades han revisado desde diferentes visiones y programas la manera de fomentar y apoyar a los emprendedores como parte del tejido empresarial y social -- En Colombia, el Congreso expidi?? la ley 1014 de 2006 con el fin de fomentar...

  12. Low-order AO system in LAMOST

    Yuan, Xiangyan; Cui, Xiangqun; Liu, Genrong; Zhang, Yong; Qi, Yongjun

    2006-06-01

    The large sky area multi-object fiber spectroscopic telescope (LAMOST) is a special reflecting Schmidt telescope with its main optical axis on the meridian plane tilted by an angle of 25° to the horizontal. The clear aperture is 4m, working in optical band. The light path is 60m long when working in observing mode and it will be doubled if work in auto-collimation mode. So the image quality is affected clearly by the ground seeing and the dome seeing. In order to improve the seeing condition of the long light path, we enclosed the spherical primary and the focus unit in a tunnel enclosure and cooled the tunnel. This is an effective but passive method. Corresponding experiments and simulations show the main part of the aberrations caused by the ground seeing and dome seeing is slowly changed low order items such as tip-tilt, defocus, astigmatism, coma and spherical aberration. Thus we plan to develop the low-order AO system based on the low-cost 37-channel OKO deformable mirror for the telescope to better the ground seeing and the dome seeing, not aimed to reach diffraction limited image. This work is being carried on now.

  13. Adesao ao guia alimentar para populacao brasileira

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  14. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  15. Contributions to the 37Ar background by research reactor operations

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  16. Atividade colinesterásica cerebral e comportamento de ratos após exposição perinatal ao diclorvós Brain cholinesterase activity and the behavior of rats after perinatal exposure to dichlorvos

    Jaqueline Pérola de Souza

    2006-04-01

    Full Text Available O organofosforado diclorvós impregnado em coleiras plásticas é um recurso utilizado em medicina veterinária que visa ao controle de ectoparasitas de cães e gatos. O objetivo deste trabalho foi avaliar os efeitos do uso de coleiras plásticas impregnadas com diclorvós (8,37% em ratas Wistar durante o período de gestação e lactação, como possível fonte de alterações comportamentais e da atividade colinesterásica cerebral dos filhotes. Na desmama, não houve diferença na atividade colinesterásica cerebral entre as mães tratadas com diclorvós e o grupo controle, bem como entre os respectivos filhotes. O tratamento com diclorvós também não influenciou no comportamento geral dos animais, avaliado no campo aberto, nem no nível de ansiedade testado no labirinto em cruz elevado, ambos aos 35 dias pós-natal.The organophosphate dichlorvos impregnated into plastic collars (8.37% is used in veterinary practice as an alternative for the control of ectoparasites in dogs and cats. The aim of this work was to determine the possible toxic effects of these collars in female Wistar rats during pregnancy and lactation, as a possible cause of alterations in brain cholinesterase activity and behavior of offspring. At weaning, there was no difference in brain cholinesterase activity between control and treated dams, nor between their respective offspring as well. The treatment did not affect the general behavior of the offspring, when evaluated in the open field, nor anxiety in the elevated plus-maze, both evaluated on the 35th postnatal day.

  17. Conservação de rúcula minimamente processada produzida em campo aberto e cultivo protegido com agrotêxtil Conservation of minimally processed rocket produced under open field conditions and non woven polypropylene

    Angela F Gonzalez

    2006-09-01

    Full Text Available Folhas de rúcula produzidas em campo aberto e sob cultivo protegido com agrotêxtil foram minimamente processadas, embaladas inteiras ou picadas em bandejas de poliestireno expandido e cobertas com filme de PVC de 14 micras. O delineamento adotado foi o inteiramente casualizado em esquema fatorial 2x2x2 (ambiente de cultivo, forma de preparo e refrigeração a 0(0C e 10(0C, com quatro repetições por tratamento, totalizando 32 bandejas. Os tratamentos foram armazenados a 0ºC e 10ºC por 10 dias, quando foram avaliadas as variáveis perda de massa (%; pH; sólidos solúveis; acidez titulável; cor e aparência. A conservação a 0ºC promoveu uma diminuição da perda de peso da rúcula minimamente processada. A utilização de folhas inteiras ou minimamente processadas foi significativa para sólidos solúveis sendo os maiores valores encontrados para as folhas inteiras. Para folhas picadas observou-se valores de acidez significativamente maiores para as produzidas sob ambiente natural. Independente da forma de preparo, a rúcula produzida em ambiente natural apresentou menor valor de pH. A cor e aparência da rúcula não foram influenciadas pelos tratamentos.Leaves of rocket salad produced under open field and non woven polypropylene were minimally processed and packed entire or pricked in polyestyrene trays covered with PVC film of 14 micras. The treatments were stored at 0(0C and 10(0C per 10 days, when the variables weight loss (%; pH; soluble solids; titratable acidity; colour and appearance were evaluated. The conservation under 0(0C promoted a reduction of weight loss on rocket salad minimally processed. Using entire or minimally processed leaves were significant for soluble solids the biggest values being found for entire leaves. For pricked leaves bigger values of acidity were observed for the produced ones under natural environment. Independent of the preparation form rocket salad produced under natural environment presented minor

  18. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  19. Identification and analysis of ARS function of six plant MARs

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  20. Application of the antibiotic disk diffusion method to multivariate profiling of soil bacterial community: comparing the power to discriminate different soils and dimension of the discrimination with that of the Biolog method Aplicação do método de difusão de disco de antibiótico para traçar o perfil da comunidade bacteriana no solo: comparação de seu poder discriminatório e dimensão da discriminação em relação ao método Biolog

    Ryoichi Doi

    2003-12-01

    Full Text Available The antibiotic disk diffution (ADD method was compared with the Biolog method in terms of power to discriminate soils and dimension of the discrimination. Soils from a forest and a citrus field in Thailand were profiled with these methods. These methods differentiated the soils in the principal component score plots. Then, Wilk's lambda statistic was determined to estimate power of these methods to discriminate the soils. The ADD method scored Wilk's lambda of 0.003 (p = 0.144 and 0.000 (p=0.020, for direct and ratio-transformed calculation, respectively. The Biolog method recorded Wilk's lambda of 0.001 (p=0.067, 0.003 (p=0.144 and 0.035 (p=0.440, at 0.25, 0.50 and 0.75 average well color developments (AWCDs, respectively. The ADD method showed high discrimination power, or at least comparable to that of the Biolog method. Redundancy analysis (RDA resulted in ordination diagrams, which revealed a difference in dimension of the soil discrimination among the methods and the AWCDs. The soil environmental factors significantly related to the bacterial profiles at p=0.05 were: available phosphorus (ADD method and Biolog 0.25 AWCD, and pH (Biolog 0.50 and 0.75 AWCD. These results indicated that the profiling methods and the AWCDs revealed the multidimensionality of the discrimination. The possibility of the application of the ADD method to extraction of such pieces of information for effective land management was suggested.O método de Difusão de Disco de Antibiótico (ADD foi comparado ao método Biolog quanto ao seu poder de discriminar solos e quanto à dimensão da discriminação, analisando-se os solos de uma floresta e de um campo de cítricos na Tailândia. A diferenciação dos solos por esses métodos foi feita de acordo com o score plot do componente principal.Em seguida, determinou-se o valor de lambda de Wilk para estimar o poder discriminatório desses métodos. O método ADD resultou em lambda de Wilk de 0,003 (p=0,144 e 0,035 (p=0

  1. Plasma AR and abiraterone-resistant prostate cancer.

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  2. Behaviour of AR glass fibre for building structural applications

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  3. Opera ar drama... Aleksejus Kartavovas Vilniuje

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  4. Amando de olhos abertos: Emma Goldman e o dissenso político nos EUA Loving with open eyes: Emma Goldman and the political dissent in the Unites States

    Cecilia Azevedo

    2007-01-01

    Este artigo apresenta a trajetória de Emma Goldman, grande nome do anarquismo, pacifismo e feminismo nos EUA, procurando apresentá- la como uma representante da chamada tradição de dissenso neste país que, ao longo de toda sua história, tem disputado os sentidos a serem atribuídos aos ideais nacionais. Em meio à atual guerra no Iraque, a memória e o legado de Emma Goldman vêm sendo recuperados no embate político em torno do sentido do americanismo.This article presents the life of Emma Goldma...

  5. First closed-loop visible AO test results for the advanced adaptive secondary AO system for the Magellan Telescope: MagAO's performance and status

    Close, Laird M.; Males, Jared R.; Kopon, Derek A.; Gasho, Victor; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Uomoto, Alan; Hare, Tyson; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Busoni, Lorenzo; Arcidiacono, Carmelo; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando; Argomedo, Javier

    2012-07-01

    The heart of the 6.5 Magellan AO system (MagAO) is a 585 actuator adaptive secondary mirror (ASM) with response times (0.7 ms typically). This adaptive secondary will allow low emissivity and high-contrast AO science. We fabricated a high order (561 mode) pyramid wavefront sensor (similar to that now successfully used at the Large Binocular Telescope). The relatively high actuator count (and small projected ~23 cm pitch) allows moderate Strehls to be obtained by MagAO in the “visible” (0.63-1.05 μm). To take advantage of this we have fabricated an AO CCD science camera called "VisAO". Complete “end-to-end” closed-loop lab tests of MagAO achieve a solid, broad-band, 37% Strehl (122 nm rms) at 0.76 μm (i’) with the VisAO camera in 0.8” simulated seeing (13 cm ro at V) with fast 33 mph winds and a 40 m Lo locked on R=8 mag artificial star. These relatively high visible wavelength Strehls are enabled by our powerful combination of a next generation ASM and a Pyramid WFS with 400 controlled modes and 1000 Hz sample speeds (similar to that used successfully on-sky at the LBT). Currently only the VisAO science camera is used for lab testing of MagAO, but this high level of measured performance (122 nm rms) promises even higher Strehls with our IR science cameras. On bright (R=8 mag) stars we should achieve very high Strehls (>70% at H) in the IR with the existing MagAO Clio2 (λ=1-5.3 μm) science camera/coronagraph or even higher (~98% Strehl) the Mid-IR (8-26 microns) with the existing BLINC/MIRAC4 science camera in the future. To eliminate non-common path vibrations, dispersions, and optical errors the VisAO science camera is fed by a common path advanced triplet ADC and is piggy-backed on the Pyramid WFS optical board itself. Also a high-speed shutter can be used to block periods of poor correction. The entire system passed CDR in June 2009, and we finished the closed-loop system level testing phase in December 2011. Final system acceptance (

  6. Sensibility of different wheat varieties (strains) to Ar+ implantation

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  7. Practical reactor production of {sup 41}Ar from argon clathrate

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  8. Hyperdeformed band in the 36Ar nucleus?

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  9. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  10. VARIABILIDADE TEMPORAL DA TEMPERATURA DO AR EM JABOTICABAL – SP

    GARCIA, Anice

    2015-05-01

    Full Text Available The study aimed to obtain a monthly average temperature equation estimated from the analysis of the variability of temperatures (maximum, average and minimum, to Jaboticabal /SP. The analysis of the parameters was made monthly, seasonal, annual and interannual. Data (1971-2013 were collected in a Agrometeorological Station of the Universidade Estadual Paulista (UNESP at Jaboticabal Campus(Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. On the data were applied statistical methods (mean, standard deviation and coefficient of variation. Were also correlated the monthly averages obtained by the standard method (INMET and by the method of extreme temperatures. The results showed that standard deviation of the temperatures had a slow variations with low coefficient of variation. The equations obtained between the mean values of standard INMET and the mean of the extreme, can be used for micro region of Jaboticabal with good accuracy in results. Este estudo teve como objetivo analisar a variabilidade de temperatura e obter uma equação mensal de estimativa de temperatura média do ar a partir da análise das temperaturas (máxima, média e mínima, para Jaboticabal –SP. A análise dos elementos foi feita mensal, sazonal, anual e interanualmente. Os dados, referentes ao período de 1971 a 2013, foram coletados na Estação Agroclimatológica da Universidade Estadual Paulista (UNESP – Campus de Jaboticabal (Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. Sobre os dados foram aplicados métodos estatísticos (média, desvio padrão e coeficiente de variação. Foram, também, correlacionadas as médias mensais obtidas pelo método padrão (INMET e pelo método das temperaturas extremas. Os resultados obtidos mostraram que os desvios das temperaturas (máximas, medias e mínimas tiveram variações discretas com consequentes coeficientes de variação baixos para os elementos estudados. As equações obtidas entre as m