WorldWideScience

Sample records for abanico argopecten purpuratus

  1. Morphological alterations in cryopreserved spermatozoa of scallop Argopecten purpuratus Alteraciones morfológicas en espermatozoides criopreservados de concha de abanico Argopecten purpuratus

    Carlos Espinoza

    2010-01-01

    Full Text Available The present work identifies and quantifies the morphological alterations of scallop Argopecten purpuratus spermatozoa caused by long-term cryopreservation. Percentages of motility, fertilization and injured spermatozoa were quantified by optic microscopy and scanned electron microscopy. These parameters were evaluated in sperm without treatment (CTR, spermatozoa incubated in cryoprotective solution but not freezed (ICS and freezed-thawed spermatozoa (FTS. Spermatozoa of ICS treatment remained motile longer than those of CTR, whereas those of FTS treatment were lowest. Morphology of the spermatozoa was affected in several ways by the freeze-thawing treatment; some had their head deformed or swollen, others had their cell membrane folded or broken; acrosome reaction; anomalous positions or absence of mitochondria as well as broken, stiff or loss of lineal structure of tail. CTR and ICS treatments had higher percentages of undamaged sperm (87.7% and 79.0% respectively, while FTS samples had 14.2% of undamaged sperm. The tail was the spermatic structure most commonly injured in FTS (77.0%, the percentage of sperm with head injury was 55.1% and with acrosome reaction was 28.7%, whereas middle piece was affected in 23.9% of sperm. Percentages of fertilization were 68.3%, 67.9% and 58.2% for CTR, ICS and FTS respectively, which were not significantly different. There was a higher correlation between injuries and motility than between injuries and fertilization success. Correlation between motility and fertilization was low (0.605 and 0.668 with motility at 5 and 30 min, respectively.El presente trabajo identifica y cuantifica las alteraciones morfológicas en espermatozoides de concha de abanico A. purpuratus causadas por la criopreservación en nitrógeno líquido. Porcentajes de motilidad, fecundación de ovocitos frescos y espermatozoides lesionados (en cabeza, acrosoma, pieza media y flagelo fueron determinados bajo microscopía óptica y electr

  2. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) in laboratory condition

    Lucio Encomendero; Enrique Dupré

    2003-01-01

    Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por ...

  3. Inactivation of Vibrio cholerae O1 El Tor inoculated into Peruvian ''choro'' mussels (Aulacomya ater) and two species of clams (Argopecten purpuratus and Gari solida) using medium-dose irradiation

    The radiation decimal reduction dose (D10) for Vibrio cholerae O1 biotype El Tor inoculated through the natural feeding system into three species of bivalve mollusks from the Peruvian Pacific coast: ''choro'' mussels (Aulacome ater), ''abanico'' clams (Argopecten purpuratus), and common clams (Gari solida), was determined in vivo. The D10 value obtained in vivo was 0.14 kGy in all mollusks tested. Concurrent studies conducted to determine the potential use of irradiation to extend the microbiological shelf-life of the mollusks during post-irradiation storage at 0-1 deg. C indicated that a dose of 1.0 kGy was optimal for choro mussels and abanico clams, whereas 2.0 kGy produced the best results when treating common clams. Shelf-life extension thus achieved was 31 days for choro mussels, 16 days for abanico clams, and 21 days for common clams. Non-irradiated control samples of all mollusks spoiled after 17 days of refrigerated storage. There were no significant (p<.05) adverse effects from the application of the optimal radiation treatments on the sensory characteristics (i.e. appearance, odor, flavor, and texture) of the mollusks. Total volatile basic nitrogen (VBN) and pH values were examined for use as indexes of seafood freshness. (author)

  4. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification

    Ramajo, Laura

    2015-12-08

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.

  5. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification.

    Ramajo, Laura; Marbà, Núria; Prado, Luis; Peron, Sophie; Lardies, Marco A; Rodriguez-Navarro, Alejandro B; Vargas, Cristian A; Lagos, Nelson A; Duarte, Carlos M

    2016-06-01

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers. PMID:26644007

  6. Congelamiento de espermatozoides de Argopecten pupuratus Congelamiento de espermatozoides del ostión del norte Argopecten purpuratus mediante congelador mecánico Freezing of spermatozoa of the scallop Argopecten purpuratus using a mechanical freezing system

    Enrique Dupré

    2004-11-01

    Full Text Available El congelamiento de espermatozoides es una técnica utilizada en acuicultura que permite almacenar los excedentes que fueron obtenidos durante la época reproductiva, para utilizarlos posteriormente. El proceso de criopreservación, requiere disminuir la temperatura gradualmente y de manera controlada para minimizar los daños ocasionados por el choque osmótico o por formación de cristales de hielo, lo cual es difícil lograr en terreno donde no se dispone de un equipo automático para realizarlo. Este estudio presenta un dispositivo manual portátil que permite descender gradualmente la temperatura, permitiendo repetir en forma exacta cada uno de los protocolos cada vez que se requiera. El equipo consta de un termo Dewar para nitrógeno líquido, un sistema de poleas graduadas, una placa porta-muestras de acrílico y un termómetro para bajas temperaturas. Para verificar su eficiencia, se procedió a criopreservar trozos de la parte masculina de la gónada de Argopecten purpuratus a diferentes tasas de congelamiento (1,1; 2,2; 4,6; 6,5; 8,8; 12,9; 19,2; 32,2 y 96,5 C°min-1. Se utilizó una solución crioprotectora compuesta por leche descremada liofilizada, ME2SO y sucrosa a una tasa de descongelamiento de 573°C·min-1. La tasa óptima de congelamiento fue de 8,8° C·min-1, con la cual se obtuvo 51,3 ± 6,6% de espermatozoides móviles. El congelador mecánico mostró ser eficiente para la criopreservación de espermatozoides de A. purpuratus a diferentes tasas de congelamiento, ya que permitió regular el descenso de las muestras en los vapores de nitrógeno líquido a diferentes velocidades

  7. Artificial collection and early growth of spat of the scallop Argopecten purpuratus (Lamarck, 1819), in La Rinconada Marine Reserve, Antofagasta, Chile

    Avendaño D., Miguel; Cantillánez S., Marcela; Thouzeau, Gérard; Peña, Juan B.

    2007-01-01

    Artificial collection of early juveniles ("spat") of the scallop Argopecten purpuratus in Japanese-type collectors was evaluated between January 2001 and July 2002 in the La Rinconada Marine Reserve, Antofagasta, Chile. This area of Antofagasta Bay has in the past been noted for the retention of scallop larvae by local gyres, in which their numbers can vary between 89 and 34175 larvae m-3, producing larval sets of 400 to 15340 post-larvae (spat) per collector. The results showed no quantitati...

  8. The role of Argopecten purpuratus shells structuring the soft bottom community in shallow waters of southern Peru

    Lomovasky, Betina J.; Gamero, Patricia A.; Romero, Leonardo; Firstater, Fausto N.; Gamarra Salazar, Alex; Hidalgo, Fernando; Tarazona, Juan; Iribarne, Oscar O.

    2015-12-01

    Accumulation of Argopecten purpuratus shells often occurs after El Niño events in shallow waters of Independencia Bay (14°17‧S-76°10‧W; Pisco, Peru). Here we experimentally investigate the effects of their shell accumulation on macrobenthos assemblages in soft bottom, shallow areas of the bay. A field experiment (from May 2006 to May 2007), including four treatments with different coverage levels of empty shells of A. purpuratus, were randomly arranged in: (1) areas devoid of shells ("Empty" treatment: experimental control), (2) 50% of the plot area covered with shells haphazardly distributed over the bottom ("medium" treatment), (3) 100% of the plot area covered with shells, forming a 10 cm valve layer ("full" treatment) and (4) "natural control". We found a total of 124 taxa throughout the experiment. Polychaetes, crustaceans and mollusks were the most abundant groups in "natural controls", dominated by the gastropod Nassarius gayi and the polychaetes Prionospio peruana, Platynereis bicanaliculata and Mediomastus branchiferus. The abundance of individuals (N) and the species richness (S) were higher in the "medium" treatment, but only in one month under positive sea bottom thermal anomalies. Similarity analysis (Bray-Curtis) showed that "natural control", "empty" and "full" treatments were more similar among them than the "medium" treatment. Multidimensional analysis showed no clear species association among treatments and a higher grouping among the samplings of Jun-06, Aug-06 and Nov-06. Our results also showed that the commercial crab Romaleon polyodon and the polyplacophora Tonicia elegans were positively affected by shell accumulations ("medium" treatment), while the limpet Fissurella crassa was negatively affected. Our study shows that directly by changing habitat structure or indirectly by changing sediment characteristics, the addition of scallop shells to the soft bottom can modify the macrobenthic assemblage; however, the seasonal oceanographic

  9. Elimination of vibrio cholerae El Tor, in scallops (Argopecten purpuratus) by gamma radiation and product organoleptic evaluation

    V. cholerae D10 value in scallops (Argopecten purpuratus) was determined in vivo. D10 was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1o), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13th day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18th day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors)

  10. Temperatura superficial del mar de satélites NOAA y captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile Sea surface temperature of NOAA satellites and seeds' yield of Argopecten purpuratus in Bahía Inglesa, Chile

    Dinko Galeno D.

    1999-01-01

    Full Text Available Se analiza la relación entre la temperatura superficial del mar (TSM y los rendimientos en la captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile (27°07'S-70°54'W. La TSM del área de captación se estima a partir de datos de satélites NOAA. Se deduce un modelo de regresión exponencial que relaciona dichos rendimientos con la TSM de tres meses previos (R²=74%The relationship between the sea surface temperature (SST and seed-collection's yield of Argopecten purpuratus is analized in Bahía Inglesa, Chile (27°07'S-70°54'W. The SST of the collection area is estimated from NOAA's satellites data. An exponential regression model that relate the yield collection with the 3 months previous SST it deduced (R²=74%

  11. Comparación del crecimiento de Argopecten purpuratus entre cohortes obtenidas de captación de larvas en ambiente natural y de hatchery Comparison of growth among cohorts obtained Argopecten purpuratus larval recruitment in natural and hatchery

    Eduardo P Pérez

    2012-11-01

    Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005

  12. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae in laboratory condition

    Lucio Encomendero

    2003-01-01

    Full Text Available Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por períodos de 6, 12 y 18 días con flujo de agua filtrada a 50 mm. A cada sustrato con biofilm de diferentes edades (6, 12 y 18 días o sin él, contenidos en un recipiente con 300 mL de agua de mar filtrada, se le agregaron 200-300 larvas competentes. Después de 72 h en condiciones de laboratorio (15,3-18,6°C, se contó el número de larvas asentadas. Se determinó que el tipo de sustrato influye en la intensidad del asentamiento larval del ostión. Los mayores asentamientos se obtuvieron sobre asbesto-cemento (29,6-62,3%; seguidos por malla mosquitera (17,1-21,2% y concha de ostión (13-30%. Los niveles más bajos se obtuvieron sobre el netlón (4,3-15,2%. También se observó una relación directa entre el porcentaje de asentamiento larval y la edad del biofilm excepto en asbesto-cemento. El tipo de sustrato y la edad del biofilm mostraron un efecto sinérgico sobre la intensidad del asentamiento larvalThe effects of different types of substrate and of primary biofilm formed on them in relation to their capacity to attract settlement of competent larvae of the northern scallop Argopecten purpuratus, was studied. The hypothesis that different substrates permit the formation of different biofilm over time, which affect the intensity of scallop larval settlement on each different substrate, was tested. Substrates including Netlon @, fly screen, scallop shell, and asbestos-cement were incubated in 50 mm-filtered flowing sea water to allow formation

  13. Crecimiento y estructura demográfica de Argopecten purpuratus en la Reserva Marina La Rinconada, Antofagasta, Chile

    2005-01-01

    Full Text Available Se presentan los parámetros de crecimiento L∞ = 120.38 mm y K = 0.9668 para el banco de Argopecten purpuratus de la Reserva Marina La Rinconada (Antofagasta, Chile, obtenidos entre marzo de 2001 y mayo de 2003 usando métodos de marcaje y recaptura de ejemplares. La elevada recaptura de individuos marcados (60–80% indica baja mortalidad natural y una conducta sedentaria del recurso. Las evaluaciones anuales realizadas para estimar el tamaño del banco confirmaron tal conducta, encontrándose la mayoría de los individuos agregados en el centro, con densidades que variaron entre años de 9 a 14.8 ind m–2. La abundancia de ejemplares también mostró variabilidad interanual, con cifras de 10.1 × 106 en 2001, 8.2 × 106 en 2002 y 12.4 × 106 en 2003. Estas evaluaciones mostraron, además, una disminución en la talla media de la estructura demográfica del banco entre un año y otro, reduciéndose de 75.8 mm en 2001 a 62.1 mm en 2002 y a 51.7 mm en 2003. Esta disminución también ocurrió con el número de ejemplares mayores o iguales a la talla mínima legal (90 mm, reduciéndose de 2.6 × 106 ejemplares presentes en 2001 a 3.7 × 105 ejemplares en 2003. La aplicación de los parámetros de crecimiento sobre la estructura poblacional del banco entre 2002 y 2003 señaló la integración de una nueva clase anual de 6.5 × 106 de ejemplares en 2002 y de 11.2 × 106 de individuos en 2003. El descuento de estas cifras, del número total de ejemplares presentes en ambos años, demuestra una pérdida cercana a los 8.4 × 106 de ostiones en 2002 y de cerca de 7.0 × 106 de individuos en 2003. Estas pérdidas correspondieron a ejemplares con tallas superiores a los 60 mm, lo cual es corroborado con el análisis de la curva de captura realizado con el programa Fisat, cuyos resultados señalan una mortalidad Z = 2.15 en 2002 para el segmento de la población entre 67.5 y 115.5 mm, y Z = 3.08 en 2003 para el segmento de 64.3 a 112.5 mm. Los

  14. Molecular characterization of two ferritins of the scallop Argopecten purpuratus and gene expressions in association with early development, immune response and growth rate.

    Coba de la Peña, Teodoro; Cárcamo, Claudia B; Díaz, María I; Brokordt, Katherina B; Winkler, Federico M

    2016-08-01

    Ferritin is involved in several iron homoeostasis processes in molluscs. We characterized two ferritin homologues and their expression patterns in association with early development, growth rate and immune response in the scallop Argopecten purpuratus, a species of economic importance for Chile and Peru. Two ferritin subunits (Apfer1 and Apfer2) were cloned. Apfer1 cDNA is a 792bp clone containing a 516bp open reading frame (ORF) that corresponds to a novel ferritin subunit in A. purpuratus. Apfer2 cDNA is a 681bp clone containing a 522bp ORF that corresponds to a previously sequenced EST. A putative iron responsive element (IRE) was identified in the 5'-untranslated region of both genes. The deduced protein sequences of both cDNAs possessed the motifs and domains characteristic of functional ferritin subunits. Both genes showed differential expression patterns at tissue-specific and early development stage levels. Apfer1 expression level increased 40-fold along larval developmental stages, decreasing markedly after larval settlement. Apfer1 expression in mantle tissue was 2.8-fold higher in fast-growing than in slow-growing scallops. Apfer1 increased 8-fold in haemocytes 24h post-challenge with the bacterium Vibrio splendidus. Apfer2 expression did not differ between fast- and slow-growing scallops or in response to bacterial challenge. These results suggest that Apfer1 and Apfer2 may be involved in iron storage, larval development and shell formation. Apfer1 expression may additionally be involved in immune response against bacterial infections and also in growth; and thus would be a potential marker for immune capacity and for fast growth in A. purpuratus. PMID:27040527

  15. Evaluación en ambiente natural, del uso de biopelículas marinas en el asentamiento larval de Argopecten purpuratus (Lamarck, 1819 Evaluation in natural environment of use of marine biofilms, in the larval settlement of Argopecten purpuratus (Lamarck, 1819

    Marcela Cantillánez

    2010-01-01

    Full Text Available En una granja marina ubicada colindante con el área de reserva marina “La Rinconada” (Antofagasta, Chile, se evaluó el asentamiento larval del pectínido Argopecten purpuratus sobre colectores impregnados con películas multi-específicas, de las diatomeas Navicula sp. y Amphora sp., y de la cepa bacteriana NC1, aisladas desde colectores utilizados en captaciones comerciales de esta especie que presentaron altos índices de fijación, y que bajo condiciones controladas de criadero y laboratorio, han mostrando altos niveles de asentamiento larval. Los resultados obtenidos con el uso de estas biopelículas, sobre colectores instalados en forma paralela a los utilizados por la empresa para la captación de semilla con fines comerciales, no mostraron diferencias significativas entre los diferentes tratamientos probados y el control, respecto a las fijaciones ocurridas en un lapso de 30 días de inmersión. Se discute, debido a los tiempos que demandaron las larvas de la primera cohorte en asentarse sobre los colectores tratados, un posible reemplazo de las biopelículas utilizadas, por otra común en todos ellos y atractiva para el asentamiento de las larvas, como causa de la ausencia de efectos significativos de los tratamientos probados en el medio natural. Se recomienda la necesidad de establecer el tiempo de permanencia, en el ambiente natural, de las biopelículas impregnadas a los colectores en laboratorio.In a commercial farm located near the Marine Reserve “La Rinconada” (Antofagasta, Chile the larval settlement of Argopecten purpuratus on artificial collectors impregnated with multiespecific films of marine diatoms Navicula sp. and Amphora sp. and, bacterial strain NC1 were evaluated, These biofilms were isolates from artificial collector used in commercial activities with highest index of settlement in hatchery and laboratory conditions. The results to use this biofilms in collectors installed in same condition of commercial

  16. Molecular characterization of an inhibitor of NF-κB in the scallop Argopecten purpuratus: First insights into its role on antimicrobial peptide regulation in a mollusk.

    Oyanedel, D; Gonzalez, R; Flores-Herrera, P; Brokordt, K; Rosa, R D; Mercado, L; Schmitt, P

    2016-05-01

    Inhibitors of nuclear factor kappa B (IκBs) are major control components of the Rel/NF-κB signaling pathway, a key regulator in the modulation of the expression of immune-related genes in vertebrates and invertebrates. The activation of the Rel/NF-κB signaling pathway depends largely in the degradation of IκB proteins and thus, IκBs are a main target for the identification of genes whose expression is controlled by Rel/NF-κB pathway. In order to identify such regulation in bivalve mollusks, the cDNA sequence encoding an IκB protein was characterized in the scallop Argopecten purpuratus, ApIκB. The cDNA sequence of ApIκB is comprised of 1480 nucleotides with a 1086 bp open reading frame encoding for 362 amino acids. Bioinformatics analysis showed that ApIκB displays the conserved features of IκB proteins. The deduced amino acid sequence consists of a 39.7 kDa protein, which has an N-terminal degradation motif, six ankyrin repeats and a C-terminal phosphorylation site motif. Phylogenetic analysis revealed a high degree of identity between ApIκB and other IκBs from mollusks, but also to arthropod cactus proteins and vertebrate IκBs. Tissue expression analysis indicated that ApIκB is expressed in all examined tissues and it is upregulated in circulating hemocytes from scallops challenged with the pathogenic Gram-negative bacterium Vibrio splendidus. After inhibiting ApIκB gene expression using the RNA interference technology, the gene expression of the antimicrobial peptide big defensin was upregulated in hemocytes from non-challenged scallops. Results suggest that ApIκB may control the expression of antimicrobial effectors such as big defensin via a putative Rel/NF-κB signaling pathway. This first evidence will help to deepen the knowledge of the Rel/NF-κB conserved pathway in scallops. PMID:26993612

  17. Sobrevivencia y crecimiento de post-larvas de Argopecten purpuratus (Lamarck, 1819 en Bahía Inglesa, Chile: efectos del origen, distribución en la bahía y bacterioflora larval Postlarval survival and growth of Argopecten purpuratus (Lamarck,1819 in Bahia Inglesa, Chile: effects of origin, distribution in the bay and larval bacterioflora

    RUBÉN E. AVENDAÑO

    2001-09-01

    Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that

  18. Asociación entre la tasa de autofecundación y la frecuencia de larvas malformadas en poblaciones cultivadas del ostión del norte Argopecten purpuratus (Lamarck, 1819 Association between self-fertilization rates and the frequency of malformed larvae in farmed populations of the northern scallop Argopecten purpuratus (Lamarck, 1819

    Christopher Concha

    2011-07-01

    Full Text Available El incremento de la frecuencia de malformaciones y la reducción de la viabilidad y fecundidad suelen ser las primeras manifestaciones de la depresión por consanguinidad en animales. El ostión del norte, Argopectenpurpuratus (Lamarck, 1819, es una especie hermnafrodita funcional con autofecundación parcial y durante la reproducción artificial puede presentar altos grados de autofecundación. En este trabajo se analizó la asociación de la tasa de autofecundación con la frecuencia de larvas malformadas y la supervivencia larval. Se desovaron adultos maduros y se recogieron separadamente los gametos femeninos del 5° pulso de liberación en adelante y los masculinos. Los ovocitos fueron fecundados con espermatozoides de otro individuo, formando familias de hermanos completos. La tasa de autofecundación se verificó por la proporción de ovocitos que entra en división en una muestra de ellos sin fecundar. La tasa de autofecundación varió entre familias de 0 a 100%, con distribución de frecuencias normal. La proporción de larvas malformadas se distribuyó al azar entre las familias analizadas, pero se correlacionó negativamente, en forma moderada pero significativa, con la tasa de autofecundación y la temperatura media del cultivo. Los datos sugieren que la autofecundación en las familias de ostiones puede favorecer una mayor homeostasis del desarrollo larval.Increased frequencies of malformations and the reduction of viability and fecundity are some of the first manifestations of inbreeding depression in animals. The northern scallop, Argopecten purpuratus (Lamarck, 1819, is a functional hermaphrodite species with partial self-fertilization. During artificial reproduction, this species may present high degrees of self-fertilization. In this work, the association between the selfing rate and the frequency of larval malformations and survival were analyzed. Mature adults were spawned, and female and male gametes were collected

  19. Simulation model of the scallop (Argopecten purpuratus farming in northern Chile: some applications in the decision making process Modelo de simulación para el cultivo del ostión (Argopecten purpuratus en el norte de Chile: aplicaciones para la toma de decisiones

    Renato Molina

    2012-09-01

    Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din

  20. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819) con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819) and the survival, growth and larval development of their progenies

    Ricardo M García; Federico M Winkler

    2012-01-01

    Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo contro...

  1. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819 con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819 and the survival, growth and larval development of their progenies

    Ricardo M García

    2012-07-01

    Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the

  2. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú en junio del 2000

    Rita Cabello

    2013-06-01

    Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.

  3. Fanning the Optimal Breeze with an Abanico

    Goon, Grace; Marthelot, Joel; Reis, Pedro; MIT EGS Lab Team

    Flexible hand-held fans, or abanicos, are universally employed as cooling devices that are both portable and sustainable. Their to and fro axial motion about one's hand generates an airflow that increases the evaporation rate near the skin and refreshes. We study this problem in the context of fluid-structure interaction, through precision model experiments. We first characterize the elastic properties of a semi-circular thin plates with various thickness and evaluate their aerodynamic performance in a custom built apparatus. The air velocity profile that results from the flapping motion of the fan is characterized for different driving conditions. A systematic variation of the geometric and elastic parameters, along with an exploration of the parameter space of the periodic driving motion (amplitude and frequency), allows us to establish optimal design and operational conditions for maximal output of the generated airflow, while minimizing the input power.

  4. El efecto abanico y la paradoja del experto

    Gómez-Ariza, Carlos J.

    2010-01-01

    La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico). Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para i...

  5. El efecto abanico y la paradoja del experto

    Carlos J. Gómez-Ariza

    2010-09-01

    Full Text Available La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico. Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para integrar la información en estructuras complejas de información.

  6. The complete mitochondrial genome of Saxidomus purpuratus (Veneroida: Veneridae).

    Bao, Xiangbo; He, Chongbo; Gao, Xianggang; Li, Yunfeng; Gao, Lei; Jiang, Bing; Liu, Weidong

    2016-09-01

    In this study, the complete mitochondrial genome of Saxidomus purpuratus is determined, which is the first complete mitochondrial genome in the genus Saxidomus. The genome was of 19 637 bp in length, including 2 rRNAs, 22 tRNAs and 12 protein-coding genes with the order of ND3 and ND5 reversed. Maximum likelihood tree based on nucleotide sequences of 12 mitochondrial PCGs was constructed, in which S. purpuratus was clustered with 3 Meretrix species. The results are expected to provide useful data for species identification and further studies of the genus Saxidomus. PMID:26329595

  7. The genome of the sea urchin Strongylocentrotus purpuratus.

    SEA URCHIN GENOME SEQUENCING CONSORTIUM; SODERGREN E; WEINSTOCK GM; DAVIDSON EH; CAMERON RA; GIBBS RA; ANGERER RC; ANGERER LM; ARNONE MI; BURGESS DR; BURKE RD; COFFMAN JA; Dean, M.; ELPHICK MR; ETTENSOHN CA

    2006-01-01

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or ...

  8. Caracterización y modelo de abanicos aluviales en la cuenca Estefaniense de Rengos (Asturias

    Santos García, J. A.

    1989-08-01

    Full Text Available The Stephanian deposits of the Rengos Basin are studied in this paper from a sedimenlological point of view. Five lithostratigraphic units are stablished. They are organised in four megasequences which have been attributed lo minar tectonic movements on the northern border. Most of the infilling of the basin was relaled lo longitudinal input of alluvial sediments along former fluvial val1eys. Lateral supply of sediment was developed. After analysing lateral and vertical variations of these material in the first megasequence a transition from proximal lo and distal facies was deduced. The existence of a threshold in the Riolorno zone has been deduced. From the previous data we conclude that these materials deposited in alluvial fans. A model of fan and its dynamic evolution is proposed.En este trabajo se estudia la sedimentología de los depósitos estefanienses, de la cuenca de Rengas. Se establecen 5 unidades litoestratigráficas, dispuestas en 4 megasecuencias, atribuidas a pulsos tectónicos menores sobre el borde norte de la cuenca. El relleno de la cuenca, se realizó condicionado fundamentalmente por los aportes longitudinales de ríos de abanicos aluviales, a lo largo de antiguos valles, mientras que los aportes laterales presentan menor importancia. La variación lateral y vertical de los materiales, en la primera megasecuencia, queda representada por una transición de facies proximales a distales de abanicos aluviales. Se determina la presencia de un umbral en la zona de Riotorno. Finalmente, se establece un modelo de abanico aluvial y su evolución dinámica.

  9. The genome of the sea urchin Strongylocentrotus purpuratus.

    Sodergren, Erica; Weinstock, George M; Davidson, Eric H; Cameron, R Andrew; Gibbs, Richard A; Angerer, Robert C; Angerer, Lynne M; Arnone, Maria Ina; Burgess, David R; Burke, Robert D; Coffman, James A; Dean, Michael; Elphick, Maurice R; Ettensohn, Charles A; Foltz, Kathy R; Hamdoun, Amro; Hynes, Richard O; Klein, William H; Marzluff, William; McClay, David R; Morris, Robert L; Mushegian, Arcady; Rast, Jonathan P; Smith, L Courtney; Thorndyke, Michael C; Vacquier, Victor D; Wessel, Gary M; Wray, Greg; Zhang, Lan; Elsik, Christine G; Ermolaeva, Olga; Hlavina, Wratko; Hofmann, Gretchen; Kitts, Paul; Landrum, Melissa J; Mackey, Aaron J; Maglott, Donna; Panopoulou, Georgia; Poustka, Albert J; Pruitt, Kim; Sapojnikov, Victor; Song, Xingzhi; Souvorov, Alexandre; Solovyev, Victor; Wei, Zheng; Whittaker, Charles A; Worley, Kim; Durbin, K James; Shen, Yufeng; Fedrigo, Olivier; Garfield, David; Haygood, Ralph; Primus, Alexander; Satija, Rahul; Severson, Tonya; Gonzalez-Garay, Manuel L; Jackson, Andrew R; Milosavljevic, Aleksandar; Tong, Mark; Killian, Christopher E; Livingston, Brian T; Wilt, Fred H; Adams, Nikki; Bellé, Robert; Carbonneau, Seth; Cheung, Rocky; Cormier, Patrick; Cosson, Bertrand; Croce, Jenifer; Fernandez-Guerra, Antonio; Genevière, Anne-Marie; Goel, Manisha; Kelkar, Hemant; Morales, Julia; Mulner-Lorillon, Odile; Robertson, Anthony J; Goldstone, Jared V; Cole, Bryan; Epel, David; Gold, Bert; Hahn, Mark E; Howard-Ashby, Meredith; Scally, Mark; Stegeman, John J; Allgood, Erin L; Cool, Jonah; Judkins, Kyle M; McCafferty, Shawn S; Musante, Ashlan M; Obar, Robert A; Rawson, Amanda P; Rossetti, Blair J; Gibbons, Ian R; Hoffman, Matthew P; Leone, Andrew; Istrail, Sorin; Materna, Stefan C; Samanta, Manoj P; Stolc, Viktor; Tongprasit, Waraporn; Tu, Qiang; Bergeron, Karl-Frederik; Brandhorst, Bruce P; Whittle, James; Berney, Kevin; Bottjer, David J; Calestani, Cristina; Peterson, Kevin; Chow, Elly; Yuan, Qiu Autumn; Elhaik, Eran; Graur, Dan; Reese, Justin T; Bosdet, Ian; Heesun, Shin; Marra, Marco A; Schein, Jacqueline; Anderson, Michele K; Brockton, Virginia; Buckley, Katherine M; Cohen, Avis H; Fugmann, Sebastian D; Hibino, Taku; Loza-Coll, Mariano; Majeske, Audrey J; Messier, Cynthia; Nair, Sham V; Pancer, Zeev; Terwilliger, David P; Agca, Cavit; Arboleda, Enrique; Chen, Nansheng; Churcher, Allison M; Hallböök, F; Humphrey, Glen W; Idris, Mohammed M; Kiyama, Takae; Liang, Shuguang; Mellott, Dan; Mu, Xiuqian; Murray, Greg; Olinski, Robert P; Raible, Florian; Rowe, Matthew; Taylor, John S; Tessmar-Raible, Kristin; Wang, D; Wilson, Karen H; Yaguchi, Shunsuke; Gaasterland, Terry; Galindo, Blanca E; Gunaratne, Herath J; Juliano, Celina; Kinukawa, Masashi; Moy, Gary W; Neill, Anna T; Nomura, Mamoru; Raisch, Michael; Reade, Anna; Roux, Michelle M; Song, Jia L; Su, Yi-Hsien; Townley, Ian K; Voronina, Ekaterina; Wong, Julian L; Amore, Gabriele; Branno, Margherita; Brown, Euan R; Cavalieri, Vincenzo; Duboc, Véronique; Duloquin, Louise; Flytzanis, Constantin; Gache, Christian; Lapraz, François; Lepage, Thierry; Locascio, Annamaria; Martinez, Pedro; Matassi, Giorgio; Matranga, Valeria; Range, Ryan; Rizzo, Francesca; Röttinger, Eric; Beane, Wendy; Bradham, Cynthia; Byrum, Christine; Glenn, Tom; Hussain, Sofia; Manning, Gerard; Miranda, Esther; Thomason, Rebecca; Walton, Katherine; Wikramanayke, Athula; Wu, Shu-Yu; Xu, Ronghui; Brown, C Titus; Chen, Lili; Gray, Rachel F; Lee, Pei Yun; Nam, Jongmin; Oliveri, Paola; Smith, Joel; Muzny, Donna; Bell, Stephanie; Chacko, Joseph; Cree, Andrew; Curry, Stacey; Davis, Clay; Dinh, Huyen; Dugan-Rocha, Shannon; Fowler, Jerry; Gill, Rachel; Hamilton, Cerrissa; Hernandez, Judith; Hines, Sandra; Hume, Jennifer; Jackson, Laronda; Jolivet, Angela; Kovar, Christie; Lee, Sandra; Lewis, Lora; Miner, George; Morgan, Margaret; Nazareth, Lynne V; Okwuonu, Geoffrey; Parker, David; Pu, Ling-Ling; Thorn, Rachel; Wright, Rita

    2006-11-10

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or known only outside the deuterostomes. This echinoderm genome provides an evolutionary outgroup for the chordates and yields insights into the evolution of deuterostomes. PMID:17095691

  10. A prokaryotic mycoplasma-like organism infection in the scallop Argopecten irradians

    ZHANG Weizhu; WU Xinzhong; SUN Jingfeng; LI Dengfeng

    2007-01-01

    Intracytoplasmic infection with a prokaryotic mycoplasma-like organism (MLO) were characterized in the scallop Argopecten irradians, and the first report of such infection in this scallop was represented. Ultrastructurally these microorganisms are usually pleomorphic and variable in morphology and size, and appear in several cell types such as small spherical body, rod-shaped bodies and longer filament-shaped body. They lack a cell wall. These observations revealed that these types of the prokaryote showed some characteristics of a mycoplasma-like organism (MLO). MLO reproduced in two ways: binary fission and budding. The results of isolation and purification showed that a large number of MLOs existed in the tissues of diseased scallops. The results of experimental infection revealed that the MLO is pathogenic to the scallop Argopecten irradians.

  11. Effect of E. coli coli on Anti-disease Activities of Scallops: Argopecten irradians

    2003-01-01

    The effect of acute E. coli challenge on the anti-disease activity of scallops Argopecten irradians is examined. The treatments of scallop from which hemolymph samples were taken for study included (1) control scallops, (2) sham-injected scallops, (3) PSW-injected scallops and (4) E. coli-injected scallops. From the beginning, the anti-disease activities of scallops are determined at 12 hr and 24 hr. The concentrations of circulating hemocytes, the total serum protein concentrations and the activities of alkaline phosphatase, acid phosphatase and superoxide dismutase in the scallops Argopecten irradians are determined. Injection with E. coli results in a significant elevation in the concentration of circulating hemocytes and in the alkaline phosphatase activity and a significant decline in the total serum protein concentration and in the superoxide dismutase activity at 24 hr postchallenge. It shows that metabolism of bay scallop is expedited to adopt the challenge.

  12. Los sistemas defensivos del castellum de Tamuda. ¿Torres de planta en abanico?

    Bermejo Meléndez, Javier

    2014-12-01

    Full Text Available The tamuda’s castle, situated next to Tetuan (Morocco, is one the best example of roman military architecture in the Mauritanians Provincies as much for his conservation as dates that we have thanks to the different campaigns developed to Spanish protectorate and today for the University of Huelva. One of more original aspects in this sense are the architectonics dates that we have of different areas of this castellum, specially about SE and NW towers traditionally adscript as fan, hypothesis that today must to be modified since exists news dates.El castellum de Tamuda, ubicado en las proximidades de la actual Tetuán (Marruecos, supone uno de los mejores ejemplos de arquitectura militar romana en las provincias mauritanas tanto por el grado de conservación como por los datos que hasta la fecha se tienen gracias a las campañas de excavación desarrolladas durante el periodo del protectorado español y las que actualmente se están llevando a cabo por parte de la Universidad de Huelva. Uno de los aspectos más novedosos a este respecto son los datos arqueoarquitectónicos que se desprenden del análisis paramental realizado en diversas partes de este campamento, de los cuales tendrán especial relevancia las torres SE y NO tradicionalmente adscritas como de abanico, planteamiento que a día de hoy debe ser modificado dado los nuevos datos con los que se cuentan.

  13. The sea urchin (Strongylocentrotus purpuratus test and spine proteomes

    Mann Karlheinz

    2008-08-01

    Full Text Available Abstract Background The organic matrix of biominerals plays an important role in biomineral formation and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin, which is an important model organism for developmental biology and biomineralization, only few matrix components have been identified and characterized at the protein level. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of possible matrix proteins at the gene level, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy, proteomic analysis. Results We identified 110 proteins as components of sea urchin test and spine organic matrix. Fourty of these proteins occurred in both compartments while others were unique to their respective compartment. More than 95% of the proteins were detected in sea urchin skeletal matrices for the first time. The most abundant protein in both matrices was the previously characterized spicule matrix protein SM50, but at least eight other members of this group, many of them only known as conceptual translation products previously, were identified by mass spectrometric sequence analysis of peptides derived from in vitro matrix degradation. The matrices also contained proteins implicated in biomineralization processes previously by inhibition studies using antibodies or specific enzyme inhibitors, such as matrix metalloproteases and members of the mesenchyme-specific MSP130 family. Other components were carbonic anhydrase, collagens, echinonectin, a α2-macroglobulin-like protein and several proteins containing scavenger receptor cysteine-rich domains. A few possible signal transduction pathway components, such as GTP-binding proteins, a semaphorin and a possible tyrosine kinase were also identified. Conclusion This report presents the most comprehensive

  14. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  15. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales UNAPAL - Abanico 75: new butternut squash cultivar, with high dry matter content in fruit for agribusiness purposes.

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.Using three diallel crosses among populations of butternut squash, with different levels of inbreeding (S0 x S0, (S1 x S1 y (S2 x S2, two hybrids and two inbred lines of butternut squash were selected, for its high dry matter content in fruit and plant production. Seven hybrid populations were formed from the selected genotypes. They are genetically stabilized by fraternal crossing and were evaluated in different environments of Valle del Cauca. Population one was selected, which presented a plant production between 29 to 32 kg; average fruit weight between 5 -6 kg; 4-5 fruit per plant; dry matter in fruit among 24-26%; globular form ribbed bright green external color and deep yellow to orange flesh color (12 to 14 Roche Fan. This population was registered in Institute Colombian Agropecuario ICA, under the name UNAPAL-Abanico-75.

  16. Marine Toxin Okadaic Acid Affects the Immune Function of Bay Scallop (Argopecten irradians).

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Yun, Saekil; Kim, Sang Guen; Park, Se Chang

    2016-01-01

    Okadaic acid (OA) is produced by dinoflagellates during harmful algal blooms and is a diarrhetic shellfish poisoning toxin. This toxin is particularly problematic for bivalves that are cultured for human consumption. This study aimed to reveal the effects of exposure to OA on the immune responses of bay scallop, Argopecten irradians. Various immunological parameters were assessed (total hemocyte counts (THC), reactive oxygen species (ROS), malondialdehyde (MDA), glutathione (GSH), lactate dehydrogenase (LDH), and nitric oxide (NO) in the hemolymph of scallops at 3, 6, 12, 24, and 48 h post-exposure (hpe) to different concentrations of OA (50, 100, and 500 nM). Moreover, the expression of immune-system-related genes (CLT-6, FREP, HSP90, MT, and Cu/ZnSOD) was also measured. Results showed that ROS, MDA, and NO levels and LDH activity were enhanced after exposure to different concentrations of OA; however, both THC and GSH decreased between 24-48 hpe. The expression of immune-system-related genes was also assessed at different time points during the exposure period. Overall, our results suggest that exposure to OA had negative effects on immune system function, increased oxygenic stress, and disrupted metabolism of bay scallops. PMID:27563864

  17. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians

    Cheng Chi

    2016-05-01

    Full Text Available Palmitoleic acid (PA, an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP activity, superoxide dismutase (SOD, lysozyme, phagocytic activity, total protein, malondialdehyde (MDA level, and reactive oxygen species (ROS production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe to PA. Lysozyme activity was lower in scallops at 12–48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6–12 hpe to 40–80 mg/L of PA, but decreased at 24–48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6–48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes.

  18. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians.

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Kim, Sang Guen; Yun, Saekil; Park, Se Chang

    2016-01-01

    Palmitoleic acid (PA), an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians) is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L) of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP) activity, superoxide dismutase (SOD), lysozyme, phagocytic activity, total protein, malondialdehyde (MDA) level, and reactive oxygen species (ROS) production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD) were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe) to PA. Lysozyme activity was lower in scallops at 12-48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6-12 hpe to 40-80 mg/L of PA, but decreased at 24-48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6-48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes. PMID:27171074

  19. Growth and survival larvae of Argopecten nucleus fed with different microalgae diets

    Yenia Katerine Carreño Hernández

    2012-06-01

    Full Text Available The influence of the diet on larval growth of the scallops Argopecten nucleus was studied, testing six microalgae diets composed by single-algae and mixed diets of the species Isochrysis galbana, Chaetoceros calcitrans y Tetraselmis suecica, handling a concentration per mL equivalent to 40000 cells of I. galbana and the response through the variables surviving, growth, appearance of the eye spot and state of condition (full, half-full and empty larvae was measured. The diets containing I. galbana showed greater results over all the measured variables, with regard to those where it was not present. In particular, the mixed diet I. galbana + C. calcitrans presented superiority over all variables, although in the most cases was statistically similar to I. galbana + C. calcitrans + T. suecica, I. galbana + T. suecica and I. galbana alone. For the opposite, the diets with the lowest results were C. calcitrans and C. calcitrans +T. suecica. The results obtained are principally attributed to the nutritional composition mainly of high unsaturated fatty acids (HUFA of each microalgae and each mixture supply, which is discussed in detail.

  20. Environmental economics reality check: a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project.

    Isla, Ana; Thompson, Shirley

    2003-01-01

    This paper presents a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project in the Arenal Conservation Area, Costa Rica. Microenterprise is the Sustainable Development and the Women in Development model for gender equity and environment of the World Bank, International Monetary Fund and large non-government organizations, like the World Wildlife Fund-Canada. The authors of this paper argue that debt-for-nature investment in microenterprise and ecological economic models are not distinct from neoclassical economic and development models that created the environmental, social and cultural crises in the first place. This case study shows that the world market accommodates only one model of development: unsustainable export-oriented production based on flexible labour markets, low wages, indebtedness and low cost production. Working standards in those micro-enterprises are eroded due to many factors,including indebtedness. What happened at a national level in non-industrial countries with the international debt crisis is now mirrored in individual indebtedness through microenterprise. Is current development policy creating a new form of indentured servitude? Medicinal plants, prior to commodification, were a source of women's power and upon commodification in international development projects, are the source of their exploitation. PMID:12859005

  1. Histamine is a modulator of metamorphic competence in Strongylocentrotus purpuratus (Echinodermata: Echinoidea

    Sutherby Josh

    2012-04-01

    Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We

  2. Structural characterization and mechanical behavior of a bivalve shell (Saxidomus purpuratus)

    The structure and mechanical behavior of Saxidomus purpuratus bivalve shell were investigated. XRD results show that the only form of calcium carbonate present in the shell is aragonite. The inner and middle layers have a cross-lamellar structure, while the outer layer has porosity and does not have tiles, but instead has 'blocky' regions. The hardness of middle and inner layer are close in both plane view and cross section, but the hardness of outer layer is significantly less, especially in the plane view. The compressive strengths with loading along the three orientations were established and significant differences were found. The Weibull strength at 50% of the probability of failure varies between 59 and 148 MPa and is dependent on the loading orientation and in condition of shell (dry vs. hydrated). These differences are interpreted in terms of the anisotropic structure and coarser structure of the external layer.

  3. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.Volcanic and volcaniclastic rocks grouped into the Farellones and Abanico formations make up most of the western Andean Main Range between 32° and 35°SL New 15 Ma Ar-Ar ages from the top of the latter formations show that the overlying succession, which locally onlaps eroded volcanic edifices, is diachronic. The calcalkaline Farellones volcanic activity started during the earliest

  4. Effects of chronic gamma radiation on the growth and survival of juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians)

    Juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians) from North Carolina were exposed to five intensities of chronic γ radiation for 3 to 14 months during 1973/1974. Exposure rates ranged downward from 37 rads/hr to levels slightly higher than background radiation. Deleterious effects on growth and survival of clams occurred only at the highest exposure rate (37 to 16 rads/hr). Clams exposed to low radiation levels (0.007 to 0.008 rads/hr) increased in weight, but not in length, faster than the controls. One-half of the clams exposed to the highest radiation level survived to 159 days, after a cumulative dose of 132 krads, and only 10 % survived to 14 months after a cumulative dose of 150 to 346 krads. No deleterious effects on growth and survival of scallops were apparent during 84 days of exposure to a cumulative radiation dose of 71.7 krads. (author)

  5. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.

  6. Estudios histológico e histoquímico del sistema digestivo de la almeja catarina Argopecten ventricosus (Sowerby, 1842)

    Cáceres, C.; Alarcón, F.J.

    2002-01-01

    Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...

  7. UNAPAL –Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Estrada Salazar Edgar Iván

    2010-09-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  8. "Spiral asters" and cytoplasmic rotation in sea urchin eggs: induction in Strongylocentrotus purpuratus eggs by elevated temperature

    1985-01-01

    "Spiral asters" composed of swirls of subcortical microtubules were recently described in fertilized eggs of the sea urchin Strongylocentrotus purpuratus. In our study, these structures did not occur at culture temperatures below 16 degrees C. When the culture temperature was elevated, however, "spiral asters" routinely appeared during a susceptible period before mitotic prophase when the sperm aster-diaster normally exists. A massive and protracted rotation of the cytoplasm (excluding an imm...

  9. Effects of produced water on gametogenesis and gamete performance in the purple sea urchin (Stronglyocentrotus purpuratus)

    The author examined the effects of a chronic exposure to produced water (an oil production effluent) discharge on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus) using an in situ caging experiment. Adult purple urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites with distances ranging from 5m to 1,000m. Cage exposures were maintained in the field for eight weeks and each cage held 25 urchins. Gametogenesis was examined for each sex by comparing a size-independent measure of gonad mass as determined by analysis of covariance. The author found that there was a significant negative relationship between gonad mass and cage distance for both sexes, indicating that urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetic bioassay that holds the concentration of eggs constant and varies the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a kinetics model. Significant differences were found in the fertilizability of eggs between cages. This showed a positive relationship with distance away from the outfall. The findings indicate that while adult urchins exposed to a produced water outfall produced larger gonads, they suffered a marked decreases in gamete performance

  10. Identification and developmental expression of the ets gene family in the sea urchin (Strongylocentrotus purpuratus).

    Rizzo, Francesca; Fernandez-Serra, Montserrat; Squarzoni, Paola; Archimandritis, Aristea; Arnone, Maria I

    2006-12-01

    A systematic search in the available scaffolds of the Strongylocentrotus purpuratus genome has revealed that this sea urchin has 11 members of the ets gene family. A phylogenetic analysis of these genes showed that almost all vertebrate ets subfamilies, with the exception of one, so far found only in mammals, are each represented by one orthologous sea urchin gene. The temporal and spatial expression of the identified ETS factors was also analyzed during embryogenesis. Five ets genes (Sp-Ets1/2, Sp-Tel, Sp-Pea, Sp-Ets4, Sp-Erf) are also maternally expressed. Three genes (Sp-Elk, Sp-Elf, Sp-Erf) are ubiquitously expressed during embryogenesis, while two others (Sp-Gabp, Sp-Pu.1) are not transcribed until late larval stages. Remarkably, five of the nine sea urchin ets genes expressed during embryogenesis are exclusively (Sp-Ets1/2, Sp-Erg, Sp-Ese) or additionally (Sp-Tel, Sp-Pea) expressed in mesenchyme cells and/or their progenitors. Functional analysis of Sp-Ets1/2 has previously demonstrated an essential role of this gene in the specification of the skeletogenic mesenchyme lineage. The dynamic, and in some cases overlapping and/or unique, developmental expression pattern of the latter five genes suggests a complex, non-redundant function for ETS factors in sea urchin mesenchyme formation and differentiation. PMID:16997294

  11. Contaminación de alimentos marinos por cadmio en Lima, 2015

    Gloria Marín Vallejos

    2015-12-01

    Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.

  12. Sedimentología y petrología de los abanicos aluviales y facies adyacentes en el Neogeno de Paracuellos de Jarama (Madrid

    Alonso, M.

    1986-06-01

    arcosas gruesas en el Conjunto Superior. Para el Conjunto Inferior se concluye unas relaciones de facies correspondientes a la progradación paulatina de depósitos propios de abanicos aluviales sobre depósitos palustres. Así mismo, el Conjunto Superior representa una progradación brusca de los sistemas de abanicos aluviales, con superposición de facies intermedias de estos abanicos sobre las facies más distales, que caracterizan el Conjunto Inferior. Dentro del contexto estratigráfico general de la Cuenca de Madrid, estas Unidades se incluyen básicamente en la Unidad Intermedia del Mioceno.
    La presencia de nivelesde calcreta, sepiolita y sílex en la parte más meridional de la sección es un hecho destacable en las partes más distales de los sistemas de abanicos aluviales y sU transición a las facies palustres. La gran abundancia de estos niveles en la zona, nos ha llevado a estudiar más específicamente los rasgos petrológicos de estos tipos de materiales, no siempre bien definidos en depósitos de ambiente continental.

  13. Molecular cloning of the first metazoan beta-1,3 glucanase from eggs of the sea urchin Strongylocentrotus purpuratus.

    Bachman, E S; McClay, D R

    1996-01-01

    We report the molecular cloning of the first beta-1,3 glucanase from animal tissue. Three peptide sequences were obtained from beta-1,3 glucanase that had been purified from eggs of the sea urchin Strongylocentrotus purpuratus and the gene was cloned by PCR using oligonucleotides deduced from the peptide sequences. The full-length cDNA shows a predicted enzyme structure of 499 aa with a hydrophobic signal sequence. A 3.2-kb message is present in eggs, during early embryogenesis, and in adult ...

  14. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Orlando Garrido; José Pino

    2014-01-01

    Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo q...

  15. Abanico East Formation: petrology and geochemistry of volcanic rocks behind the Cenozoic arc front in the Andean Cordillera, central Chile (33°50'S

    Marcia Muñoz

    2006-01-01

    Full Text Available The stratigraphy, chemistry and age of rocks assigned to the eastern portion of the Abanico Formation exposed along the El Volcán river valley, Principal Cordillera east of Santiago (30º50'S/70º12'-70º5'W, are reported and discussed. This ca. 3,300 m thick succession is mainly composed of basalts, basaltic andesites and volcaniclastic rocks. 40Ar/39Ar radiometric dates on plagioclase from the lava flows yield Oligocene-lower Miocene ages with a maximum age of 34.3 ±0.4 Ma for the lower part and a plateau age of 21.4±1.0 Ma for the upper part of the succession. The lava flows show calc-alkaline affinities and have chemical characteristics that are typical of arc volcanic rocks erupted in an active continental margin. A temporal chemical evolution in the sequence is indicated by upward increases in concentrations of LILE and LREE elements and LaN/YbN ratios. This pattern can be attributed to increasing contributions of fluids derived from the subducted lithosphere with time. A chemical comparison of these rocks with Oligocene-lower Miocene volcanic rocks from the Cerro Abanico and Chacabuco areas on the western border of the Principal Cordillera, east of Santiago, and at the northern end of the Central Depression reveals west to east compositional variations. From west to east these variations include: (1 increasing LILE and LREE concentrations, LaN/YbN ratios and Sr and Nd initial isotopic ratios, and (2 decreasing LILE/HFSE and LREE/HFSE ratios. These pattern can be attributed to a west to east decrease in the contribution of slab derived fluids and increase in the influence of crustal contamination processesLa formación Abanico Este: petrología y geoquímica de las rocas volcánicas detrás del arco Cenozoico en la Cordillera Andina, Chile central (33º50'S. Se presentan los resultados del estudio de la estratigrafía, química y edades de rocas asignadas a la franja oriental de la Formación Abanico expuestas en la ladera sur del R

  16. Phosphoproteomes of Strongylocentrotus purpuratus shell and tooth matrix: identification of a major acidic sea urchin tooth phosphoprotein, phosphodontin

    Mann Matthias

    2010-02-01

    Full Text Available Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the determination of test (shell and tooth organic matrix phosphoproteomes. Altogether 34 phosphoproteins were identified in the biomineral organic matrices. Most phosphoproteins were specific for one compartment, only two were identified in both matrices. The sea urchin phosphoproteomes contained several obvious orthologs of mammalian proteins, such as a Src family tyrosine kinase, protein kinase C-delta 1, Dickkopf-1 and other signal transduction components, or nucleobindin. In most cases phosphorylation sites were conserved between sea urchin and mammalian proteins. However, the majority of phosphoproteins had no mammalian counterpart. The most interesting of the sea urchin-specific phosphoproteins, from the perspective of biomineralization research, was an abundant highly phosphorylated and very acidic tooth matrix protein composed of 35 very similar short sequence repeats, a predicted N-terminal secretion signal sequence, and an Asp-rich C-terminal motif, contained in [Glean3:18919]. Conclusions The 64 phosphorylation sites determined represent the most comprehensive list of experimentally identified sea urchin protein phosphorylation sites at present and are an important addition to the recently analyzed Strongylocentrotus purpuratus shell and tooth proteomes. The identified phosphoproteins included a major, highly phosphorylated protein, [Glean3:18919], for which we suggest the name phosphodontin. Although not sequence-related to such highly phosphorylated

  17. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Orlando Garrido

    2014-06-01

    Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.

  18. Análisis markoviano de las sucesiones de abanicos aluviales de la cuenca de Madrid y de la depresión intermedia (Madrid y Guadalajara, España central)

    Torres Pérez-Hidalgo, Trinidad José de

    1996-01-01

    En este trabajo se aplica el análisis por cadenas de Markov a sucesiones estratigráficas del Neógeno de la Cuenca de Madrid y de la Depresión Intermedia. Los datos proceden de sondeos mecánicos de reconocimiento que atraviesan depósitos de abanico aluvial y de playa fangosa. El análisis por cadenas de Markov permite determinar la aparición de procesos repetitivos en el espacio y en el tiempo y, en el caso que nos ocupa, detectar aquellos estados (facies>, cuya aparición depe...

  19. Effects of increased pCO2 and geographic origin on purple sea urchin (Strongylocentrotus purpuratus calcite elemental composition

    J. D. Hosfelt

    2012-12-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (such as Mg and Sr into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore the effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low to high magnesium calcites. Mg/Ca and Sr/Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions along the US west coast (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg/Ca and Sr/Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg/Ca or Sr/Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 ppm; pH = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated CO2 (900 ppm; pH = 7.72 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr/Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr incorporation under elevated CO2

  20. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus

    Matthew C. Foster

    2015-01-01

    Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is

  1. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-01-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment. PMID:22822356

  2. Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) in relation to its reproductive cycle and the environmental condition of Sanggou Bay, China

    Bi, Jinhong; Li, Qi; Zhang, Xinjun; Zhang, Zhixin; Tian, Jinling; Xu, Yushan; Liu, Wenguang

    2016-04-01

    Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) was investigated from March 2012 to February 2013 in relation to environmental condition of Sanggou Bay and the reproductive cycle of clam. According to the histological analysis, the reproductive cycle of S. purpuratus includes two distinctive phases: a total spent and inactive stage from November to January, and a gametogenesis stage, including ripeness and spawning, during the rest of the year. Gametes were generated at a low temperature (2.1°C) in February. Spawning took place once a year from June to October. The massive spawning occurred in August when the highest water temperature and chlorophyll a level could be observed. The key biochemical components (glycogen, protein and lipid) in five tissues (gonad, foot, mantle, siphon and adductor muscle) were analyzed. The glycogen content was high before gametogenesis, and decreased significantly during the gonad development in the gonad, mantle and foot of both females and males, suggesting that glycogen was an important energy source for gonad development. The protein and lipid contents increased in the ovary during the gonad development, demonstrating that they are the major organic components of oocytes. The lipid and protein contents decreased in the testis, implying that they can provide energy and material for spermatogenesis. The results also showed that protein stored in the mantle and foot could support the reproduction after the glycogen was depleted.

  3. Análisis sedimentológico de la Cuenca estefaniense de Tineoo (Asturias. Ejemplo de depósitos de carbón en abanicos aluviales

    Santos García, J. A.

    1991-04-01

    septentrional, dando lugar a los depósitos de la U. Conglomerática. El relleno de la cuenca, se asimila con un modelo de abanicos aluviales en una cuenca tectónicamente activa, en la que los depósitos de carbón se relacionan con las facies más distales y las etapas de mayor tranquilidad, caracterizándose la existencia de un abanico principal y otros coalescentes de menor entidad.

  4. Effects of anthracene and UV-B radiation on larvae of Argopecten irradians%蒽和UV-B辐射增强对海湾扇贝早期发育的影响

    谭海丽; 王玉堃; 唐学玺; 周斌; 王其翔; 王悠

    2013-01-01

    The effects of anthracene and UV-B radiation on the early stage embryos development of benthos, and the single and joint a-cute toxicological effects of anthracene and UV-B radiation on the trochophore and D larvae of Argopecten irradians under the controlled laboratory conditions were studied. The results showed that with the increase of time and the anthracenes concentration or the increase of days and radiation does, the liabilities of the trochophore and D larvae declined. With the combination of anthracene and UV-B radiation , the liabilities of trochophore and D larvae were lower than those in the single action. Compared to D larvae, the trochophore was more sensitive to anthracene and UV-B radiation.%为了探讨蒽和UV-B辐射对底栖生物早期发育的影响,在实验生态学的条件下,选择海湾扇贝(Argopecten irradians)担轮幼虫和D型幼虫作为受试生物进行单一和联合急性毒性试验.结果表明:在实验的蒽浓度和UV-B辐射剂量下,随着蒽浓度和作用时间的增加,海湾扇贝担轮幼虫和D型幼虫的存活率逐渐降低;随着UV-B辐射剂量和辐射天数的增加,海湾扇贝担轮幼虫和D型幼虫存活率下降;在蒽和UV-B辐射共同作用对担轮幼虫和D型幼虫处理时,其两个发育阶段的存活率较两者单独作用的存活率均低很多;担轮幼虫较D型幼虫对蒽和UV-B辐射更敏感.

  5. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus calcite and potential effects of pCO2 during early life stages

    M. LaVigne

    2013-06-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr

  6. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus) calcite and potential effects of pCO2 during early life stages

    LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.

    2013-06-01

    Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr

  7. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Rosalba Alonso-Rodriguez

    2012-05-01

    Full Text Available The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2; after hydrolysis, the carbamate toxins (epimers GTX2/3 were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  8. 海湾扇贝组织蛋白酶L基因编码区的克隆和分析%Cloning and sequence analysis of cathepsin L gene from bay scallop Argopecten irradians

    李娟; 李莉; 张国范

    2011-01-01

    通过cDNA末端快速扩增技术(RACE),从海湾扇贝(Argopecten irradians)中克隆得到了组织蛋白酶L基因(AiCL)的编码区全长,为1095 bp,推测编码364个氨基酸.经比对与分析发现蛋白序列中存在4个组织蛋白酶L活性位点保守氨基酸:Q164,C170,H309,N329;6个极为保守的半胱氨酸残基:C167,C201,C210,C243,C302,C351.预测其N端17个氨基酸为信号肽序列,C端ASYPTV可能也是分泌信号.AiCL成熟蛋白分子由219个氨基酸构成,前体肽的切割位点预计在A145和M146之间.序列同源性分析中,AiCL蛋白序列与软体动物同源蛋白最为相似,序列一致性在50%以上,在系统进化树中与其它无脊椎动物组织蛋白酶L聚合到一起.通过SwISS-MODEL构建的AiCL成熟蛋白三维模型表明该蛋白空间结构高度保守.根据其序列特征,推测~CL可能具有水解多种肌蛋白的活性.%The complete open reading frame (ORF) of cathepsin L was obtained from bay scallop (Argopecten irradians) by RACE technique. The ORF was of 1 095 bp, encoding 364 amino acids. Four conserved residues for enzyme activity (Q164, C170, H309, N329) and six preserved cysteines were found in the protein sequence. 17 amino acids of N terminal were predicted to be the signal peptide and the sequence ASYPTV at C terminal was found to be a possible signal sequence. The mature protein of AICL contained 219 amino acids and the potential cleavage site was between A 145 and M 146. Analysis indicated AiCL shared the highest identities (>50%) with molluscan cathepsin Ls.It clustered with other invertebrate cathepsin Ls in the phylogenetic tree. The 3D-model predicted by SWISS-MODEL demonstrated that cathepsin L was conserved in tertiary structure. Collectively, data showed that AiCL was likely to catalyze the hydrolysis of multiple muscle related proteins.

  9. Permanent genetic resources added to molecular ecology resources database 1 august 2011-30 september 2011

    A'Hara, S.W.; Amouroux, P.; Argo, Emily.E.; Avand-Faghih, A.; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M.; Blatrix, R.; Blin, Aurelie; Bouktila, D.; Broome, A.; Burban, Christian; Capdevielle-Dulac, C.; Casse, N.; Chandra, Suresh

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procon...

  10. Nutritional improvement of the commercial production of marine aquaculture species through application of innovative biotechniques

    G Gajardo; Coutteau, P.; Curé, K.; Sorgeloos, P.; Beardmore, J.A.

    1996-01-01

    Marine aquaculture, particularly the salmon farming industry, has expanded very fast in Chile. Currently the country ranks second among the world leading salmon producers. However, there is a growing concern for the diversification of aquaculture activities. Examples are the cultures of flatfishes, either the introduced turbot (Scophthalmus maximus) or the native flounder species Paralichthys microps and P. adspersus, along with the native scallop, Argopecten purpuratus. Although both turbot ...

  11. Rapid species identification of fresh and processed scallops by multiplex PCR

    Marín, Alan; Fujimoto, Takafumi; Arai, Katsutoshi

    2013-01-01

    Food control policies regarding to seafood label authenticity have become a global issue due to increased incidence of species substitution or mislabelling. Proper species-level identification in processed scallop products is hindered by the lack of morphological characters such as their valves. In order to identify four commercially important scallop species (Argopecten purpuratus, A. irradians, Mizuhopecten yessoensis, Pecten albicans) a species-specific multiplex PCR reaction is described ...

  12. Deposición transversal de líquido de las boquillas de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales The transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions

    R.G. Viana

    2009-06-01

    Full Text Available El objetivo de este trabajo fue el de evaluar la deposición transversal de caldo de las boquillas pulverizadoras de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales. Se utilizaron 5 muestras de cada boquilla pulverizadora siendo considerada cada unidad, una repetición. La distribución de caldo fue evaluada por medio de una mesa de evaluación de distribución construida de acuerdo con la norma ISO 56821. Se evaluó el perfil de distribución individual, la distribución volumétrica simulada de la superposición de los chorros por medio del coeficiente de variación (CV% de los volúmenes colectados, el caudal y el ángulo de abertura de los chorros. Las condiciones operacionales fueron: presión de trabajo de 200, 300 y 400 Kpa, altura de 30, 40 y 50 cm en relación al blanco y espaciamiento entre boquillas simulados en Software (Microsoft Excel entre 45 y 100 cm. Las boquillas presentaron perfil individual descontinuo con la mayor deposición de líquido en la región central y reducción del volumen gradual en dirección a las extremidades. El aumento de la presión promovió alargamiento del perfil y de la franja de aplicación. Las boquillas proporcionaron perfil uniforme que dependió del espaciamiento entre las boquillas, con valores menores con reducción en el espaciamiento y en presiones mayores. El caudal y el ángulo del chorro aumentaron con el incremento en la presión.The objective of this work was evaluate the transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions. Was used five samples of each nozzle and considerate a unite one repetition. The spray deposition was evaluate on a table of evaluation distribution constructed in accordance with norm ISO 5682-1. Was evaluate a single spray distribution, volumetric distribution of the overlapping spurts by means of the coefficient of variation (CV%, outflow and angle of opening of the

  13. Abanicos aluviales cuaternarios del Baix Camp (provincia de Tarragona): resultados de dataciones radiométricas

    Villamarín, J. A.; Masana, E; Calderón, T.; Julià, Ramón; Santanach, P.

    1998-01-01

    The Quaternary fans which cover the southernmost part of the El Camp Basin belong to three generations. Noticeable calcrete levels developed on the top of fans from the first and second generation. Radiometric dating by means of U/Th and termolumiscence techniques of the mentioned caliche levels allow us to attribute a minimal age of ca. 300000 years to the top of the first generation fans, and ca. 100000 years to the top of the second generation alluvial fans

  14. Permanent genetic resources added to Molecular Ecology Resources Database 1 August 2011-30 September 2011.

    A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana. PMID:22136175

  15. PRODUCCIÓN DE ENZIMAS EXTRACELLARES POR BACTERIAS AISLADAS DE INVERTEBRADOS MARINOS

    Jorge León

    2014-06-01

    Full Text Available Con el fin de seleccionar las bacterias marinas con la capacidad de producir enzimas extracelulares ( CEE , se analizaron muestras de Argopecten purpuratus y Crassostrea gigas en el cultivo , así como de otros invertebrados interticlal y bentónicos. La selección de cepas de la CEE de productores se llevó a cabo en Agar Marino ( MA con la adición del sustrato relevante ( almidón , caseína , Tween - 80 , lecitina , ADN y gelatina . La CEE evaluación cepas productoras se llevó a cabo en 102 aislamientos . Los resultados muestran que las bacterias asociadas TOA . purpuratusand C. gigashave las mejores actividades multienzimáticos ; Sin embargo , Semimytilus algosus, Tetrapigus niger y Thais chocolata también son fuentes importantes de productores de bacterias de la CEE. La actividad multienzimático cualitativa en MA ( zonas claras u opacas alrededor de las colonias en mm de diámetro varió de 6 a > 16 mm . La frecuencia de la producción multienzimático fue caseinase 62,74 % , entre esterasa 57,84 % , 52,94 % de la amilasa , la gelatinasa 38,23 % , 33,3 % DNAsa , agarasa 5,43 % y 90,0 % lecitinasa . Los resultados sugieren la posibilidad de usar cepas nativas para fines biotecnológicos

  16. Taxonomy Icon Data: purple urchin [Taxonomy Icon

    Full Text Available purple urchin Strongylocentrotus purpuratus Echinodermata Strongylocentrotus_purpuratus_L.png Strongylocentr...otus_purpuratus_NL.png Strongylocentrotus_purpuratus_S.png Strongylocentrotus_purpu...ratus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NS ...

  17. Gene : CBRC-CJAC-01-0861 [SEVENS

    Full Text Available ein [Strongylocentrotus purpuratus] 4e-12 30% MGLSLGPKFLGGAFPRQGLPWAWFSLKGRWGGFPRVGLSLGGAFSGWGFLWVELSLDVAVSG...GFLWVELSLDGALPGWGFSGRGFPWVGLFLGRGFLGGAFPGRGFLWARLFLGEVFLGGAFPEWGFPWVGLFWVGFFPGWGFSWVRLFSGQGFSWVGLFWAGLFLSGSL...SGQGFSWVGLFSGQGFPWARLFLSGSLWVELFWMGYFSLGGAFPEQGFSWVGLFVGGAFLGGLFPWAWLSLSGAFPWVGLSGWSFFGWAFSLGGAFPGLVFFPVWAFLSWDLCIPGPCLVTSF ...

  18. The occurrence of domoic acid linked to a toxic diatom bloom in a new potential vector: the tunicate Pyura chilensis (piure).

    López-Rivera, Américo; Pinto, Maricela; Insinilla, Andrea; Suárez Isla, Benjamín; Uribe, Eduardo; Alvarez, Gonzalo; Lehane, Mary; Furey, Ambrose; James, Kevin J

    2009-11-01

    The tunicate Pyura chilensis (Molina, 1782); Phylum Chordata; Subphylum Urochordata; Class Ascidiacea, common local name "piure" or sea squirt; a filter-feeder (plankton and suspended particles) sessile species; may play an important role in monitoring domoic acid (DA) the principal toxic component of Amnesic Shellfish Poisoning (ASP). Significant DA concentrations have been determined in tunicate samples, collected during a recent ASP outbreak in Bahía Inglesa, an important scallop (Argopecten purpuratus) farming area. Several infaunal species were tested for the presence of DA, in addition to the usual scallop monitoring programme. DA was found at sub-toxic levels in filtering bivalves such as mussels (Mytilus chilensis), large mussels (Aulacomya ater) and clams (Protothaca thaca) (6.4, 5.4 and 4.7 microg DA/g tissue respectively). Of particular interest was the observation of significant accumulations of toxic Pseudo-nitzschia sp. diatoms in the internal siphon and atrium spaces of the tunicate. Toxin distribution within major tunicate organs was heterogeneous with 8.7-15.5 microg DA/g in edible tissues, 14.9-17.9 microg DA/g in the fecal material and 13.6-32.7 microg DA/g in the gut content. DA was determined by HPLC-UV and confirmed by diode-array detection and LC-MS/MS analysis. This is the first report of the presence of DA in a tunicate that is regularly consumed by coastal populations. These results confirm the need to include these organisms in sanitation programs for marine toxins. PMID:19505493

  19. NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS

    Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...

  20. NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS

    Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS

    Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...

  2. Poliploidia en moluscos de importancia comercial (almeja catarina Argopecten ventricosus Sowerby ii, 1842; almeja mano de leon Nodipecten subnodosus Sowerby 1835; y abulón rojo Haliotis rufescens Swainson 1822)

    Maldonado, R.

    2003-01-01

    La poliploidía ha sido una de las biotecnologías más empleadas en la ultima década para el mejoramiento genético de moluscos bivalvos por ser una de las mejores alternativas a corto plazo para incrementar la producción. Los organismos triploides presentan tres juegos completos de cromosomas homólogos que afectan la sinapsis, lo cual da como resultado una esterilidad parcial o total, la cual teóricamente repercute favorablemente en el crecimiento. Sin embargo, la inducción a la triploidía pres...

  3. Estratigrafía secuencial de sistemas deltaicos en cuencas de antepaís: ejemplos de Sant Llorenç del Munt, Montserrat y Roda (Paleógeno: cuenca de antepaís surpirenaica)

    López Blanco, Miguel

    1996-01-01

    [spa] En las sucesiones de Sant Llorenç del Munt y Montserrat se reconocen dos sistemas sedimentarios alternantes en el tiempo (abanicos aluviales y costeros, y plataformas carbonáticas) que muestran una profundización de la cuenca hacia el NW. Las facies terrígenas, mucho más importantes volumétricamente que las de plataforma carbonática, se componen de cuatro asociaciones o cinturones de facies principales: abanico aluvial, llanura de abanico costero, frente de abanico costero y talud de ab...

  4. NCBI nr-aa BLAST: CBRC-DDIS-04-0105 [SEVENS

    Full Text Available CBRC-DDIS-04-0105 ref|XP_795306.2| PREDICTED: similar to mind bomb [Strongylocentro...tus purpuratus] ref|XP_001195978.1| PREDICTED: similar to mind bomb [Strongylocentrotus purpuratus] XP_795306.2 0.003 64% ...

  5. NCBI nr-aa BLAST: CBRC-OCUN-01-0862 [SEVENS

    Full Text Available CBRC-OCUN-01-0862 ref|NP_999775.1| spicule matrix protein SM50 [Strongylocentrotus ...purpuratus] sp|P11994|SM50_STRPU 50 kDa spicule matrix protein precursor gb|AAA30071.1| spicule matrix protein SM50 precursor [Strongylocentrotus purpuratus] NP_999775.1 2e-15 34% ...

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS

    Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-1055 [SEVENS

    Full Text Available CBRC-XTRO-01-1055 ref|XP_782654.2| PREDICTED: similar to Cpsf6 protein, partial [St...rongylocentrotus purpuratus] ref|XP_001180349.1| PREDICTED: similar to Cpsf6 protein, partial [Strongylocentrotus purpuratus] XP_782654.2 1e-34 51% ...

  8. NCBI nr-aa BLAST: CBRC-RMAC-09-0027 [SEVENS

    Full Text Available CBRC-RMAC-09-0027 ref|XP_797403.2| PREDICTED: similar to Aminopeptidase N (rAPN) (Alanyl aminope ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] ref|XP_00 ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] XP_797403 ...

  9. NCBI nr-aa BLAST: CBRC-OCUN-01-0528 [SEVENS

    Full Text Available CBRC-OCUN-01-0528 ref|XP_795774.2| PREDICTED: similar to plus agglutinin [Strongylo...centrotus purpuratus] ref|XP_001192339.1| PREDICTED: similar to plus agglutinin [Strongylocentrotus purpuratus] XP_795774.2 0.062 32% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Full Text Available CBRC-OANA-01-1904 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-81 42% ...

  11. NCBI nr-aa BLAST: CBRC-OANA-01-1491 [SEVENS

    Full Text Available CBRC-OANA-01-1491 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-35 36% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Full Text Available CBRC-OANA-01-1904 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-84 42% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1738 [SEVENS

    Full Text Available CBRC-OANA-01-1738 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 0.007 30% ...

  14. NCBI nr-aa BLAST: CBRC-OANA-01-2167 [SEVENS

    Full Text Available CBRC-OANA-01-2167 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-11 31% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-3457 [SEVENS

    Full Text Available CBRC-XTRO-01-3457 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-17 38% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-0997 [SEVENS

    Full Text Available CBRC-OANA-01-0997 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-49 40% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-1470 [SEVENS

    Full Text Available CBRC-OANA-01-1470 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-44 36% ...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-2284 [SEVENS

    Full Text Available CBRC-OANA-01-2284 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-64 41% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-01-0521 [SEVENS

    Full Text Available CBRC-MDOM-01-0521 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-10 30% ...

  20. NCBI nr-aa BLAST: CBRC-XTRO-01-2405 [SEVENS

    Full Text Available CBRC-XTRO-01-2405 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 9e-45 37% ...

  1. NCBI nr-aa BLAST: CBRC-GACU-23-0138 [SEVENS

    Full Text Available CBRC-GACU-23-0138 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-119 39% ...

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Full Text Available CBRC-XTRO-01-0211 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-05 63% ...

  3. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 4e-65 42% ...

  4. NCBI nr-aa BLAST: CBRC-OANA-01-2105 [SEVENS

    Full Text Available CBRC-OANA-01-2105 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-79 43% ...

  5. NCBI nr-aa BLAST: CBRC-OANA-01-1879 [SEVENS

    Full Text Available CBRC-OANA-01-1879 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-61 42% ...

  6. NCBI nr-aa BLAST: CBRC-GACU-11-0007 [SEVENS

    Full Text Available CBRC-GACU-11-0007 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-120 40% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-2234 [SEVENS

    Full Text Available CBRC-OANA-01-2234 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-59 42% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Full Text Available CBRC-XTRO-01-3296 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 7e-11 32% ...

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Full Text Available CBRC-XTRO-01-0211 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-05 51% ...

  10. NCBI nr-aa BLAST: CBRC-OLAT-26-0032 [SEVENS

    Full Text Available CBRC-OLAT-26-0032 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-63 48% ...

  11. NCBI nr-aa BLAST: CBRC-FRUB-02-0514 [SEVENS

    Full Text Available CBRC-FRUB-02-0514 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-87 40% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-11-0167 [SEVENS

    Full Text Available CBRC-MDOM-11-0167 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 0.48 28% ...

  13. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 2e-64 41% ...

  14. NCBI nr-aa BLAST: CBRC-OANA-01-1048 [SEVENS

    Full Text Available CBRC-OANA-01-1048 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-28 40% ...

  15. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-65 44% ...

  16. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Full Text Available CBRC-XTRO-01-3296 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 3e-10 41% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-2231 [SEVENS

    Full Text Available CBRC-OANA-01-2231 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 5e-19 43% ...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-1934 [SEVENS

    Full Text Available CBRC-OANA-01-1934 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-29 37% ...

  19. NCBI nr-aa BLAST: CBRC-OANA-01-1148 [SEVENS

    Full Text Available CBRC-OANA-01-1148 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-38 41% ...

  20. Dicty_cDB: Contig-U15067-1 [Dicty_cDB

    Full Text Available apiens chromosome 13q34 schizophrenia regio... 36 1.7 9 ( AC177006 ) Strongylocentrotus purpuratus clone R3-...andidatus Carsonella ruddii PV DNA, complete gen... 34 1.1 10 ( AE014303 ) Homo s

  1. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  2. Dicty_cDB: SHK759 [Dicty_cDB

    Full Text Available hl*lqlvmy qvqlqlq*llqfnqllmnlqvviiimitviqqllqqlqllqq*mieikqprqfkrhgkii vvsnnlkkklklknylkilvncylimkeihlkiikh*ilksmmmkiminhktitim... Shewanella sp. W3-18-1, complet... 38 0.71 AB110082_1( AB110082 |pid:none) Bacillus ehim...1_A04_T7A Strongylocentrotus purpuratus, purple sea urchin , sperm genomic BAC library Strongylocentrotus purpuratus genomi...c 40.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: mitochondri...ATGAAGAAGATCAAATCGAAAATTAAATATATAAAAAATTTTAAATAAAAATAAAAA TAAAGAAATAATAAAAAAAATATTATTTTTTTA sequence update

  3. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    G. González Bonorino; J. I. Boyce; B. B. Koseoglu

    2003-01-01

    Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ...

  4. Técnica manipulativa de descomprensión en esguince de tobillo

    Rodríguez Monteverde, Juan Ignacio

    2015-01-01

    Nos encontramos hoy en día ante un amplio abanico de tratamientos y terapias destinadas a la rehabilitación del esguince de tobillo, con diferentes metodologías, procedimientos, puntos de vista y disensos entre quienes ejecutan estas prácticas. De este abanico de alternativas, a veces deriva ineludiblemente, una confusión en el abordaje de esta patología, que se estima es la más frecuente del ser humano. Ante esto, surge la necesidad imperiosa de identificar herramientas terapé...

  5. Avaliação de um conjunto de bicos para uso em uma barra para aplicação de herbicidas em lavouras de café em formação

    Gilton José Rodrigues; Mauri Teixeira Martins; Lino Roberto Ferreira; Haroldo Carlos Fernandes; Mario Herrera Prat

    2004-01-01

    El objetivo de este trabajo fue evaluar un conjunto de boquillas del tipo abanico para usarla en una barra de pulverización, para la aplicación de herbicidas en labores del café en formación. Para esto, fueron evaluados cinco boquillas hidráulicas de chorro plano, tipo abanico de distribución uniforme (80-EF-015, 80-EF-02 e 80-EF-03), así como la distribución volumétrica del líquido, proporcionada individualmente por cada boquilla, se utilizó una barra de pulverización situada ...

  6. Dicty_cDB: Contig-U11022-1 [Dicty_cDB

    Full Text Available 35 5 ( EH079886 ) PMECF85TO Perkinsus marinus large insert cDNA lib... 42 0.048 2 ( ET095291 ) QM0AAA22BH01FM1 CCL1...gylocentrotus purpuratus clone R3-3085L11, W... 40 0.14 2 ( AC180454 ) Strongylocentrotus purpuratus clone R...022-1Q) /CSM_Contig/Contig-U11022-1Q.Seq.d CAAATACACTCAGACAGGGTTGCAAATGCGTTGAATTGGACGTTTGGGAT GGTAATGATGGTGATCC...DNA sequence from clone CH211-51L17 in ... 52 0.060 1 ( BX324154 ) Zebrafish DNA ... SP_1031_A2_E05_SP6E Strongylocentrotus purpuratus... 42 0.075 2 ( EL354039 ) CCEM10702.b4_L12.ab1 CC

  7. La biblioteca pública al servicio de la comunidad

    Domínguez Sanjurjo, María Ramona; Merlo Vega, José Antonio

    2001-01-01

    El artículo pone de relieve el papel de las bibliotecas públicas en la sociedad de la información que tiende a integrarlas cada vez más en la comunidad, extendiendo el abanico de información que ofrece a cuestiones relacionadas con la vida cotidiana y el ejercicio de los derechos de los ciudadanos.

  8. Geología y minería

    Puche Riart, Octavio

    1986-01-01

    Nuevos campos da aplicación y nuevas tecnologías abren ampliamente el abanico de posibilidades formativas de los Ingenieros Técnicos da Minas. Y como no debemos quedar al margen de los avances científicos , hay que desarrollar canales nutritivos de conocimiento.

  9. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.

  10. NCBI nr-aa BLAST: CBRC-DDIS-04-0127 [SEVENS

    Full Text Available CBRC-DDIS-04-0127 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 1e-22 ...

  11. NCBI nr-aa BLAST: CBRC-DSIM-08-0061 [SEVENS

    Full Text Available CBRC-DSIM-08-0061 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 4e-42 ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1530 [SEVENS

    Full Text Available CBRC-PHAM-01-1530 ref|NP_999775.1| spicule matrix protein SM50 precursor [Strongylo...centrotus purpuratus] sp|P11994|SM50_STRPU RecName: Full=50 kDa spicule matrix protein; Flags: Precursor gb|AAA30071.1| spic

  13. Dicty_cDB: Contig-U13236-1 [Dicty_cDB

    Full Text Available .3 4 ( AC173720 ) Strongylocentrotus purpuratus clone R3-1008M14, W... 38 2.4 5 ( AY858561 ) Hermeuptychia hermes...6 2.6 2 ( AY858562 ) Hermeuptychia hermes isolate CTBEH144 cytochrome ... 36 2.7 2 ( CU442744 ) Pig DNA sequ...ence *** SEQUENCING IN PROGRESS *** f... 40 2.7 2 ( AY858563 ) Hermeuptychia hermes

  14. Estrategias reproductivas de moluscos bivalvos y equinoideos

    Calvo, J.; Morriconi, E.; Orler, P.

    1998-01-01

    The theoretical aspects of reproductive strategies and life histories are analyzed. The gonadal structures and the main features of gametogenesis of bivalves and echinoids are described. Research on the reproductive characteristics and gametogenic cycles of the bivalve molluscs in the Argentinian littoral and the echinoid Loxechinus albus is reviewed. Special references to Mytilus edulis, Aulacomya ater, Brachidontes purpuratus, Aequipecten tehuelchus, Zygochlamys patagonica, Ostrea puelchana...

  15. Dicty_cDB: Contig-U01942-1 [Dicty_cDB

    Full Text Available W... 46 0.75 1 ( AC179610 ) Strongylocentrotus purpuratus clone R3-1028M04, W... 46 0.75 1 ( FG646102 ) CSRLCD001_05-G10-pAL17d Heal...thy leaf tissue Solan... 46 0.75 1 ( BM579253 ) 17000687237959 A.Gam.ad.cDNA.blood1

  16. Dicty_cDB: Contig-U05840-1 [Dicty_cDB

    Full Text Available lone R3-12G8, WORK... 52 0.017 1 ( AC180970 ) Strongylocentrotus purpuratus clone R3-3059B02, W... 52 0.017 1 ( AC139728 ) Carol...lia perspicillata clone 29G20, complete sequ... 48 0.27 1 ( AC150467 ) Carol

  17. Dicty_cDB: Contig-U05052-1 [Dicty_cDB

    Full Text Available nom... 34 2.7 3 ( AC149914 ) Strongylocentrotus purpuratus clone R3-12I13, WOR... 36 2.8 9 ( AC146769 ) Carol... HindIII BAC Library Solanum lycoper... 36 5.9 3 ( AC146829 ) Carollia perspicillata clone 9I15, WORKING DRA

  18. Dicty_cDB: Contig-U15705-1 [Dicty_cDB

    Full Text Available ... 32 5.8 2 ( AC180698 ) Strongylocentrotus purpuratus clone R3-3087F16, W... 38 5.9 7 ( CB939163 ) IpCGJ...x13_43_E10_23 IpCGJx13 Ictalurus punctatus c... 38 5.9 2 ( EJ010891 ) 1095403698687

  19. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Sadhna Phanse; Cuihong Wan; Blake Borgeson; Fan Tu; Kevin Drew; Greg Clark; Xuejian Xiong; Olga Kagan; Julian Kwan; Alexandr Bezginov; Kyle Chessman; Swati Pal; Graham Cromar; Ophelia Papoulas; Zuyao Ni

    2015-01-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium ...

  20. Geophysical survey in `Albanico El Paso` Cochabamba - Bolivia; Levantamento geofisico no `Albanico El Paso` Cochabamba - Bolivia

    Ellert, N.; Rodas, C.S. [Sao Paulo Univ., SP (Brazil). Inst. de Geociencias; Ricaldi, V.; Jaldin, L.A. [Corporacion para el Desarrollo de Cochabamba (Bolivia)

    1994-12-31

    Vertical electrical soundings were measured in the Cochabamba sedimentary basin at several alluvial fans (locally called `abanicos`). This paper presents data from the Abanico El Paso. This research attempted to correlate geophysical data with the presence of paleo-channels inside the alluvial fans. These fans, mostly concentrated at the foot of the Cordilheira Ocidental, are about 1 km across and up to 4 km long. Data from deep wells were used to establish a correlation between the geophysical and hydrogeological data. The specific yield of the deep wells can be correlated with the grain size of the sediments. Apparent resistivity values of the vertical electrical soundings, for several AB/2 spacing were used to construct resistivity profiles, where the distance between each measured points correspond to the distances between the points where a vertical electrical sounding was measured. Once again, the electro-resistivity method demonstrated its potentiality as an exploration tool. (author). 3 refs., 14 figs.

  1. Bases para la intervención emocional con hermanos de niños con discapacidad intelectual

    Iriarte Redín, Concha; Ibarrola-García, Sara

    2010-01-01

    Introducción. El presente trabajo pone de relieve la necesidad de prestar atención a la vivencia emocional de la discapacidad intelectual por parte de los hermanos. Lejos de ignorar, minimizar o sobredimensionar sus necesidades psicosociales se apuesta por tener en cuenta el amplio abanico de aspectos emocionales tanto positivos como negativos que puede conllevar el hecho de tener un hermano con discapacidad intelectual. Ello resultará tremendamente útil a la hora intervenir y ...

  2. Inserci??n laboral de docentes noveles del Nivel Medio en la Argentina. Una aproximaci??n a partir de los egresados de la Universidad Nacional de General Sarmiento

    Serra, Juan Carlos; Krichesky, Graciela; Merodo, Alicia

    2011-01-01

    El prop??sito de este art??culo es presentar algunos resultados de la investigaci??n ???De estudiantes a profesores: primeros desempe??os profesionales en secundarios del conurbano bonaerense??? que tuvo entre sus objetivos analizar los problemas y necesidades de los graduados de los profesorados en sus primeros ejercicios profesionales, interpretados en el marco de la heterogeneidad de sus trayectorias personales y profesionales. Las trayectorias analizadas reflejan un abanico...

  3. Potencialidad del desarrollo de hipotecas inversas como complemento pensionario: el caso de Chile

    Javier Alonso; David Tuesta; Maria Lamuedra

    2013-01-01

    Las hipotecas inversas se han venido constituyendo en una alternativa para generar flujos de ingresos liquidos durante la etapa de jubilacion en algunos paises desarrollados. Teniendo en cuenta que los riesgos de menores recursos durante la etapa de vejez suelen ser enfrentados con un abanico amplio de fuentes de financiamiento, el presente trabajo analiza las potencialidades del desarrollo de las hipotecas inversas como alternativa de ingresos para la vejez. El trabajo se centra en el estudi...

  4. Ser minero. El contexto cultural generado por la minería industrial (siglos XIX-XX en el sur de la Península Ibérica

    CANO SANCHIZ, J.M.

    2014-01-01

    de la hibridación entre globalización y endemismo: el pueblo minero contemporáneo del sur de la Península Ibérica. Para ello, se combinan técnicas de estudio arqueológicas y antropológicas (de campo y de escritorio, que se aplican sobre un amplio abanico de fuentes: cultura material, memoria oral, documentación histórica e informaciones turísticas.

  5. Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia) Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia)

    Romero Ordóñez F. H.; Schultz-Güttler R. A.; Chavez-Gil T.

    1996-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  6. Ocurrencias diamantíferas de la quebrada alba rosa, caño guapayito, guainía, colombia (primera ocurrencia comprobada de diamantes en colombia)

    Romero Ordóñez, F. H.; Schultz-Güttler, R. A.; Chavez-Gil, T.

    2012-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  7. Análisis multi-proxy paleoambiental y modelización de registros sedimentarios fluviales en los Alpes Suizos

    Ferreira de Carvalho, Rui Filipe

    2014-01-01

    El estudio de sistemas fluviales mediante el análisis de testigos sedimentarios supone una oportunidad singular para comprender los patrones espaciales y temporales que rigen la dinámica de la agradación fluvial bajo la influencia de diferentes fuerzas motrices, como son la variabilidad climática o las actividades humanas. Los abanicos aluviales y deltas de los principales valles alpinos de modelado glaciar son importantes cubetas sedimentarias (Hinderer, 2001), que proporcionan registros sed...

  8. Personalización de perfiles de notificación de aplicaciones según el contexto del usuario

    LÓPEZ GUERRERO, IGNACIO

    2012-01-01

    En los últimos años los teléfonos móviles inteligentes (smartphones) se han convertido en un objeto indispensable en nuestras vidas cotidianas, esto ha provocado la aparición de todo un gran ecosistema de potentes sistemas operativos móviles, como iOS, Android o Windows Phone 7, y un gran abanico de aplicaciones compatibles con estos sistemas...

  9. Redes y desarrollo profesional del docente: entre el dato Serendipiti y el foro de trabajo colaborativo

    Jesús Salinas

    1998-01-01

    El art??culo versa sobre las posibilidades de la red en el desarrollo profesional del docente. Describe las principales oportunidades que las redes ofrecen para el desarrollo personal y profesional del docente. Abarcan un amplio abanico desde el acceso aleatorio a datos valiosos (el dato serendipiti, que surge a partir del cotejo de otros datos sin que haya sido buscado de manera deliberada), hasta verdaderos programas de trabajo colaborativo en la creaci??n de materiales ...

  10. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  11. Dicty_cDB: Contig-U09442-1 [Dicty_cDB

    Full Text Available uct DNA, clone: pF... 39 0.13 DQ120651_1( DQ120651 |pid:none) Pan troglodytes RBM1 gene, partia...nomi... 37 0.51 AB325927_1( AB325927 |pid:none) Sorogena stoianovitchae stf4 mRNA ... 37 0.51 AP008210_766( ... Entamoeba histolytica small heat shock protein (H... 40 0.23 2 ( AC177962 ) Strongylocentrotus purpuratus c...lone R3-3049H23, W... 48 0.42 1 ( AC177453 ) Strongylocentrotus purpuratus clone R3-1030K24, W... 48 0.42 1 ...m clone CH211-67N10 in ... 46 1.7 1 ( AC149872 ) Xenopus tropical

  12. Karyotypes of three species of the marine Veneroida molluscs

    Sun Zhenxing; Shao Yanqun; Guo Shengchao; Qin Yan; Yang Aiguo

    2003-01-01

    The karyotypes of three species of marine Veneroida molluscs, Solen grandis Dunker,Saxidomus purpuratus Sowerby and Mactra chinensis Philippi were studied by using the adult gill tissues. The chromosomes were prepared through injecting phytohemagglutinin (PHA) and colchicine, hypotonic treatment, chopping air-dry, and squashing technology. The results show that the diploid chromosome numbers of the three Veneroida species are the same as 2 n = 38. The karyotype of Solen grandis is 26m + 6sm + 2st + 4t, NF = 70, the karyotype of Saxidomus purpuratus is 32m + 2sm + 4st/t, NF = 72, and the karyotype of Mactra chinensis is 20m + 16sm + 2st/t, NF = 74. Satellite and sex chromosome were not found among the chromosomes of three species.

  13. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut Geomorphological evolution and relative chronology of terrace levels adjacent to the Chubut River mouth to the Atlantic (Chubut Province.

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.An ancient alluvial fan and its subsequent evolution are described. Ancient alluvial fan accumulations have been interpreted as the northern continuation of the rodados patagónicos of the Montemayor Plateau, a proposal

  14. Dicty_cDB: SHF413 [Dicty_cDB

    Full Text Available nnesssqgsnnessnnesnnqnsnnesshkeesesnshqss eteskdqvsnsgsmnqssessessslseqssafessssss...kdqvsnsgsmnqssessessslseqssafessssssgnsqsksse Frame B: lyylnnymyifvfk**kiifl*fffnikr...k*iivfirtklcf*ifviiew*fsikik*k Homology vs CSM-cDNA Score E Sequences producing s...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N A... SEQUENCE, 40 unordered pieces. 32 0.010 3 AC180650 |AC180650.1 Strongylocentrotus purpuratus clone R3-3090E

  15. Cis-regulatory control of the nodal gene, initiator of the sea urchin oral ectoderm gene network

    Nam, Jongmin; Su, Yi-Hsien; Lee, Pei Yun; Robertson, Anthony J; Coffman, James A.; Davidson, Eric H.

    2007-01-01

    Expression of the nodal gene initiates the gene regulatory network which establishes the transcriptional specification of the oral ectoderm in the sea urchin embryo. This gene encodes a TGFβ ligand, and in Strongylocentrotus purpuratus its transcription is activated in the presumptive oral ectoderm at about the 30-cell stage. Thereafter Nodal signaling occurs among all cells of the oral ectoderm territory, and nodal expression is required for expression of oral ectoderm regulatory genes. The ...

  16. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Judith eLevine; Lowe, Christopher J.; Maria Ina Arnone; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea) and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely...

  17. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largel...

  18. Dynamic Evolution of Toll-Like Receptor Multigene Families in Echinoderms

    Buckley, Katherine M; Rast, Jonathan P.

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like re...

  19. RNA Deep Sequencing Reveals Differential MicroRNA Expression during Development of Sea Urchin and Sea Star

    Kadri, Sabah; Hinman, Veronica F.; Benos, Panayiotis V.

    2011-01-01

    microRNAs (miRNAs) are small (20–23 nt), non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin) and Patiria miniata (sea star) are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs d...

  20. Lectins with Potential for Anti-Cancer Therapy

    Tammy Yau; Xiuli Dan; Charlene Cheuk Wing Ng; Tzi Bun Ng

    2015-01-01

    This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygo...

  1. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    Dora A. Taboada P.; Haydée Russac; Carolina Ramos de Ormachea

    2014-01-01

    En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos molusco...

  2. Proteome Sci.

    Mann Matthias; Poustka Albert J; Mann Karlheinz

    2010-01-01

    Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the deter...

  3. A Genomic View of the Sea Urchin Nervous System

    Burke, RD; Angerer, LM; Elphick, MR; Humphrey, GW; Yaguchi, S; Kiyama, T.; Liang, S.; Mu, X.; Agca, C; Klein, WH; Brandhorst, BP; Rowe, M.; Wilson, K.; Churcher, AM; Taylor, JS

    2006-01-01

    The sequencing of the Strongylocentrotus purpuratus genome provides a unique opportunity to investigate the function and evolution of neural genes. The neurobiology of sea urchins is of particular interest because they have a close phylogenetic relationship with chordates, yet a distinctive pentaradiate body plan and unusual neural organization. Orthologues of transcription factors that regulate neurogenesis in other animals have been identified and several are expressed in neurogenic domains...

  4. Organization of an echinoderm Hox gene cluster

    Martinez, Pedro; Rast, Jonathan P.; Arenas-Mena, César; Davidson, Eric H.

    1999-01-01

    The Strongylocentrotus purpuratus genome contains a single ten-gene Hox complex >0.5 megabase in length. This complex was isolated on overlapping bacterial artificial chromosome and P1 artificial chromosome genomic recombinants by using probes for individual genes and by genomic walking. Echinoderm Hox genes of Paralog Groups (PG) 1 and 2 are reported. The cluster includes genes representing all paralog groups of vertebrate Hox clusters, except that there is a sing...

  5. Rapid accumulation of an interleukin 17 homolog transcript in Crassostrea gigas hemocytes following bacterial exposure

    Roberts, S; Gueguen, Yannick; De Lorgeril, Julien; Goetz, F

    2008-01-01

    Interleukin-17 (IL-17) gene models have been found in the sequenced genomes of Strongylocentrotus purpuratus and Caenorhabditis elegans. However, there have been no published reports on the empirical cloning and characterization of any interleukin cDNAs in invertebrates. From a Pacific oyster (Crossostrea gigas) hemocyte cDNA library, two clones were obtained that encoded a protein similar to vertebrate IL-17s. The putative oyster IL-17 homolog (CgIL-17) was 27% identical to rainbow trout IL-...

  6. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    L Courtney Smith

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence...

  7. Dicty_cDB: Contig-U05011-1 [Dicty_cDB

    Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..

  8. Lectins with Potential for Anti-Cancer Therapy

    Tammy Yau

    2015-02-01

    Full Text Available This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygonatum odoratum lectin, autophagy inducing lectins include annexins and Polygonatum odoratum lectin.

  9. Sea Urchin Recruitment: Effect of Substrate Selection on Juvenile Distribution

    Cameron, R. A.; Schroeter, S. C.

    1980-01-01

    Intertidal field observations have shown that juvenile purple sea urchins Strongylocentwtus purpuratus are found in higher densities near adults . The same is true for subtidal populations of juvenile red sea urchins 5. franciscanus. These distribution patterns could be influenced by any of three elements: substrate selection, early juvenile mortality or juvenile migration. Using laboratory-reared larvae, we conducted experiments designed to gauge the effect of substrate selection on ju...

  10. Sea urchin vault structure, composition, and differential localization during development

    Dickey-Sims Carrie; Lang Jennifer; Makabi Miriam; Stewart Phoebe L; Robertson Anthony J; Coffman James A; Suprenant Kathy A

    2005-01-01

    Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Resul...

  11. La generación distribuida. Comparación de cogeneración con gas natural y biomasa en aplicaciones de district heating

    Sroka Chalot, Daniel Jakub

    2012-01-01

    En la actualidad, la generación distribuida responde a un amplio abanico de tecnologías de producción eléctrica descentralizada que, correctamente aplicadas, pueden presentar ventajas respecto a la generación centralizada. Estas ventajas están fundamentalmente relacionadas con un ahorro de energía primaria, el aprovechamiento de energías renovables, la electrificación de zonas remotas o la seguridad de suministro. Dentro de las tecnologías disponibles, una de las más aplicadas ...

  12. Gestión de infraestructuras virtuales configuradas dinámicamente

    Caballer Fernández, Miguel

    2014-01-01

    En los últimos años y con el auge las tecnologías de virtualización y de las infraestructuras cloud, se abre un nuevo abanico de posibilidades para acceso de recursos de cómputo para el ámbito científico. Estas tecnologías permiten "acceso ubicuo, adaptado y bajo demanda en red a un conjunto compartido de recursos de computación". Estas tecnologías permiten que el acceso a grandes cantidades de recursos virtualizados sea mucho más sencillo para el científico. Si bien la adaptación de aplicaci...

  13. Geolog??a e historia del oro de Granada

    Mart??n, Jos?? M.

    2000-01-01

    El oro aluvial de Granada aparece como peque??as laminillas mm-cm y se encuentra en los r??os Genil y Darro, donde se ha batea-do desde la ??poca romana hasta la actualidad, y en los conglomerados de la "Formaci??n Alhambra", explotados en mina a cielo abierto. La "Formaci??n Alhambra" (~200 m de potencia) est?? constituida por sedimentos detr??ticos gruesos ligados a abanicos aluviales del Plioceno basal (~5 Ma); en la zona de la mina, son conglomerados de cantos heterom??tricos, aunque rela...

  14. El móvil en la educación: un nuevo paradigma. Ventajas y desventajas de su uso

    Martín-Herrera, Borja

    2012-01-01

    Hoy en día el abanico de posibilidades que nos ofrecen las TIC en todos los aspectos de la sociedad son prácticamente infinitos. Todos estos avances están encaminados a mejorar nuestra calidad de vida, tareas rutinarias, facilitar procesos complejos, etc…En el ámbito de la educación desde la creación y expansión de internet son numerosas las tecnologías que se han ido incorporando al aula con la finalidad de mejorar el proceso de enseñanza – aprendizaje las cuales han ido ag...

  15. El perfil del referencista en el siglo XXI y su impacto ante las redes sociales

    Rodríguez Vidal, Patricia Lucía; Contreras Hernández, Brenda

    2015-01-01

    En los albores del Siglo XXI las Tecnologías de Información y Comunicación han impactado grandemente los servicios de información en las bibliotecas universitarias, lo que ha ocasionado que en éstas se sumen otras opciones que abran un abanico de posibilidades dirigidos especialmente en el servicio de referencia virtual. El objetivo de la presente ponencia aborda fundamentalmente el perfil con el que debe contar el actual referencista del Siglo XXI, así como, los retos, oportunidades y desafí...

  16. La formación profesional en Derecho mediante el Aprendizaje Basado en Problemas (ABP)

    Rué, Joan; Font Ribas, Antoni; Cebrián, Gisela

    2011-01-01

    La formación en Derecho ha sido tradicionalmente una formación que puede orientarse y resolverse en un abanico de posibilidades profesionales muy elevado. Sin embargo esta amplitud y diversidad de referentes profesionales no ha sido históricamente asumido por el modelo de formación general seguido por las universidades españolas, centralizado y orientado a un aprendizaje fundamentalmente memorístico de los contenidos a los que se somete a un tratamiento muy dogmático. No obstante existen enfo...

  17. Evolución urbana e inundaciones en Castelló

    Segura Beltrán, Francisca S.

    2001-01-01

    La ciudad de Castellón está sometida a un elevado riesgo de inundación, derivado de su localización en el abanico aluvial del Riu Sec de Borriol. La interpretación en clave geomorfológica de las noticias históricas y actuales ha permitido reconstruir los procesos de desbordamiento de los cauces funcionales (Riu Sec, Barranc del Sol y de Penya-Roja) y de los paleocauces (Barranc de Fraga, la Sequiota, paleocauces del Riu Sec), así como las dimensiones y ubicación de las zonas inundables. Así p...

  18. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  19. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia Morphotectonic modeling of the Ibagué strike-slip fault, Colombia

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  20. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Ingrid Viviana Serrano Ramírez

    2012-01-01

    Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violen...

  1. Microarreglos de ADN y sus aplicaciones en investigaciones biomédicas

    Carlos Vallin Plous

    2007-01-01

    miles de genes. Sus aplicaciones clínicas están en fase de desarrollo. Sin embargo, cabe especular con algunas posibles aplicaciones futuras. Por ejemplo, Cáncer, Alergia, Inmunodeficiencias primarias, Enfermedades autoinmunes y Enfermedades infecciosas. La posibilidad de poder medir simultáneamente la expresión de todos los genes de un genoma, o al menos de una parte considerable de este, abre un abanico de nuevas posibilidades muchas de las cuales aún están por explorar.

  2. Natación con escaleras

    Crespo, Adrián Esteban

    2011-01-01

    La natación, como actividad humana, está logrando fortalecerse en el espectro de actividades humanas y no exclusivamente desde lo deportivo-competitivo. En los pueblos y localidades del interior, durante un largo período se asoció a la misma con la competencia de niños y adolescentes en el marco de estructuras de clubes o instituciones que brindaban tal servicio a las familias de la comunidad que la incluían. Hoy en día, dicha acepción a cambiado y se ve favorecida por el enorme abanico de...

  3. Herramienta de auditoría automática de los procesos de organización

    Meana de la Llave, Ricardo

    2010-01-01

    En los tiempos actuales, el abanico de lenguajes de programación se hace cada vez más variado y las funcionalidades que nos ofrecen son más amplias. Consecuencia de esto es que a veces encontrar una solución a un problema simple puede llevarnos varias horas delante del ordenador buscando por Internet hasta que damos con lo que buscábamos. Ante este problema encontramos la solución en una plataforma de conocimiento sobre interconectividad de aplicaciones de Microsoft. Esta ...

  4. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    Felipe Soto-Pérez

    2012-01-01

    Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra....

  5. Diseño e implementación de un cliente de una red social basado en iOS

    Miranda González, Roberto

    2011-01-01

    A lo largo de los últimos años el uso de los dispositivos móviles con pantalla táctil se ha extendido enormemente. Al mismo tiempo, el uso de redes sociales se ha disparado hasta unos límites inimaginables. La combinación de dispositivos móviles con servicios de datos móviles con tecnologías como Edge o 3G permite que se abra un amplio abanico de posibilidades de acceso a redes sociales a partir de dispositivos móviles. De manera concreta, de todos los smartphones utilizados, los dispositivos...

  6. metalTIC – Hogar Digital

    Flórez-Revuelta, Francisco; Ferrández Pastor, Francisco Javier; Cabo Díez, Miguel; Romacho Agud, Vicente

    2011-01-01

    metalTIC – Hogar Digital es un proyecto empresa-universidad para la recreación de una vivienda con los últimos avances en las tecnologías y servicios del hogar digital. Incorpora un amplio abanico de tecnologías de control, tanto estándares como propietarias, cableadas e inalámbricas. El middleware de gestión permite la interoperabilidad entre todos ellos. Asimismo, toda su funcionalidad puede ser accedida mediante servicios web, abstrayendo de toda la tecnología subyacente y haciendo sencill...

  7. El reto de la prevención del blanqueo de capitales en un mundo globalizado = The challenge of money laundering prevention in a global world

    Mateos Martín, José Antonio

    2013-01-01

    El blanqueo de capitales es uno de los fenómenos de mayor impacto social del mundo contemporáneo. Esta repercusión social es debida, en parte, al ruido mediático del que se hacen eco diariamente los medios de comunicación mundial y a la repercusión económica que tiene este fenómeno en las economías mundiales, minando el amplio abanico que va desde las cuentas de un Estado, hasta la moral individual de las personas, o lo que es lo mismo, afectando tanto a aspectos macroeco...

  8. Diseño e implementacion de un sistema de reconstrucción tridimensional de imágenes de ultrasonido

    Forero Martínez, David Eugenio

    2003-01-01

    El sistema de reconstrucción tridimensional para generación de volúmenes cardiacos es un dispositivo, basado en los conceptos de visión por computador, diseñado para resolver un problema especifico que es la visualización de estructuras cardiacas, a partir de la utilización de imágenes provenientes de equipos de ecocardiografía bidimensional. Utilizando el método conocido como abanico manual transtoráxico. La adquisición y digitalización de la información proveniente de dichos equipos, está s...

  9. Educación para la salud en el mundo laboral, los servicios de prevención como motor de cambio para alcanzar un modelo óptimo de salud en el trabajo

    Mejías Martínez, Juan Carlos

    2016-01-01

    Falta palabras clave Los enfoques sociopedagógicos contemporáneos relacionados con la educación para la salud, abarcan un amplio abanico de posibilidades desde donde enfocar nuestra investigación. Actualmente, desde los postulados de la educación para la salud y como consecuencia del auge que ha adquirido el mundo laboral y la prevención de riesgos, debido al aumento de la siniestralidad en el mundo del trabajo, se avanza con intensidad en los procesos de formación y capacitación de esta m...

  10. Cuestionario de evaluación de la personalidad eficaz en segundo y tercer ciclo de educación primaria

    Eva Fueyo Gutiérrez; María Eugenia Martín Palacio; Bianca Dapelo Pellerano

    2010-01-01

    Se presenta un cuestionario de evaluación del constructoPersonalidad eficaz en contextos educativos de segundo y tercer ciclo de la educación primaria, con resultados de fiabilidad 0.797, validez de constructo, validez concurrente con factores de personalidad de segundo orden de CPQ de Porter y Cattell, y normalización en función de la variable género. Cubrimos así el abanico de cuestionarios elaborados en torno al constructo en contextos de educación secundaria, bachillerato, formación profe...

  11. Pleistocene lacustrine basin of the east domain of Guadix-Baza basin (Granada, Spain): sedimentology, chronostratigraphy and palaeoenvironment

    Torres Pérez-Hidalgo, Trinidad José de

    2003-01-01

    Se presenta el estudio de los depósitos lacustres de la parte este de la Cuenca de Guadíx Baza (GBE), una cuenca intramontañosa que permaneció preservada de la erosión hasta la parte superior del Pleistoceno medio. La distribución de facies muestra una clara distribución centrípeta con sistemas de abanicos aluviales que alcanzaron la GBE a través de cañones todavía hoy visibles, aunque también se produjeron aportes de exutorios kársticos con sulfatos disueltos de las evaporitas...

  12. Variabilidad espacial de los atributos de la capa arable de un inceptisol del piedemonte de la cordillera oriental (casanare, colombia)

    Peña, Ricardo; Rubiano, Yolanda; Peña, Andrés; Chaves, Bernardo

    2009-01-01

    El objetivo de este trabajo fue estudiar la variabilidad espacial de los atributos del suelo, enfocado a optimizar futuros muestreos en suelos similares. El estudio se realizó en una superficie de 58 ha, ubicada en Tauramena, departamento de Casanare, Orinoquia colombiana. El suelo del estudio corresponde a un Oxic Dystrudept de textura franco arenosa a franco arcillosa, localizado sobre un abanico de terraza del piedemonte de la cordillera Oriental. A través del análisis del semivariograma y...

  13. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    Jesús Vera; Berta Sánchez; Juana Rodríguez

    2012-01-01

    Producción Científica Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL) son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contr...

  14. Catherine Jean Julien (1950-2011)

    Combès, Isabelle

    2014-01-01

    Catherine Julien falleció el 27 de mayo de 2011 en Turlock (California). Lo que nos queda de ella es más que el recuerdo o la tristeza: una obra extensa, llamativa, impertinente a menudo y, sobre todo, extremadamente bien documentada; una obra que abarcó un abanico de disciplinas (arqueología, historia, paleografía, antropología) y lugares tan distintos como el Cusco, el lago Titicaca, Tarija, Santa Cruz de la Sierra o Paraguay – con una constante: el marco temporal de sus investigaciones, to...

  15. Estudio de enanas ultra-compactas y cúmulos globulares en el cúmulo de Antlia

    Caso, Juan Pablo

    2015-01-01

    En la presente Tesis se intenta aportar evidencias que ayuden a dilucidar el origen de las enanas ultra-compactas (UCDs). Las mismas fueron descubiertas hace poco más de una década, y presentan propiedades que podrían relacionarlas tanto con los cúmulos globulares (CGs), como con galaxias de baja masa. Esto ha resultado en un abanico de hipótesis sobre su origen, que incluyen ser los miembros más brillantes de los sistemas de CGs, los resultantes de la fusión de varios cúmulos estelares masiv...

  16. Proyecto Youtuber

    Herranz Cano, Pablo

    2014-01-01

    Las nuevas tecnologías nos han ofrecido un abanico de posibilidades en cuanto a la emisión y recepción de información, por ende, han abierto un nuevo mundo que nos permite llevar a cabo una nueva forma de publicidad más efectiva que la que hemos conocido hasta ahora. Y ello, ha contribuido a la generación de una nueva oportunidad de negocio que solo algunos han sido capaces de interpretar a tiempo: los youtubers

  17. Estudio de viabilidad de una empresa de prestación de servicios elaborando una estrategia para la mejora en la realización administrativa con los diferentes entes públicos

    ALCAIDE QUEREDA, NAYIMA

    2013-01-01

    El objetivo de este TFC es crear una empresa especializada en servicios integrados, una empresa destinada a proporcionar un gran abanico de servicios a las empresas (asesoría, consultoría empresarial, asesoría jurídica, informática y un servicio de ingeniería industrial). La idea elegida surge después de realizar prácticas en la Consellería de Gobernación de Alicante, y constatar la falta de información de la que disponen muchos empresarios a la hora de tramitar la documentación en la adminis...

  18. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico Interstitial cystitis: A challenge for the clinician

    Pablo Young; Bárbara C. Finn; Martín González; Laura P. Comercio; Mariano Quezel; Julio E. Bruetman

    2010-01-01

    La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades ter...

  19. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    2010-01-01

    La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades ter...

  20. Hipergranulación en heridas crónicas: un problema ocasional pero no infrecuente Hypergranulation of chronic wounds: an occasional but not infrequent problem

    Daniel Chaverri Fierro

    2007-01-01

    La hipergranulación es un problema ocasional, pero a la vez no infrecuente, con el que se enfrentan muchos clínicos responsables del tratamiento de heridas en su práctica diaria. Este fenómeno ocurre en un amplio abanico de heridas que incluyen las incisiones y heridas posquirúrgicas, los estomas (gastrostomías, traqueostomías, etc.) y las heridas crónicas. El objetivo del presente artículo es cuantificar y analizar la evidencia generada en torno al tema de la hipergranulación en las heridas ...

  1. La integración de conocimientos en ciencias mediante una propuesta de uso de materiales multimedia

    Carreri, Ricardo A.; Alzugaray, Gloria E.; Marino, Luis A.

    2008-01-01

    Las propuestas didácticas para la enseñanza y el aprendizaje de las ciencias requieren en la actualidad del diseño y aplicación de recursos educativos que incorporen el uso de las TIC. El abanico de temas que pueden abordar los alumnos en relación a su formación profesional y ciudadana; es amplio y diverso. Así por ejemplo además de cuestiones sobre género, arte, trabajo, recreación y deporte, salud, alimentación y drogas, se incluyen temáticas vinculadas al medio ambiente, la comunicac...

  2. Hepatitis B-cuadro clínico

    Jorge Patiño-Masís

    2008-01-01

    Las manifestaciones clínicas de la hepatitis viral tipo B tienen un amplio abanico de presentaciones, dependiendo de muchos factores, algunos desconocidos y otros, perfectamente identificables: subtipo del virus, características genéticas del huésped, estado inmunológico en el momento de la inoculación, carga viral y vía de entrada de dicha inoculación, entre los más importantes. La clínica de la hepatitis viral por virus B tanto aguda como crónica puede ser desde síntomas inespecíficos sin i...

  3. Beacons BLE (Bluetooth Low Energy) en el sector turístico, control de afluencia y servicios de valor añadido

    Arregui Caballero de Tineo, Arkaitz

    2016-01-01

    Con la aparición del Bluetooth Smart y su bajo consumo, se ha abierto un nuevo abanico de posibilidades para las experiencias de proximidad. El uso de beacons Bluetooth Smart hace posible crear nuevas relaciones Proveedor-Usuario mediante la detección de usuarios que se acercan a una localización concreta. El bajo coste de los dispositivos BLE unido a la posibilidad de estar activo por largos periodos de tiempo con una pila de botón, permite marcar un lugar mediante un beacon con independenci...

  4. Estratigrafía de la Formación del Crestón, sierra de Famatina, Argentina: Sedimentación paleógena en el antepaís andino?

    F. M. Dávila

    2002-12-01

    Full Text Available Se redescriben y analizan los espesos depósitos de la Formación del Crestón (>1700m en el antepaís andino en la región del Famatina (Provincia de La Rioja, que en el pasado han sido relegados. Se definen sus paleoambientes y se discute su posición estratigráfica, edad y significado en el contexto de los depósitos sinorogénicos de la región del antepaís fragmentado. La unidad, dominantemente areno-conglomerádica y de color rojo-morada registra una evolución en dos megaciclos granoestratocrecientes que representan una progresión desde etapas con escaso relieve a depósitos gruesos que caracterizan sectores proximales de abanicos aluviales. En el megaciclo inferior se suceden barreales (fangosos y salinos, abanicos terminales y abanicos aluviales de baja eficiencia mientras que en el ciclo superior se suceden depósitos de barreales, depósitos de sistemas entrelazados mixtos y abanicos aluviales de alta eficiencia. La diferencia composicional entre los conglomerados cuspidales de cada ciclo permite asociar el primero a devastación de cúpulas y coladas volcánicas andesíticas mientras que el segundo se vincula con exhumación de cuerpos granitos que conforman parte del marco de antepaís fragmentado. En este trabajo, y a partir de relaciones de campo, los depósitos de la Formación del Crestón se consideran como antecesores de los clásicos depósitos sinorogénicos neógenos (Grupo Angulos y se relacionan con evidencias aportadas por trazas de fisión y actividad orogénica en otras regiones de los Andes centrales para sostener que la unidad puede representar el registro más antiguo de la sedimentación de antepaís preservado en esta región. Asimismo, se infiere que el inicio de la fragmentación del antepaís andino y la evolución geológica de la región de Famatina es bastante más compleja de lo establecido con anterioridad.

  5. Mediamorphosis and misinformation in the infosphere : media, digital and information literacy face of changes in information consumption habits

    Juan Ignacio AGUADED; Romero-Rodríguez, Luis M.

    2015-01-01

    Desde la reflexión teórica, este trabajo evidencia que el ecosistema comunicacional y digital actual es endógeno y sistémicamente desinformativo, pues se ha convertido paulatinamente en un escenario sobresaturador e infoxicador, atravesado por una dinámica de mediamorfosis, en la que los medios tradicionales buscan competir por la preferencia de la audiencia frente al abanico de propuestas digitales en razón de su subsistencia económica, generalmente intentand...

  6. Estudio de tensioactivos aniónicos y catiónicos derivados de lisina: interacción con membranas celulares, desarrollo de sistemas nanoestructurados para la liberación intracelular y evaluación toxicológica in vitro

    Rubert Nogueira, Daniele

    2013-01-01

    [spa] Los tensioactivos son compuestos altamente versátiles con amplia utilización en la industria farmacéutica y cosmética. Aquellos derivados de aminoácidos presentan una baja toxicidad y elevada biodegradabilidad y, por lo tanto, tienen un abanico más amplio de aplicaciones y constituyen una alternativa a los tensioactivos sintéticos convencionales. En los últimos años, existe un interés creciente en la utilización de excipientes bioactivos con actividad lítica pHsensible en sistemas nanoe...

  7. Niños con necesidades educativas especiales y terapias asistidas con animales

    García Novillo, Blanca

    2013-01-01

    Este es un Trabajo Final del Grado, centrado en los alumnos de “necesidades educativas especiales” y en lo importante de elegir una buena metodología para dar respuesta a sus necesidades integrando animales de compañía en su día a día, construyendo de esta forma una escuela inclusiva. En cada escuela y en cada clase hay un ciclo de evaluación, planificación, enseñanza y revisión de las necesidades de todos los niños. Esos estudios generales tienen en cuenta el amplio abanico de habilidades, a...

  8. La atención a los padres con hijos con necesidades educativas especiales (NEE)

    Claudia María Pernas Pico

    2011-01-01

    Los padres que tienen hijos con necesidades educativas especiales (NEE) necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, et...

  9. Historia del crecimiento económico: una propuesta de recursos didácticos

    Bringas Gutiérrez, Miguel Ángel; Catalán Martínez, Elena

    2013-01-01

    RESUMEN. Con esta comunicación queremos dar a conocer la renovada sección de docencia que la Asociación Española de Historia Económica ha publicado en su página web recientemente. Esta página pretende estimular y promover la enseñanza de la economía del crecimiento y de la Historia Económica a través de un amplio abanico de herramientas y recursos didácticos que contribuyan a la renovación de los métodos docentes en las aulas universitarias.

  10. Soft-computing based visual control for unmanned vehicles

    Olivares Méndez, Miguel Ángel

    2013-01-01

    El objetivo principal de esta Tesis es extender la utilización del “Soft- Computing” para el control de vehículos sin piloto utilizando visión. Este trabajo va más allá de los típicos sistemas de control utilizados en entornos altamente controlados, demonstrando la fuerza y versatilidad de la lógica difusa (Fuzzy Logic) para controlar vehículos aéreos y terrestres en un abanico de applicaciones diferentes. Para esta Tesis se ha realizado un gran número de pruebas reales en las cuales los cont...

  11. Un Simulador empresarial como herramienta práctica para la asignatura de Aprendizaje Automático

    Fuentetaja, Raquel; Castro, Silvia; García, Javier; Fernando FERNÁNDEZ; Borrajo, Daniel; Borrajo, Fernando

    2010-01-01

    En este artículo se plantea el uso de un simulador empresarial (SIMBA) como dominio de aplicación de las prácticas de la asignatura de Aprendizaje Automático (AA). El objetivo principal es que los alumnos se enfrenten a un entorno realista en el que tengan que plantear y ofrecer soluciones basadas en AA. El contexto de la toma de decisiones empresarial ofrece un amplio abanico de aplicaciones, desde el análisis de datos (predicción de resultados empresariales, análisis de perfiles de decis...

  12. El conflicto en el software: una aproximación al fenómeno del fork en los proyectos de software libre

    Taravilla Herrera, Javier

    2013-01-01

    La presente investigación pretende ampliar el marco de trabajo de los estudios actuales en filosofía o sociología de la tecnología, mediante un acercamiento a una práctica surgida en las comunidades y movimiento de Software Libre de los últimos años conocida como “fork”. Un ejercicio que consiste inicialmente en hacer una copia del código fuente de un programa para desarrollarlo en una dirección distinta de la original, pero que analizada en detalle sugiere un amplio abanico de cuestiones rel...

  13. La complejidad de vivir la ciudadanía en el aula: Análisis en cuatro centros de secundaria

    Parareda-Pallarès, Alba; Simó-Gil, Núria; Domingo-Peñafiel, Laura; Soler-Mata, Joan

    2016-01-01

    Este artículo describe y analiza un abanico de prácticas democráticas en cuatro centros de secundaria que se basan en principios relacionados con la vivencia de la ciudadanía y pone de relieve las posibilidades y límites que estas plantean. Se enmarcan dentro de un proyecto de investigación que analiza procesos participativos y democráticos en centros educativos, con la intención de promover y mejorar su cultura democrática, participativa e inclusiva y sus prácticas diarias a partir del conce...

  14. Structuration and Integration of Magnetic Molecules and Nanoparticles on Surfaces and Devices by Directwrite AFM Lithography

    Bellido Vera, Elena

    2011-01-01

    La progresiva miniaturización de los materiales a la escala nanométrica ha abierto en la última década nuevas expectativas en el campo de la Ciencia de Materiales. Dichos materiales nanométricos presentan propiedades únicas, difiriendo a menudo de las propiedades del propio material a la macroescala, las cuales abren un amplio abanico de nuevas fenomenologías, y en consecuencia, de aplicaciones tecnológicas. De especial interés han sido los nanomateriales magnéticos, incluyendo las nanopartíc...

  15. Aplicación móvil multiplataforma para el aprendizaje de lenguajes de programación. Caso práctico con Swift

    Román Bengoechea, Álvaro

    2015-01-01

    En este proyecto se ha estudiado el abanico de posibilidades que las plataformas web y móviles ofrecen para aprender lenguajes de programación compilados. A continuación, se ha realizado el diseño y la implementación de una plataforma para el aprendizaje de lenguajes de programación desde dispositivos móviles, con posibilidad de compilación remota desde la aplicación desarrollada, analizando el proceso y las elecciones de desarrollo tomadas. Así, se ha desarrollado una app mediante la p...

  16. Manipulación genética: el nuevo monstruo de Frankenstein en el cine

    Prada Pérez, Francisco Javier de

    2007-01-01

    [ES] El cine se ha ocupado en multitud de ocasiones de lanzar los interrogantes que abren los avances científicos y su repercusión en la vida del ser humano. No en vano la ciencia ficción es un género consagrado a esa tarea, la de intentar predecir hacia dónde camina la humanidad gracias a la aplicación de nuevos descubrimientos. La manipulación genética, por su extraordinario abanico de posibilidades, no podía escapar a guiones que intentaran vislumbrar las aplicaciones que la sociedad pudie...

  17. Cooking Stardust

    Marciel Martín, Sara

    2015-01-01

    Cooking Stardust es una aplicación Android de recetas de cocina. Con sólo introducir algunos de los ingredientes que haya en la nevera, se abrirá todo un abanico de posibilidades culinarias, teniendo en cuenta el estado de salud o simplemente los gustos a la hora de sentarse a la mesa. Una forma cómoda y sencilla de intentar facilitar una de las tareas diarias más difíciles y que tantos quebraderos de cabeza puede causar. Además de mostrársele las diferentes recetas de comida que cumplan c...

  18. Estudio de la corrosión electroquímica en los bronces de aluminio con níquel (NAB)

    Rey Ruiz, Alberto

    2014-01-01

    RESUMEN: Los bronces al aluminio con níquel, más conocidos como NAB, Nickel Aluminiun Bronzes, por sus siglas en inglés, cubren con solvencia un amplio abanico de aplicaciones y soluciones constructivas en el medio marino. En ambientes de agua dulce la familia de materiales predominante son los aceros inoxidables. En situaciones y ambientes específicos, como pueden ser centrales hidroeléctricas especificas, se debe recurrir a aceros inoxidables especiales u otras familias...

  19. Procesos de documentación arqueológica y generación de modelos virtuales

    Josep Blasco Senabre; Sebastián Varea; Fernando Cotino Vila; Albert Ribera Lacomba; Oreto García Puchol

    2011-01-01

    En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L) en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de ob...

  20. Design and evaluation of admission control policies in mobile cellular networks

    BERNAL MOR, ELENA

    2013-01-01

    Durante los últimos años las redes móviles celulares han experimentado un considerable crecimiento y desarrollo debido al nuevo modo en que la sociedad crea, comparte y consume información. El enorme impacto y penetración de los servicios móviles telefónicos en la sociedad actual, así como la introducción de un amplio abanico de nuevos servicios de datos y servicios multimedia, han llevado a un crecimiento espectacular del volumen de tráfico transportado por este tipo de redes....

  1. Maternidad subrogada: revisión bibliográfica

    Ruiz Martínez, Rocío

    2013-01-01

    Los avances y descubrimientos científicos han desarrollado técnicas de reproducción asistida como alternativa a la esterilidad. El nuevo abanico de posibilidades que ofrecen la genética y la técnica a la humanidad, plantea problemas que tendremos que ir resolviendo. Estas posibilidades no solo permiten separar la procreación de la unión sexual entre el hombre y la mujer, sino también que ésta pueda realizarse sin la participación biológico-genética y /o sin el conocimiento del otro miembro de...

  2. Entorno de control y gestión de instrumentación médica

    Hernández Orejón, Xavier

    2007-01-01

    Este proyecto final de carrera describe el diseño y la implementación de un proyecto de innovación de un dispositivo estético de la empresa Rös’s estética y electromedicina s.a. El objetivo principal es actualizar la electrónica del dispositivo, con el fin de poder integrarlo a las nuevas tecnologías de la información y la comunicación, permitiendo abrir un abanico de posibilidades para controlarlo y gestionarlo. El proyecto pretende mostrar a la empresa cliente la posibi...

  3. Luces en la Sombra: Educación artística, teatro, mujer y centros penitenciarios.

    Martín Fernández, Sara

    2015-01-01

    Este proyecto refleja la importancia de la creación de nuevos modelos educativos, en el ámbito social, basados en el Arte y la Educación Artística. Se indica como punto de referencia las herramientas artísticas, como elementos de transformación social, las cuales ofrecen un amplio abanico de posibilidades para facilitar el desarrollo integral de las personas participantes y la población en general. Para trabajar de forma específica se ha utilizado la herramienta del teatro. Esta herramienta f...

  4. Geology and micromammals of the Serra-1 site (Tabernas Basin, Betic Cordillera

    Ruiz Bustos, A.

    1993-12-01

    Full Text Available A chronology is given for the alluvial fan deposits in the Tabernas Basin (Internal Zone, Betic Cordillera. Palaeontological and sedimentological data are used to establish a palaeoclimatic model for the Quaternary in southeastern Spain.La Cuenca de Tabernas está situada en la zona interna de la Cordillera Bética, se da una cronología para los depósitos formados por abanicos aluviales y se plantea a través de datos paleontológicos y sedimentológicos un modelo paleochmátlco para el Cuaternano en el sureste de España.

  5. Representaciones sociales de la agricultura ecol??gica en Andaluc??a

    Lozano Cabedo, Carmen

    2013-01-01

    En los ??ltimos a??os se ha generalizado un amplio abanico de representaciones e im??genes en torno a la producci??n ecol??gica, por parte de m??ltiples y diferentes actores sociales, tanto en lo que refiere a su definici??n y ??mbito de actuaci??n, como a las repercusiones de esta actividad sobre el ??mbito econ??mico, social, ambiental, econ??mico e institucional. Este trabajo constituye un an??lisis de los discursos y las percepciones sobre la agricultura y la ganader??a ecol??gica que pos...

  6. Análisis del comportamiento de compra del maximizador frente al satisfactor

    Bernal Bernal, Sheila

    2014-01-01

    En la sociedad actuallas personas se enfrentan cada día a una gran cantidad de actividades comerciales que implican la percepción y diferenciación entre una gran variedad de productos ofrecidos. Elegimos entre un extenso abanico de posibilidades”, formado por diversos factores como la marca, precio, calidad y el interés de un producto, el cual se haampliado gracias a las nuevas tecnologías de fabricación, así como a las posibilidades de adquirir bienes y servicios de c...

  7. DE MIGUEL GONZÁLEZ, R. y DONERT, K. (EDITORES (2014 Innovative Learning Geography in Europe: New Challenges for the 21st Century. Cambridge Scholars Publishing. 233 pp. ISBN (13: 978-1-4438-5508-2.

    María Luisa Gómez Ruiz

    2014-12-01

    Full Text Available   Este libro editado por los profesores Rafael de Miguel y Karl Donert muestra un gran abanico de posibilidades para aprender geografía desarrollando métodos y técnicas innovadoras propias de las oportunidades que ofrece el siglo XXI. El alcance de todas ellas es cada vez más amplio gracias a las nuevas y emergentes tecnologías que favorecen cada vez más el acceso a la información geográfica o geoinformación y a los recursos geo-media. 

  8. Vivir en familia: los aspectos positivos del acogimiento familiar

    Bernedo Muñoz, Isabel María

    2015-01-01

    La familia es el mejor espacio para el desarrollo y bienestar psicosocial de los niños y niñas. En ocasiones, se dan circunstancias familiares y sociales que llevan a la separación del niño de su familia de origen. Dentro del amplio abanico de medidas que los Servicios de Protección de Menores pueden llevar a cabo ante esta situación de riesgo o desamparo, el acogimiento familiar se sitúa en un punto medio entre aquellas medidas que suponen una ruptura radical entre el niño, su familia biológ...

  9. El concepto pedagógico formación en el universo semántico de la educación

    María Eugenia Venegas Renauld

    2004-01-01

    El material contenido en este artículo, representa uno de los productos de la investigación del concepto formación en la Ley Fundamental de Educación de Costa Rica, que consideró entre las preguntas de investigación, la búsqueda de las raíces del concepto en Occidente. Mediante un rastreo en el lenguaje educativo, el acercamiento semántico es una de las etapas del rastreo. El artículo muestra la complejidad semántica del término en el amplio abanico de acepciones y ...

  10. El proyecto urbano: enseñanza y aprendizaje en el grado universitario

    Sbarra, Alberto; Morano, Horacio; Cueto Rúa, Verónica; Moroni, Leandro

    2015-01-01

    La presente ponencia presenta un trabajo de investigación que se encuentra en su primera fase de desarrollo, y que tiene como objetivo central estudiar la manera en que hoy se transmite la enseñanza del Proyecto Urbano en las facultades de arquitectura de la región (ARQUISUR), ofreciendo un abanico de técnicas y estrategias que ayuden a la consolidación del pensamiento proyectual. Complementariamente se intenta revisar el concepto de Proyecto Urbano, otorgándole una validez operativa que pong...

  11. La figura del autor en el cine de Krzysztof Kieslowski: metadiscurso, universo propio y álter ego

    ZARAGOZA JUST, ANDRES

    2013-01-01

    El objetivo principal de este trabajo es aportar un nuevo análisis sobre el cine del director polaco Krzysztof Kie¿lowski, para ello nos centramos en el tema abanico de la figura del autor. Evidenciaremos la visión de Kie¿lowski sobre este concepto, ofreciendo una relectura de una selección de sus películas tomadas desde esta perspectiva. Para realizar esta descripción de la figura del autor recurriremos al estudio del metadiscurso que se encuentra en ellas, o reflexión so...

  12. Maximización de la Disponibilidad en Líneas de Producción por medio de Programación Multiobjetivo

    Ramos Melendrez, Elizabeth

    2004-01-01

    El objetivo de este trabajo es maximizar la disponibilidad en líneas de producción por medio de programación multiobjeitvo, utilizando componentes redundantes para maximizar la disponibilidad, así como también la utilización de algoritmos genéticos con codificación entera. Encontrando datos de disponibilidad y costos simultáneamente proporcionando así un abanico de soluciones para este problema. Palabras claves: Programación multiobjetivo, Algoritmos genéticos, compo...

  13. Geopolítica y governance de los hidrocarburos

    Lara, Ignacio Fernando

    2012-01-01

    El devenir del mercado mundial de los hidrocarburos es una de los temas fundamentales de la geopolítica energética mundial. En el tentativo de dilucidar sus dinámicas, se abordará un complejo abanico de temas: la situación de la oferta y la demanda, la discordancia entre ambas y las repercusiones sobre el futuro del precio del petróleo; les mecanismos del comercio internacional de energía, ligado a la seguridad energética, los choke points y el fenómeno de los fondos soberanos "energéticos"; ...

  14. Geopolítica y governance de los hidrocarburos

    Lara, Ignacio Fernando

    2014-01-01

    El devenir del mercado mundial de los hidrocarburos es una de los temas fundamentales de la geopolítica energética mundial. En el tentativo de dilucidar sus dinámicas, se abordará un complejo abanico de temas: la situación de la oferta y la demanda, la discordancia entre ambas y las repercusiones sobre el futuro del precio del petróleo; les mecanismos del comercio internacional de energía, ligado a la seguridad energética, los denominados choke points y el fenómeno de los fondos soberanos "en...

  15. Automatización del modelado y gestión de procesos de fabricación dirigida por semántica

    Ferrándiz Colmeiro, Antonio; Maciá Pérez, Francisco; Gilart Iglesias, Virgilio; Berná Martínez, José Vicente; Gea Martínez, Jorge

    2009-01-01

    La madurez alcanzada por las IT junto con algunas de las teorías modernas de gestión de procesos de negocio (BPM) ha propiciado un escenario adecuado para afrontar los requerimientos de los nuevos modelos de negocio cada vez más orientados a la personalización masiva. Las soluciones de integración aportadas en el entorno de las organizaciones manufactureras han abierto todo un abanico de posibilidades en la gestión de los procesos que, paradójicamente, está provocando que el tradicional cuell...

  16. Aproximación a la planificación de rutas en el transporte público

    Montagnini, Gabriele

    2015-01-01

    RESUMEN: El transporte supone el traslado de personas o bienes de un lugar a otro. Los lugares de en los que se produce suelen estar alejados de aquellos en los que se consume; las personas que residen en una localidad, trabajan, estudian o disfrutan de su tiempo libre en otros emplazamientos. En un mundo cada vez más globalizado, el transporte es uno de los sectores que más aporta a la generación de riqueza de una región pues abre un gran abanico de posibilidades en todos los sectores produc...

  17. Creatividad y tecnología en la orientación de nuestros futuros músicos

    Lago Castro, Pilar; Ponce De León Barranco, Luis

    2012-01-01

    La gestión y planificación de la carrera profesional son ámbitos en los que el estudiante de música debe poner en práctica su creatividad. Ayudar al alumno para desarrollar su creatividad a la hora de explorar el amplio abanico de posibilidades que comprende el mundo profesional de la música es una tarea en la que las tecnologías de la información y la comunicación pueden jugar un importante papel. En este artículo se describe un proyecto de orientación profesional llevado a cabo en un conser...

  18. Propuesta didáctica “Huerto escolar”

    Caerols Fernández, Carmen M.

    2013-01-01

    El Trabajo de Fin de Grado, en adelante TFG, sobre “huerto escolar”, se debe a la importancia sobre el acercamiento y conocimiento del alumno hacia la naturaleza. Se abre un amplio abanico de conocimientos relacionados con la alimentación, nutrición y medio ambiente. Esto beneficiará en el comportamiento que los alumnos tengan con la naturaleza, dando lugar a un espacio saludable en el aula. El principal objetivo es plasmar mi propia vivencia en el aula con alumnos de primer ciclo de Educació...

  19. Sedimentology of the early synrift record in a marginal halfgraben related to an extensional rift: Bijuesca Basin, Upper Jurassic of the Iberian Range (Zaragoza, Spain)

    Sacristán, Sara; Arribas, Mª E.; Mas, R.

    2011-01-01

    [ES] Un estudio sedimentológico detallado de los primeros depósitos continentales sinrift que aparecen en el Semigraben de Bijuesca (Formaciones Ciria y Bijuesca), ha permitido entender la arquitectura estratigráfica de los sedimentos que representan el principio de la extensión en esta estructura. La Fm Bijuesca está formada por sedimentos detríticos organizados en tres asociaciones de facies diferentes (de abanico aluvial proximal, medio y distal). La unidad está constitui...

  20. Sedimentología de sucesiones sinrift tempranas en un semigraben marginal de un rift extensional: la Cuenca de Bijuesca, Jurásico superior de la Cordillera Ibérica (Zaragoza, España)

    Sacristán Horcajada, Sara; Arribas Mocoroa, María Eugenia; Mas Mayoral, José Ramón

    2011-01-01

    Un estudio sedimentológico detallado de los primeros depósitos continentales sinrift que aparecen en el Semigraben de Bijuesca (Formaciones Ciria y Bijuesca), ha permitido entender la arquitectura estratigráfica de los sedimentos que representan el principio de la extensión en esta estructura. La Fm Bijuesca está formada por sedimentos detríticos organizados en tres asociaciones de facies diferentes (de abanico aluvial proximal, medio y distal). La unidad está constituida po...

  1. De la metropolización a las agrópolis. El nuevo poblamiento urbano en el Chile actual

    Canales, Alejandro; Canales Cerón, Manuel

    2013-01-01

    La modernización del agro chileno ha generado nuevos patrones de asentamiento y movilidad de la población tanto en ámbitos locales y regionales, como a nivel nacional. El tradicional modelo de desarrollo urbano-metropolitano, ha sido sustituido por un modelo de desarrollo agropolitano, el cual ya no se sustenta en el crecimiento y metropolización del país, sino en el crecimiento de un amplio abanico de ciudades agrarias. En este artículo se analiza la dinámica demográfica de estas ciudades ag...

  2. EQUIPOS COOPERATIVOS EN EL AULA

    Eva María Rodríguez Cobos

    2009-01-01

    No cabe duda de que los seres humanos vivimos en sociedad, una sociedad cada vez más variopinta, hablando, pues, de interculturalidad. Dentro del aula, ocurre exactamente igual, nos encontramos con un amplio abanico de alumnos, con distintas características (sociales, económicas, de raza, de sexo, de religión …), distintas expectativas, distinta motivación, … Por ello, la educación en valores cobra una relevancia especial, sobre todo en este caso la “educación para la paz”, ya que este tema t...

  3. Leche de altramuz

    Dell'Oca, Nicolás

    2015-01-01

    RESUMEN La leche de Lupinus albus posee 280 mg de calcio y 2.66 gr de proteínas, comparándola con la leche de vaca presenta más del doble en calcio y casi la misma cantidad de proteínas. La siguiente investigación pretende estudiar el grado de aceptabilidad del flan elaborado con leche de Lupinus albus y de este modo poder ampliar el abanico de alimentos para las personas que presentan intolerancia a la lactosa. Objetivos: Determinar el perfil del consumo de leche y el gr...

  4. Descubrimiento y geolocalización mediante redes Wi-Fi

    Pérez Blanco, Carlos

    2010-01-01

    En la actualidad la gran mayoría de dispositivos móviles disponen de diversos sistemas de localización, siendo el GPS el más habitual. Gracias a ello nuestro dispositivo conoce en cualquier momento la posición en la que nos encontramos, dando pie a un extenso abanico de posibilidades. Posiblemente la más popular sea la navegación, pero conocer nuestra localización tiene muchas otras aplicaciones. Por ejemplo, podemos crear una aplicación de chat en la que las personas con las que podemos chat...

  5. Productos naturales vegetales

    Ringuelet, Jorge Abel; Viña, Sonia Zulma

    2013-01-01

    El mundo vegetal es, quizás, el que muestra un abanico de moléculas más diverso y del cual el hombre ha hecho y hace una provechosa utilización. La maquinaria química de un vegetal es tan ingeniosa que asombra al estudiar en su profundidad la estructura, función, metabolismo y regulación de cada molécula identificada y de los innumerables procesos en que participan a nivel celular. Por otra parte, al no contar con el mecanismo de evasión y encontrarse ancladas al suelo o algún otro sustrato, ...

  6. Biorremediación acelerada de suelos contaminados con hidrocarburos tipo diésel

    Moliterni Merlo, Elena

    2016-01-01

    La biorremediación es una tecnología biológica para la descontaminación de suelos basada en la conversión o metabolización de los contaminantes por microorganismos; es decir, requiere una cepa o consorcio microbiano eficiente que degrade la mayor cantidad de contaminante hasta un nivel mínimo. Los procesos de biorremediación de suelos contaminados con hidrocarburos (HC) pueden desarrollarse mediante un gran abanico de estrategias. Este hecho permite acoplarse a distintos episodios de contamin...

  7. Perspectivas del negocio de la distribuci??n para un futuro incierto en el sector de la prensa = Distribution business prospects for an uncertain future in the newspapers sector.

    Rubio ??lvarez, Juan Vicente

    2014-01-01

    El negocio de la distribuci??n en el sector de la prensa viene representado por un amplio abanico de empresas, desde los editores como creadores del contenido, pasando por los impresores como creadores del soporte f??sico, las empresas de transporte y distribuci??n como prestadores del servicio de la distribuci??n, los vendedores de prensa como clientes directos o primarios y por ??ltimo los compradores y suscriptores como clientes finales. En este trabajo se realiza un an??lisis de cada u...

  8. La utilización de nuevos recursos digitales en el proceso de enseñanza-aprendizaje de las matemáticas

    Jubany, Jordi

    2010-01-01

    El presente artículo pretende presentar un abanico cualitativo de nuevos recursos con una visión que permite la interdisciplinariedad y posibilita el trabajo competencial para que sea una satisfacción aprender. No se trata de hacer un compendio exhaustivo de todos los recursos existentes, sino de dar herramientas que nos ayuden a pensar y hacer pensar a partir de la experiencia, no sólo en la utilización de la parte mecánica. Debemos abrir nuevas vías en todas las etapas educativas que puedan...

  9. Régimen fiscal de la minería. Propuestas para una actividad sostenible

    Fernández Gómez Del Castillo, Ana María

    2015-01-01

    Por todos es bien conocida la histórica riqueza minera de España, cuyo subsuelo contiene importantes yacimientos conocidos y aprovechados, constituyendo la variedad e importancia de éstos un amplio abanico para las iniciativas privadas que desarrollan actividades de exploración, investigación y explotación, y dando motivo suficiente al Estado para legislar sobre el tema, todo ello unido a la importancia estratégica del suministro de materias primas en la producción industrial como pilar básic...

  10. Cómo aplicar árboles de decisión en SPSS

    Vanesa Berlanga-Silvente; María-José Rubio-Hurtado; Ruth Vilà-Baños

    2013-01-01

    Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos) que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con ...

  11. Metodología para seleccionar tecnologías Web 2.0 para la docencia

    Grangel, R.; Campos, C.; Rebollo, C.; Remolar, I.; Palomero, S.

    2012-01-01

    Actualmente existe un gran auge en el uso y difusión de las herramientas Web 2.0 tanto en el contexto profesional como en el personal. Su aplicación al ámbito de la docencia, tal y como sugieren algunos estudios, puede tener numerosas ventajas. Sin embargo, el abanico de herramientas Web 2.0 es muy amplio y por tanto sería de utilidad disponer de una metodología que pudiera guiar al docente a la hora de elegir la tecnología más adecuada a su proceso de enseñanza-...

  12. Caracterización clínica, molecular e inmunofenotípica del cáncer colorrectal en menores de 45 años

    Perea García, José

    2009-01-01

    [ES] El Cáncer Colorrectal (CCR) de aparición precoz es relativamente infrecuente, con una incidencia del 2-8%. Este grupo de edad presenta un abanico heterogéneo de casos, desde aquellos con una agregación familiar importante para el CCR, hasta otros que son esporádicos. Parecen presentar características distintivas con respecto a aquellos que aparecen a edad más avanzadas, con una mayor frecuencia de localización en el colon derecho, bajo grado de diferenciación, mucinosos, presencia de ...

  13. Emulación de RFID activo mediante la plataforma MICAz

    García Sotelo, Tomás

    2006-01-01

    Este trabajo de final de carrera está basado en la tecnología inalámbrica RFID. Ésta tecnología, pretende desbancar a la añeja tecnología basada en códigos de barras. En el siguiente informe, se estudia las ventajas y desventajas de esta innovadora tecnología, y se pretende informar al lector del amplio abanico de utilidades que establece esta tecnología en el mundo real. Aparte de realizar un estudio de los dispositivos RFID, se han creado dos aplicaciones como prueba de...

  14. Las herramientas terminológicas en los sistemas de información jurídica

    Alvite Díez, María Luisa

    2004-01-01

    P. 77-90 Se analizan los instrumentos terminológicos integrados en las interfaces de las bases de datos jurídicas Aranzadi, Iberlex y La Ley, seleccionadas por su alta implantación en unidades de información. Se observa un abanico de soluciones que abarca desde las simples listas de palabras clave hasta los tesauros de estructura navegacional. Se aprecian diferencias sustanciales entre las bases de datos legislativas y las jurisprudenciales. Aunque constituyen instrumentos potentes para la...

  15. Matemática aplicada a ciertos problemas de la edificación

    Mena Requena, María Rosa

    2015-01-01

    Los problemas de álgebra lineal como, por ejemplo, sistemas de ecuaciones lineales o problemas de mínimos cuadrados, aparecen en un amplio abanico de aplicaciones de casi todas las áreas científicas y tecnológicas. En particular, problemas de este tipo surgen en el análisis de la resistencia de estructuras de hormigón, cálculo de estructuras, la estimación de la órbita de los electrones, la evaluación del campo gravitatorio terrestre, la simulación de circuitos VLSI, el control...

  16. Modelos para la gestión óptima de aprovisionamiento y de personal en una empresa de restauración: aplicación a caso real

    Mendia Mingo, Amaia

    2014-01-01

    En el ámbito de la restauración, la imagen y las sensaciones que cada cliente se lleve tras una visita al establecimiento son claves para la prosperidad del negocio, puesto que la gran oferta de restaurantes da al cliente un gran abanico de opciones entre las que destacar o descartar. La disponibilidad de recursos materiales y humanos, es esencial para poder ofrecer un servicio satisfactorio, puesto que son los factores más importantes de la experiencia culinaria. Es por ello que el presente ...

  17. Jóvenes que cometen delitos severos

    Wiese, Renata

    2008-01-01

    Dentro de los múltiples tipos de violencia, la delincuencia juvenil -que afecta a personas comprendidas entre los 10 y 29 años- es definida como un abanico de actos agresivos que van desde la intimidación y las peleas hasta formas más graves como la agresión y el homicidio. Con respecto a este último tipo de violencia (el homicidio) la hipótesis a verificar en este trabajo, plantea que sobre la población integrada por delincuentes juveniles homicidas han interactuado factores de riesgo partic...

  18. Sistema de gestión domótica de una vivienda

    Ruiz Lorca, Iván

    2011-01-01

    El proyecto que a continuación se presenta se basa en la elaboración de un sistema para gestionar y optimizar varios elementos de una vivienda, convirtiéndola en una casa domótica. A lo largo de ésta memoria veremos cómo hemos controlado y creado sistemas de control de temperatura, luz, puertas y ventanas, sistemas de prevención inteligentes, antirrobo, etc. En éste proyecto hemos querido demostrar el gran abanico de posibilidades que nos da un elemento, a priori sencillo, como es un PIC d...

  19. Particularidades y proyecciones de futuro de la industria de la música en el siglo XXI: el caso de la industria discográfica mexicana

    Torres Osunal, Cristian Daniel

    2012-01-01

    La industrialización de la cultura ofrece un variado abanico de posibilidades para la investigación empírica, en un complejo panorama de actividades económicas y sociales interconectadas. Cada subsector de las IC (industria del disco, libro, videojuego, televisión, cine, radio, etc.) constituye un objeto de estudio con particularidades diferenciadas de los demás (procesos productivos, actores, división del trabajo, flujo económico, social, etc.), susceptibles a ser abordadas desde diferentes ...

  20. La fuerza laboral de la comunicación comercial: radiografía del sector publicitario con enfoque de género

    Martín Llaguno, Marta

    2007-01-01

    Con una fuerza laboral joven y altamente cualificada, el ámbito laboral de la publicidad presenta una estructura polarizada y ciertos sesgos de género en detrimento del sexo femenino. Aunque considerado como gratificante en líneas generales, el alto grado de implicación y de dedicación que exige el trabajo creativo de estos profesionales provoca a menudo conflictos entre la vida laboral y la familiar. Asimismo, la existencia en el sector de un amplio abanico de políticas de conciliación no...

  1. Aplicación del análisis markoviano en sucesiones aluviales, a la predicción de facies hidrogeoquímicas: un ejemplo de la cuenca de Madrid (España central).

    Torres Pérez-Hidalgo, Trinidad José de

    1997-01-01

    En este trabajo se aplica el análisis por cadenas de Markov a sucesiones estratigráficas del Neógeno de la Cuenca de Madrid. Los datos proceden de sondeos mecánicos de reconocimiento que atraviesan depósitos de abanico aluvial y de playa fangosa. Permite determinar la aparición de procesos repetitivos en el espacio y en el tiempo y, en el caso que nos ocupa, detectar aquellos estados (facies), cuya aparición dependa sólo del estado, (facies) anterior. El método comprende el cálculo de matrice...

  2. Cadena de restaurantes de comida cosmopolita y saludable a precio asequible

    Álvarez García-Luján, Carlos

    2012-01-01

    El objeto de este trabajo es la presentación del proyecto de una “Cadena de restaurantes de comida cosmopolita y saludable a precio asequible” en la ciudad de Barcelona Se ofrecerán desayunos, comidas, meriendas, cenas e incluso “copas”, tanto en el propio local como en “take away”, abarcando así todo el abanico de demanda en alimentación fuera del hogar. Dicho proyecto basa su éxito en: • Las economías de escala y el poder negociador en las compras, basadas en un alto volumen ...

  3. Viaducto sobre el río Guarga en la autovia Mudéjar A-23. Sabiñánigo (Huesca)

    Cerezo San Frutos, Diego

    2014-01-01

    El presente documento desarrolla el Proyecto de construcción del Viaducto sobre el Rio Guarga en la autovía Mudéjar A-23 en Sabiñánigo (Huesca).Se describe el problema actual a resolver y de qué manera la implantación de la estructura supone una solución al mismo. Enmarcado el proyecto en su contexto, el siguiente nivel de detalle lo conforma el abanico de condicionantes que el entorno impone a la actuación. Estos condicionantes han sido objeto de análisis particularizados para ser determinad...

  4. Repercusiones del deseo y la búsqueda activa de información sobre la toma de decisiones en pacientes asmáticos.

    Ayllón Negrillo, Esther

    2004-01-01

    RESUMEN El asma es una enfermedad crónica que afecta a una parte significativa de la población y cuya prevalencia y morbilidad están aumentando, a pesar del cada vez mejor y mayor conocimiento que de la misma se posee y del amplio abanico de tratamientos de que se dispone para su manejo. En este contexto, la implicación del paciente en el manejo y control de su enfermedad, incluyendo el tratamiento farmacológico, se ha venido reclamando como un objetivo terapéutico de indudable valor. Un p...

  5. Estudio del marketing online en el sector de la moda. Análisis de estrategias.

    García Salas, Lucía

    2015-01-01

    Actualmente, las empresas del sector de la moda disponen de un amplio abanico de instrumentos y herramientas con las que mejorar la rentabilidad de sus negocios. Tener presencia en internet es fundamental, pero también lo es seguir una estrategia adecuada, gestionarla bien, con clientes activos y disponer de venta online. Para ello, en este trabajo analizaré los recursos y técnicas de marketing online que utilizan las marcas para alcanzar sus objetivos de marketing: desde los más tradicionale...

  6. La definición del público objetivo en el briefing de medios para la estrategia de comunicación online

    Castelló Martínez, Araceli

    2011-01-01

    Las capacidades de afinidad con el target y medición de resultados en tiempo real con que cuenta Internet convierten a la segmentación del público objetivo en una de las piezas clave a la hora de conseguir eficacia en la comunicación publicitaria online y un elevado retorno de la inversión. Además, el amplio abanico de acciones que ofrece el medio online, así como de soportes, formatos y formas de negociación/contratación, hacen que en muchas ocasiones las estrategias de presencia publicitari...

  7. Dicty_cDB: Contig-U10445-1 [Dicty_cDB

    Full Text Available 6 1e-66 AF526233_1( AF526233 |pid:none) Argopecten irradians isolate iolsa... 255 2e-66 ( P50880 ) RecName: Full=60S riboso...7 |pid:none) Mus musculus strain BALB/c ribosomal p... 155 2e-36 CP001400_1281( CP001400 |pid:none) Sulfolobus islandi...1(... 108 4e-22 CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 107 6e-22 (Q3IMY8) RecName: Full=50S riboso...4 FN316316_1( FN316316 |pid:none) Schistosoma japonicum isolate Anhu... 248 4e-64 FN357411_20( FN357411 |pid:none) Schistosoma manso...382_30(A... 42 0.033 CP001277_1681( CP001277 |pid:none) Candidatus Hamiltonella defensa... 42 0.033 (Q47LJ3)

  8. Dicty_cDB: Contig-U06051-1 [Dicty_cDB

    Full Text Available 12 CP001400_1281( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 75 2e-12 (B0R656) RecName: Full=50S riboso...mal protein L3P; &(Q9HPD4) Rec... 75 2e-12 CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L...22_1( EU752622 |pid:none) Populus tremula isolate swl21-002 ... 56 7e-07 AF526233_1( AF526233 |pid:none) Argopecten irradians isol...e-60 FN316317_1( FN316317 |pid:none) Schistosoma japonicum isolate Anhu... 233 4e-60 CR940347_663( CR940347 |pid:none) Theileria an...169 5e-41 DQ206525_1( DQ206525 |pid:none) Suberites fuscus isolate TOA20 rib... 157 3e-37 AM494969_341( AM494969 |pid:none) Leishman

  9. Dicty_cDB: Contig-U16269-1 [Dicty_cDB

    Full Text Available 1( FN320319 |pid:none) Schistosoma japonicum isolate Anhu... 325 2e-87 CR380948_179( CR380948 |pid:none) Candi...F526207_1( AF526207 |pid:none) Argopecten irradians isolate iolsa... 212 2e-53 EU558306_1( EU558306 |pid:none) Novocrania an..._1282( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 133 1e-29 (A6UV67) RecName: Full=50S ribosomal...mal protein L4P; &BA000011_329... 134 6e-30 CP001403_1389( CP001403 |pid:none) Sulfolobus islandicus Y.G...red marine group II euryar... 132 2e-29 CP001399_1369( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,..

  10. Dicty_cDB: Contig-U16272-1 [Dicty_cDB

    Full Text Available muelleri putative 60S rib... 251 7e-71 AF526233_1( AF526233 |pid:none) Argopecten irradians isolate iols... &CP000477_169... 142 2e-40 CP001400_1281( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 132 4e-40 ...CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 130 1e-39 AK297711_1( AK297711 |pid:no...39... 42 0.046 FM992695_51( FM992695 |pid:none) Candida dubliniensis CD36 chromos... 42 0.046 (A1T4N9) RecName: Full=50S riboso...6 (B6EPS5) RecName: Full=50S ribosomal protein L3; &FM178379_320(... 42 0.046 CP001277_1681( CP001277 |pid:none) Candi

  11. Dicty_cDB: Contig-U06081-1 [Dicty_cDB

    Full Text Available N320319_1( FN320319 |pid:none) Schistosoma japonicum isolate Anhu... 275 2e-72 CR380948_179( CR380948 |pid:none) Candi...AF526207 |pid:none) Argopecten irradians isolate iolsa... 212 2e-53 CP000080_113( CP000080 |pid:none) Leishman.... 104 6e-21 CP001399_1369( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 103 1e-20 (A7I5P0) RecName: Full=50S riboso...d:none) Staphylothermus marinus F1, com... 106 2e-21 CP001403_1389( CP001403 |pid:none) Sulfolobus islandicu...00_1282( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 104 5e-21 EU68663

  12. Dicty_cDB: Contig-U15098-1 [Dicty_cDB

    Full Text Available mal protein L32; AltName: Full=... 118 2e-32 AF526230_1( AF526230 |pid:none) Argopecten irradians isolate iols...mal protein L32e; &AP006878_15... 57 4e-07 CP001399_1385( CP001399 |pid:none) Sulfolobus islandi...9 6e-32 (Q8WRF3) RecName: Full=60S ribosomal protein L32; AltName: Full=... 119 6e-32 AB244986_1( AB244986 |pid:none) Polypedi...-21 FM992693_149( FM992693 |pid:none) Candida dubliniensis CD36 chromo... 96 6e-21 CR382125_297( CR382125 |p... |pid:none) Lutzomyia intermedia isolate IAFrp... 77 3e-13 AJ965641_1( AJ965641 |pid:none) Nyctotherus ovalis

  13. Dicty_cDB: Contig-U05942-1 [Dicty_cDB

    Full Text Available APV-2005 mRNA for ri... 181 4e-44 AF526207_1( AF526207 |pid:none) Argopecten irradians isolate iols... (Q9UXA6) RecName: Full=50S ribosomal protein L4P; &AE006641_651... 85 5e-15 CP001403_1389( CP001403 |pid:none) Sulfolobus islandi...cus Y.G.57.14... 83 2e-14 CP001399_1369( CP001399 |pid:none) Sulfolobus islandi...cus L.S.2.15,... 82 3e-14 CP001400_1282( CP001400 |pid:none) Sulfolobus islandicus M.14....yzae RIB40 genomic... 175 4e-78 FM992688_1292( FM992688 |pid:none) Candida dubliniensis

  14. Dicty_cDB: Contig-U15146-1 [Dicty_cDB

    Full Text Available AF526198_1( AF526198 |pid:none) Argopecten irradians isolate iolsa... 135 3e-31 DQ440259_1( DQ440259 |pid:no...P001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 66 3e-10 CP001398_1924( CP001398 |pid:none) Thermococcus gammatoleran...53 ) Mus Musculus Strain C57BL6/J chromosome 3 BAC, RP... 48 0.25 1 ( EF134343 ) Oxyrrhis marina isol...ate Om-5p-21-2 ribosomal prot... 48 0.25 1 ( EF134342 ) Oxyrrhis marina isolate Om-5p-21-1 riboso.... 124 8e-28 EF134343_1( EF134343 |pid:none) Oxyrrhis marina isolate Om-5p-21-2... 124 8e-28 BT046434_1( BT04

  15. Scaling of feeding biomechanics in the horn shark Heterodontus francisci: ontogenetic constraints on durophagy.

    Kolmann, Matthew A; Huber, Daniel R

    2009-01-01

    Organismal performance changes over ontogeny as the musculoskeletal systems underlying animal behavior grow in relative size and shape. As performance is a determinant of feeding ecology, ontogenetic changes in the former can influence the latter. The horn shark Heterodontus francisci consumes hard-shelled benthic invertebrates, which may be problematic for younger animals with lower performance capacities. Scaling of feeding biomechanics was investigated in H. francisci (n=16, 19-59cm standard length (SL)) to determine the biomechanical basis of allometric changes in feeding performance and whether this performance capacity constrains hard-prey consumption over ontogeny. Positive allometry of anterior (8-163N) and posterior (15-382N) theoretical bite force was attributed to positive allometry of cross-sectional area in two jaw adducting muscles and mechanical advantage at the posterior bite point (0.79-1.26). Mechanical advantage for anterior biting scaled isometrically (0.52). Fracture forces for purple sea urchins Strongylocentrotus purpuratus consumed by H. francisci ranged from 24 to 430N. Comparison of these fracture forces to the bite force of H. francisci suggests that H. francisci is unable to consume hard prey early in its life history, but can consume the majority of S. purpuratus by the time it reaches maximum size. Despite this constraint, positive allometry of biting performance appears to facilitate an earlier entry into the durophagous niche than would an isometric ontogenetic trajectory. The posterior gape of H. francisci is significantly smaller than the urchins capable of being crushed by its posterior bite force. Thus, the high posterior bite forces of H. francisci cannot be fully utilized while consuming prey of similar toughness and size to S. purpuratus, and its potential trophic niche is primarily determined by anterior biting capacity. PMID:19428230

  16. La neotectónica del arco volcánico a la latitud delvolcán Copahue (38ºS, Andes de Neuquén

    Emilio Rojas Vera

    2009-10-01

    Full Text Available El cerro Chancho-Coconstituye el principal elemento positivo en el perímetro de la caldera delAgrio después del volcán Copahue ubicado inmediatamente al sur del mismo. Sudesarrollo se encuentra ligado a una serie de cabalgamientos de dirección NEque generan un abanico imbricado con vergencia al SE asociado al plegamiento desecuencias pliocenas superiores agrupadas en la Formación Las Mellizas. Elprincipal quiebre topográfico dentro de este abanico imbricado de fallascoincide con el desarrollo de la falla Copahue. Este cabalgamiento levantaunidades pliocenas sobre depósitos cuaternarios coluviales y fluviales. Elestudio de las relaciones entre secciones menores de esos depósitos muestra quela falla Copahue ha sufrido al menos dos períodos de actividad. La fallaCopahue, así como los otros cabalgamientos adyacentes han afectado las coladasdel volcán Copahue hacia el sur, permitiendo la redefinición de la geometríadel bloque de Chancho-Co. Finalmente, a partir del análisis de las anomalíasgravimétricas de la zona un mecanismo asociado a la inversión de la cuenca deCura Mallín en el subsuelo es propuesto para explicar el desarrollo de estafaja de actividad neotectónica.

  17. Avaliação de um conjunto de bicos para uso em uma barra para aplicação de herbicidas em lavouras de café em formação

    Gilton José Rodrigues

    2004-01-01

    Full Text Available El objetivo de este trabajo fue evaluar un conjunto de boquillas del tipo abanico para usarla en una barra de pulverización, para la aplicación de herbicidas en labores del café en formación. Para esto, fueron evaluados cinco boquillas hidráulicas de chorro plano, tipo abanico de distribución uniforme (80-EF-015, 80-EF-02 e 80-EF-03, así como la distribución volumétrica del líquido, proporcionada individualmente por cada boquilla, se utilizó una barra de pulverización situada a 0,3, 0,4 y 0,5 m de altura y presión de 100, 200, 300 y 400 kPa. Los resultados fueron sometidos al análisis de varianza y a la prueba t, al 5% de probabilidad. Las presiones de 200 y 300 kPa, alturas entre 0,4 y 0,5 m presentaron la mejor uniformidad de distribución del líquido. La mejor uniformidad de distribución volumétrica, fue proporcionada por la barra a 0,4 m de altura con las boquillas colocados en pares, fue conseguida con las boquillas 80-EF-02, trabajando a la presión de 400 kPa, proporcionando un CV de 18%.

  18. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    Lei Zhong; Feng Zhang; Yu Zhai; Yanhui Cao; Si Zhang; Yaqing Chang

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three mi...

  19. Dicty_cDB: Contig-U01465-1 [Dicty_cDB

    Full Text Available ngylocentrotus purpuratus clone R3-3039C22, W... 48 0.43 4 ( EF158072 ) Plasmodium falciparum erythrocyte membra...ry ... 46 2.1 1 ( FE818683 ) CCAG34291.b1 CCAG Petrolisthes cinctipes heart, g... 46 2.1 1 ( FE...800468 ) CCAG23241.g1 CCAG Petrolisthes cinctipes heart, g... 46 2.1 1 ( FE800467 ) CCAG23241.b1 CCAG Petrol...Y329335 ) CAWY2264.fwd CAWY Helobdella robusta Subtracted E... 46 0.099 2 ( AC179628 ) Strongylocentrotus purpura... EY389431 ) CAXA7847.rev CAXA Helobdella robusta Subtracted L... 34 4.9 2 ( EH074316 ) PMDB174TO Pe

  20. Sequence and submolecular localization of the 115-kD accessory subunit of the heterotrimeric kinesin-II (KRP85/95) complex

    1996-01-01

    The heterotrimeric kinesin-II holoenzyme purified from sea urchin (Strongylocentrotus purpuratus) eggs is assembled from two heterodimerized kinesin-related motor subunits of known sequence, together with a third, previously uncharacterized 115-kD subunit, SpKAP115. Using monospecific anti-SpKAP115 antibodies we have accomplished the molecular cloning and sequencing of the SpKAP115 subunit. The deduced sequence predicts a globular 95-kD non-motor "accessory" polypeptide rich in alpha-helical ...

  1. Identification of a repeated sequence in the genome of the sea urchin which is transcribed by RNA polymerase III and contains the features of a retroposon.

    Nisson, P E; Hickey, R. J.; Boshar, M F; Crain, W R

    1988-01-01

    A repeated sequence element which is located about 200 nucleotides upstream from the protein-coding portion of the muscle actin gene (probably within a large 5' intron) in the genome of the sea urchin, Strongylocentrotus purpuratus has been characterized, and shown to contain the sequence features which indicate that it has been transposed by means of an RNA intermediate. This retroposon-like sequence, SURF1-1, is a member of a family which is dispersed and repeated about 800 times in the gen...

  2. Dicty_cDB: Contig-U01967-1 [Dicty_cDB

    Full Text Available =Neural Wiskott-Aldrich syndrome protein; ... 38 0.96 ( O80517 ) RecName: Full=Uclacyanin-2; AltName: Full...=Uclacyanin-II... 38 0.96 CP000249_642( CP000249 |pid:none) Fran...agen cyanog... 34 1.4 AF211852_1( AF211852 |pid:none) Danio rerio GAP-associated phos...cus tauri strain OTTH059... 42 0.051 K03206_1( K03206 |pid:none) Human PRB1 locus salivary prolin...0.008 M92040_1( M92040 |pid:none) Strongylocentrotus purpuratus alpha 1 ... 39 0.

  3. Dicty_cDB: Contig-U03592-1 [Dicty_cDB

    Full Text Available plete sequ... 34 0.015 15 ( AE014842 ) Plasmodium falciparum 3D7 chromosome 11 section 7... 42 0.015 11...modium falci... 32 0.10 3 ( AE014823 ) Plasmodium falciparum 3D7 chromosome 14 sectio...s purpuratus clone R3-3040G7, WO... 40 0.26 5 ( AE014820 ) Plasmodium falciparum 3D7 chromosome 14 section 5... 12, section ... 36 0.38 10 ( AC117076 ) Dictyostelium discoideum chromosome... 4 clone B316M24 map 4q25,... 44 0.62 7 ( AE014821 ) Plasmodium falciparum 3D7 chromosome 14 sectio

  4. Dicty_cDB: Contig-U15959-1 [Dicty_cDB

    Full Text Available g t... 46 2.8 1 ( DL073161 ) Expression method of recombinant protein having t... 46 2.8 1 ( CS498545 ) Sequence 3 from...ssion method. 46 2.8 1 ( DL073179 ) Expression method of recombinant protein havin...( DW021003 ) PMAD-aac06g03.g1 Lamprey_WGS_pCMV-sport6 Petromyz... 48 0.72 1 ( AM522569 ) Paracentrot...0990 ) Plasmodium knowlesi strain H chromosome 8, comple... 46 2.8 1 ( AC165428 ) Strongylocentrot...ngylocentrotus purpuratus clone R3-14J20, WOR... 34 0.40 2 ( AC158254 ) Ornithorhynchus anatin

  5. Dicty_cDB: Contig-U12484-1 [Dicty_cDB

    Full Text Available s purpuratus clone R3-3083B11, W... 36 0.76 8 ( AE014841 ) Plasmodium falciparum 3D7 chromosome 11 section 6...LOW-PASS SEQUENCE ... 46 3.7 1 ( DX414313 ) SOYBF93TH LargeInsertSoybeanGenLibBuild4 Glycine ... 46 3.7 1 ( ...nus DNA, clone:MSMg01-142N08.... 34 8.9 2 ( AE014817 ) Plasmodium falciparum 3D7 chromosome 14 section 2... ...ngth = 1426 Score = 1279 bits (645), Expect = 0.0 Identities = 645/645 (100%) Strand = Plus / Plus Query: 1 gatttgctcagtttct...|||||||||||||||||||||||||||||||| Sbjct: 601 attactctttgaatatgccagagagttacataaattcacatcact 645 Score = 1094 bits (552), Expect

  6. Dicty_cDB: Contig-U12479-1 [Dicty_cDB

    Full Text Available um 3D7 chromo... 35 5.6 DQ008305_1( DQ008305 |pid:none) Staphylococcus simulans biofi...74,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U12479-1 (Conti.........................................done Score E Sequences producing significant alignments: (bits) Value N ( BJ440937 ) Dic...purpuratus clone R3-3108A8, WO... 46 3.2 1 ( BH479067 ) BOGXM92TR BOGX Brassica oleracea genomic clone BO......ata genom... 46 3.2 1 ( ED536535 ) KBrB129H08F KBrB, Brassica rapa BamHI BAC libr

  7. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    Dora A. Taboada P.

    2014-06-01

    Full Text Available En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos moluscos. El 100% de ellos presentó contaminación por E. coli.

  8. Dicty_cDB: Contig-U01585-1 [Dicty_cDB

    Full Text Available us purpuratus clone R3-61N10, WOR... 42 0.13 3 ( AY392443 ) Dictyostelium discoideum possible endotoxin... AX4 chromosome 2 ... 38 0.004 8 ( EX849445 ) CBNC7929.rev CBNC Phycomyces blakesleeanus NRRL15... 38... DNA, STS on chromosome 8, D8S0163i, ... 50 0.15 1 ( S59342 ) nuclear pore complex glycoprotein...d (901 letters) Database: CSM 8361 sequences; 7,895,291 total letters Score E Sequences producing significan...quences; 101,790,757,118 total letters Searching..................................................done Score E Sequences producin

  9. Dicty_cDB: Contig-U13778-1 [Dicty_cDB

    Full Text Available se: 95,242,211,685 Length adjustment: 23 Effective length of query: 585 Effective length of databa...gth adjustment: 122 Effective length of query: 80 Effective length of databa... Motch B protein - mouse (fragment) ... 36 0.74 BC044262_1( BC044262 |pid:none) Xenopus laevis similar to de...X-Delta-2 ... 36 0.74 M17421_1( M17421 |pid:none) Strongylocentrotus purpuratus putati...se: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant alignment

  10. Dicty_cDB: Contig-U15575-1 [Dicty_cDB

    Full Text Available nnnnnnnnnnnnnnnnnnnnkndeyyfqnlnkhnniynnnnknsl yeylyfynepikmghipyqtkilifldefnfpinvgdip...dary hyperparathyroid... 34 3.5 2 ( AC178577 ) Strongylocentrotus purpuratus clon...... 32 0.050 21 ( AE014837 ) Plasmodium falciparum 3D7 chromosome 11 section 2... 36 0.065 16 ( AC127602 ) Rattus norvegicus clon...00123 ) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.15 22 ( AE014822 ) Plasmodium falciparum 3D7 chromosome 14 section...mosome 2 map 5018074... 38 0.17 18 ( CR382399 ) Plasmodium falciparum chromosome 6, complete sequ... 34 0.17 21 ( AF538053 ) Mon

  11. Dicty_cDB: Contig-U11962-1 [Dicty_cDB

    Full Text Available . ATCC 19397, complete... 38 0.16 2 ( CP000727 ) Clostridium botulinum A str. Hall, complet...otus purpuratus clone R3-3091C13, W... 48 1.3 1 ( CW414019 ) fsbb001f113h10f0 Sorghum methyla...e diphosphate... 63 4e-08 AJ005836_1( AJ005836 |pid:none) Cicer arietinum...AX344835 ) Sequence 260 from Patent WO0200927. 40 0.006 5 ( CP001078 ) Clostridium botulinum E3 str. Ala..... 36 0.16 15 ( AM412317 ) Clostridium botulinum A str. ATCC 3502 complete g... 38 0.16 2 ( CP000726 ) Clostridium botulinum A str

  12. Innate Immune Complexity in the Purple Sea Urchin: Diversity of the Sp185/333 System

    Smith, L. Courtney

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks o...

  13. Dicty_cDB: Contig-U06541-1 [Dicty_cDB

    Full Text Available cyclase... 44 7.5 1 ( EF152287 ) Strongylocentrotus purpuratus BRCA1 (brca1) mRNA,... 44 7.5 1 ( AC131169 ) ...1 ( CW927554 ) EDCBM45TF A. castellanii, 6-8 kb library from tot... 44 7.5 1 ( CL534328 ) trib011xa13.g1 T. reesei HindIII BAC libr...us lewisii genomic, ge... 44 7.5 1 ( CW927722 ) EDCBN39TR A. castellanii, 6-8 kb library from tot... 44 7.5 ...ce (All Frames) Frame A: t*idtnkkmkllfilliltitiknclsinindnnnqiinlkindtsysmvpyqdeaca...E Sequences producing significant alignments: (bits) Value Contig-U06541-1 (Conti

  14. Dicty_cDB: Contig-U13049-1 [Dicty_cDB

    Full Text Available 20, WOR... 48 0.32 1 ( AC179852 ) Strongylocentrotus purpuratus clone R3-1007J5, WO... 48 0.32 1 ( AU061377 ) Dictyostelium discoi...elium discoideum chromosom... 33 3.5 CP000107_458( CP000107 |pid:none) Ehrlichia canis str..............................done Score E Sequences producing significant alignments: (bits) Value N ( BJ382164 ) Dictyostelium discoi..._150( AL844504 |pid:none) Plasmodium falciparum 3D7 chromo... 38 0.19 CP000246_1573( CP000246 |pid:none) Clostr...90 |pid:none) Plasmodium knowlesi strain H chr... 37 0.24 AL034557_42( AL034557 |

  15. Las comunidades de mitilidos del mediolitoral rocoso del departamento de Lima

    Carlos Paredes

    2014-06-01

    Full Text Available Se estudiaron 34 muestras de los conglomerados de mitilidos de la zona medio litoral rocosa del Departamento de Lima, (10°45'38"S a 12°57'39"S, tomadas periódicamente, entre junio y noviembre de 1972. Utilizando el método del índice biológico, se determinó la existencia de dos comunidades: Comunidad de Perumytilus purpuratus (Lamarck, 1819, en el horizonte medio de la zona mediolitoral. Comunidad de Semimytilus algosus (Gould, 1850, en el horizonte inferior de la zona mediolitoral.

  16. Dicty_cDB: CHS334 [Dicty_cDB

    Full Text Available fkslkisllklkrennlns*kiinqfhl*lqlvmyq vqlqlq*llqfnqllmnlqvviiimitviqqllqqlqllqq*mieikqprqfkrhgkiiv vsnnlkkklklknylkilvncylim...50 0.012 6 AZ188093 |AZ188093.1 SP_1011_B1_A04_T7A Strongylocentrotus purpuratus, purple sea urchin , sperm genomi...keihlkiikh*ilksmmmkiminhktitimnqtnk lnqmkilkikmkmlkikmkmlkikmkmkkikskikyiknfk*k*k*rnnkk Frame... AE006471_96( AE006471 |pid:none) Salmonella typhimurium LT2 strain... 35 7.6 CR940352_701( CR940352 |pid:no... 3.4 AE017340_616( AE017340 |pid:none) Idiomarina loihiensis L2TR, comp... 35 5.8

  17. Immunofluorescence localization of dissociation supernatant and extracellular matrix components in Lytechinus pictus sectioned embryos. M.S. Thesis

    Garciaflack, Ana Leticia

    1988-01-01

    Indirect immunofluorescence was used to localize specific extracellular components in embryos of the sea urchin Lytechinus pictus. Hyalin and S2 (a group of components found in the disaggregation supernatant from Strongylocentrotus purpuratus blastulae) were uniformly present at all stages (unfertilized up to 32 hr) except hyalin could not be detected at the 12 hour early blastula stage. Laminin was found in 16 cell, 32 cell, 6 hour, 18 hour, 24 hour, and 32 hour stages, with especially bright fluorescence at 18 hours. Collagen I was present at all stages (freshly fertilized up to 32 hour) except little was detected at 12 hours. Fibronectin was uniformly present in blastocoelar fibers stained with anto-collagen I and anti-fibronectin. These results were compared with those for S. purpuratus to produce an overview of the localization of specific extracellular matrix components during development of two species of sea urchins. The results set the stage for future studies that will examine the function of these components at the various developmental stages.

  18. Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division

    Robertson, Anthony J.

    2013-03-25

    In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.

  19. La recepción de la obra de José María Arguedas: reflexiones preliminares

    Carlos García-Bedoya Maguiña

    2012-05-01

    Full Text Available José María Arguedas es no sólo un autor clave del canon literario peruano, sino también una figura emblemática de la cultura nacional. El marco simbólico de la conmemoración de los cien años de su nacimiento resulta sin duda oportuno para intentar reflexionar sobre la recepción de su obra. Los estudios de la recepción ofrecen, por cierto, un amplio abanico de posibilidades. Centraré mis reflexiones de manera muy sintética en sólo tres aspectos: la trayectoria de la crítica arguedista, la relevancia teórica de la obra de Arguedas, y la dimensión social y simbólica de su figura.

  20. Efectos de las pérdidas de peso y la deshidratación en deportes de combate: una revisión

    Martínez Abellán, Alberto

    2013-01-01

    La inmensa mayoría de los deportistas de combate realizan diferentes estrategias de rápida reducción de su peso unas pocas semanas o días antes del torneo. Mediante un amplio abanico de técnicas y métodos poco estudiados en la literatura científica, los deportistas realizan en un primer momento estas bajadas de peso basadas en a pérdida de masa grasa y masa muscular, retrasando hasta los últimos días u horas antes del pesaje oficial una extrema desidratación. En esta revisión se analizan 1) l...

  1. Sobre la toma de decisiones económicas bajo incertidumbre

    Aurora García Gallego

    2012-04-01

    Full Text Available En este artículo resumimos la evolución de la Teoría Económica sobre la toma de decisiones bajo incertidumbre. Tras una breve introducción a la teoría de la Utilidad Esperada, nos referimos a comportamientos paradójicos que obligaron a los economistas a adoptar teorías menos simplistas que permitieran explicar un mayor abanico de fenómenos. La mayor complejidad conlleva una descripción multidimensional de las actitudes humanas frente al riesgo económico. Sin embargo, las mediciones de la actitud frente al riesgo utilizadas por los economistas continúan siendo, en su mayoría, unidimensionales.

  2. CRÓNICA: EL MILAGROSO DE LA VILLA: EL ABOGADO DE LOS POBRES

    Edgar Rey Sinning

    2004-08-01

    Full Text Available Por fin hemos llegado. Son las tres de la maÒana de un s·bado caluroso del mes de marzo. Estamos en la Villa de San Benito Abad. Hemos cumplido el deseo de ir a conocer de cerca lo que sucede durante dos dÌas en este municipio sucreÒo, localizado a las orillas de la ciÈnaga del mismo nombre. Ya los tenderetes de los vendedores trashumantes est·n por todas partes. TambiÈn han llegado campesinos (agropescadores, unos por carretera, otros por agua, convertidos para estas fechas en vendedores de abanicos de mano, mochilas, pellones, hamacas, sombreros. Adem·s, de pescado, loros, pericos y hasta bultos de leÒa. Por todas partes se ofrece productos tradicionales o algunos inventos nuevos.

  3. Fotogrametría de bajo coste para la modelización de edificios históricos

    José Luis Pérez García

    2011-04-01

    Full Text Available En los últimos tiempos las metodologías y herramientas utilizadas para el estudio y la documentación del patrimonio histórico han sufrido un importante avance al disponer de un mayor abanico de posibilidades para abordar estas tareas. Sin embargo, algunas de estas nuevas posibilidades, tales como las estaciones fotogramétricas digitales o el sistema láser escáner, si bien facilitan y mejoran de manera importante los trabajos y productos obtenidos, tienen un coste bastante elevado, que en muchos casos no permiten su utilización. En este trabajo se presentan diferentes técnicas fotogramétricas de bajo coste, que permiten obtener productos con precisiones aceptables y muy interesantes para el estudio, la documentación y modelización de documentos históricos.

  4. Lyrics against images: music and audio description

    Igareda Gonzalez, Paula

    2012-01-01

    La música ha sido una parte integral del cine desde la época del cine mudo, en el que se utilizaba un piano para construir la narración y se recurría a una orquesta para cubrir el sonido del proyector. Asimismo, puede abarcar un amplio abanico de elementos, desde una canción hasta un silbido, y puede desempeñar muchos papeles. Debido a la importancia de la música dentro de la narración fílmica, es un elemento que merece atención a la hora de hacer accesible una película, bien s...

  5. Competencias integradas inglés/historia a través de la revolución industrial: propuesta didáctica

    Sergio Díaz Menéndez

    2015-01-01

    Full Text Available En este trabajo propongo varias tareas con objetivos, contenidos y criterios de evaluación para medir el desarrollo integrado de las compe- tencias básicas, así como varios instrumentos que permitan controlar este desarrollo competencial. El tema elegido será la Revolución Indus- trial, muy relevante dado que los alumnos deben aprender los contenidos del currículo de ambos territorios (Reino Unido y España en un contex- to de Secundaria bilingüe inglés/español mediante acuerdo con el British Council. Se encuentra que la literatura es una herramienta de aprendizaje eficaz y que el abanico de textos elegibles es más amplio de lo esperado.

  6. Revisión estratigráfica y paleoambientes del Grupo Angulos (Neógeno, Sierra de Famatina, La Rioja: Su significado en el relleno del antepaís fragmentado

    F.M. Dávila

    2005-03-01

    Full Text Available Sobre la ladera oriental de la sierra de Famatina se expone una espesa sucesión sinorogénica terciaria (>1500 m, conocida como los "Estratos Calchaquenses", designada formalmente como Grupo Angulos. Este grupo fue originalmente subdividido en tres formaciones: del Abra, del Buey y El Durazno. Este trabajo redescribe la estratigrafía del Grupo Angulos, y modifica y subdivide la Formación El Durazno, al redefinir su sección basal de areniscas con megaestratificación cruzada como Formación Santo Domingo. Once facies sedimentarias caracterizan al Grupo Angulos con predominio de términos silicoclásticos, volcanoclásticos, por sobre los carbonáticos. La asociación de facies de la Formación del Abra permite interpretar un ambiente de abanicos aluviales proximales que evolucionaron hacia abanicos terminales, con procesos de baja eficiencia en la sección basal que son reemplazados paulatinamente por asociaciones de alta eficiencia hacia el tope de la formación. En transición, una asociación de facies de abanicos distales caracteriza a la Formación del Buey, con desarrollo de cuerpos tabulares de calizas biolaminadas y paleosuelos que sugieren un ambiente con escasa pendiente y reducidas tasas de sedimentación. Una alternancia de conjuntos con megaestratificación cruzada y conglomerados arenosos con superficies fuertemente incisivas componen la Formación Santo Domingo sugiriendo sistemas de interacción eólico-fluvial. En discordancia la Formación El Durazno muestra una evolución paleoambiental desde planicies fluviales entrelazadas con fuerte influencia volcánica hacia sistemas de abanicos dominados por procesos de alta eficiencia. Las unidades del Grupo Angulos se disponen en tres megasecuencias, una basal grano decreciente seguida de dos grano crecientes. La ubicación del Grupo Angulos entre el Mioceno Inferior (Formación del Crestón y niveles de tobas datadas en 4 Ma, junto otras evidencias paleontológicas y correlaciones

  7. La atención a los padres con hijos con necesidades educativas especiales (NEE

    Claudia María Pernas Pico

    2011-01-01

    Full Text Available Los padres que tienen hijos con necesidades educativas especiales (NEE necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, etc... Siempre desde la empatía y la profesionalidad que debe transmitir el maestro de Audición y Lenguaje. Cambiando la preocupación de los padres por su ocupación.

  8. Integración de las músicas urbanas en el aula de infantil: hip hop y rap

    Casado Maestro, Cristina

    2015-01-01

    El Trabajo de Fin de Grado trata de dar a conocer a los profesionales de la educación infantil, que hay que trabajar todo tipo de géneros musicales para despertar el interés de los niños y abrirles un abanico de posibilidades. En este caso en concreto a través de la cultura hip hop he desarrollado y trabajado con ellos: la poesía, el cuento, el ritmo, la dramatización, el dibujo, la psicomotricidad, la informática, etc…y valores como el respeto, la socialización y el compañerismo principalmen...

  9. El Triásico de la región Nuevalos-Cubel (Zaragoza). Sedimentación en un sector del borde de cuenca del surco Molina-Valencia.

    García Royo, J.F.C.; Arche, Alfredo

    1987-01-01

    El Triásico de la región Nuévalos-Cubel (Zaragoza) se depositó en el flanco SO del Umbral de Ateca, límite de la Cuenca Ibérica durante la mayor parte de este período. La sedimentación, controlada por falías de dirección NO-SE, comenzó al O por abanicos aluviales retrogradantes, seguidos de ríos meandriformes, diversos complejos costeros siliciclásticos y al comienzo de la sedimentación de las facies Muschelkalk> el Umbral queda totalmente cubierto por sedimentos. Se hace...

  10. El Triásico de la región Nuévalos - Cubel (Zaragoza). Sedimentación en un sector de cuenca del surco Molina-Valencia.

    Arche, A.; García-Royo, J. F. C.

    1987-01-01

    [ES] El Triásico de la región Nuévalos-Cubel (Zaragoza) se depositó en el flanco SO del Umbral de Ateca, límite de la Cuenca Ibérica durante la mayor parte de este período. La sedimentación, controlada por falías de dirección NO-SE, comenzó al O por abanicos aluviales retrogradantes, seguidos de ríos meandriformes, diversos complejos costeros siliciclásticos y al comienzo de la sedimentación de las facies Muschelkalk> el Umbral queda totalmente cubierto por sedimentos. Se ...

  11. Formulación material y espacial del modelo geometricamente exacto de piezas alargadas

    Lázaro Fernández, Carlos Manuel

    2008-01-01

    El análisis de la respuesta mecánica de piezas alargadas que experimentan grandes desplazamientos y rotaciones constituye un campo en el que se han producido avances significativos en las tres últimas décadas, tanto desde el punto de vista de la formulación de modelos físicos como de la búsqueda de soluciones numéricas. El ámbito de aplicación de este tipo de modelos se separa quizás del abanico de problemas de los que tradicionalmente se ha ocupado la ingeniería civil, aproximándose más a si...

  12. Contribución a los protocolos anticolisión y técnicas de dimensionamiento para sistemas de identificación por radiofrecuencia

    Bueno Delgado, María Víctoria

    2010-01-01

    [ESP] Desde la aprobación en el año 2005 del estándar EPC Global Class 1 Gen 2, la tecnología RFID ha experimentado un gran auge, sustituyendo, en ciertos sectores, a otros sistemas de identificación automática como el código de barras. Asimismo, se ha despertado un mayor interés de investigadores y de la comunidad científica en la tecnología RFID. El futuro es prometedor, con un amplio abanico de ámbitos de uso, por ejemplo, en domótica, sistemas de control y pago, sanidad, transporte ...

  13. JunB y la proliferación celular: mecanismos de control y dianas transcripcionales

    Pérez Benavente, Beatriz

    2015-01-01

    El factor de transcripción AP-1, formado por los miembros de la familia Jun, Fos y ATF, es un mediador de la expresión génica en respuesta a un amplio abanico de estímulos extracelulares. AP-1 está involucrado en el control de la proliferación, la transformación celular y la apoptosis. El factor de transcripción JunB, miembro de la familia Jun, se comporta como supresor tumoral u oncogén dependiendo del contexto celular. Su sobreexpresión se asocia a la patogénesis de algunos linfomas, como e...

  14. Estratigrafía de la Formación del Crestón, sierra de Famatina, Argentina: Sedimentación paleógena en el antepaís andino? Geology of the Del Creston Formation, Famatina Ranges, Argentina: Paleogene sedimentation in the Andean Foreland?

    F. M. Dávila

    2002-12-01

    Full Text Available Se redescriben y analizan los espesos depósitos de la Formación del Crestón (>1700m en el antepaís andino en la región del Famatina (Provincia de La Rioja, que en el pasado han sido relegados. Se definen sus paleoambientes y se discute su posición estratigráfica, edad y significado en el contexto de los depósitos sinorogénicos de la región del antepaís fragmentado. La unidad, dominantemente areno-conglomerádica y de color rojo-morada registra una evolución en dos megaciclos granoestratocrecientes que representan una progresión desde etapas con escaso relieve a depósitos gruesos que caracterizan sectores proximales de abanicos aluviales. En el megaciclo inferior se suceden barreales (fangosos y salinos, abanicos terminales y abanicos aluviales de baja eficiencia mientras que en el ciclo superior se suceden depósitos de barreales, depósitos de sistemas entrelazados mixtos y abanicos aluviales de alta eficiencia. La diferencia composicional entre los conglomerados cuspidales de cada ciclo permite asociar el primero a devastación de cúpulas y coladas volcánicas andesíticas mientras que el segundo se vincula con exhumación de cuerpos granitos que conforman parte del marco de antepaís fragmentado. En este trabajo, y a partir de relaciones de campo, los depósitos de la Formación del Crestón se consideran como antecesores de los clásicos depósitos sinorogénicos neógenos (Grupo Angulos y se relacionan con evidencias aportadas por trazas de fisión y actividad orogénica en otras regiones de los Andes centrales para sostener que la unidad puede representar el registro más antiguo de la sedimentación de antepaís preservado en esta región. Asimismo, se infiere que el inicio de la fragmentación del antepaís andino y la evolución geológica de la región de Famatina es bastante más compleja de lo establecido con anterioridad.Largely ignored thick (>1700m dominantly conglomeratic and sandy red-purple strata of the Del

  15. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    Felipe Soto-Pérez

    2012-07-01

    Full Text Available Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra. en Psicología por la Universidad de Boston y Máster por la Universidad de Harvard.

  16. Daño hepático y enfermedad celíaca Liver damage and celiac disease

    M. D. Cantarero Vallejo; J. Gómez Camarero; L. Menchén; J. A. Pajares Díaz; Lo Iacono, O

    2007-01-01

    La enfermedad celiaca (EC) es una causa importante de elevación de transaminasas: entre un 5 y un 10% de los pacientes con elevación crónica, criptogénica, de las transaminasas presentan EC y, al contrario, la EC puede estar asociada a diferentes enfermedades hepáticas. En efecto, un amplio abanico de patología hepática puede asociarse a EC, tanto en niños como en adultos, que pueden resumirse en: a) daño hepático mínimo caracterizado por la ausencia de síntomas o signos clínicos asociables a...

  17. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.

  18. Anomalías morfoestructurales del drenaje del Río Salado sobre las Lomadas de Otumpa (Santiago del Estero y Chaco detectadas por procesamiento digital

    Verónica G Peri

    2010-06-01

    Full Text Available Se estudia la morfología y dinámica del abanico aluvial del río Salado del Norte, localizado en la región del Gran Chaco (provincias de Santiago del Estero y Chaco, dentro del piedemonte distal que se desarrolla a partir del levantamiento andino. Mediante el procesamiento digital integrado de imágenes satelitales ópticas y modelo digital de elevaciones (MDE, se reconocieron direcciones de escurrimiento, morfologías y edades relativas de cuatro grupos de paleocauces que se le asocian. Además, se realizó una caracterización del drenaje a partir de anomalías de desviamiento local y/o modificaciones en los diseños de cursos, que se acomodan a las estructuras y/o topografías regionales, particularmente en áreas de bajo relieve. Así, se han evidenciado dos importantes cambios en su dinámica, uno a escala regional a partir del gradual desvío de su cauce principal hacia el sur, y otro local, asociado al levantamiento de las Lomadas de Otumpa. De esta manera, se detectan anomalías o cambios en el régimen hidrogeológico, donde el antiguo abanico aluvial fue modificado, interrumpiéndose progresivamente su pendiente natural al extremo, que ahora la invierte hacia el noroeste y desvía el curso principal hacia el sur, donde fluye actualmente. La cartografía digital, complementada con el conocimiento geológico de superficie y subsuelo, resulta una herramienta de interpretación morfoestructural localmente insustituible en zonas de llanura con relieve poco evidente, y contribuye al mejor manejo de los recursos naturales asociados.

  19. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.

  20. Lavas Las Pataguas: volcanismo alcalino en el antearco andino del Mioceno Inferior, Chile central Lavas Las Pataguas: alkaline volcanism in the Early Miocene Andean forearc of central Chile

    Renate M Wall

    2001-12-01

    Full Text Available La presencia de rocas volcánicas del Mioceno Inferior en la cordillera de la Costa de Chile central constituye una singularidad ya que los afloramientos más occidentales del arco volcánico oligo-mioceno se encuentran 80 km al este. Lavas Las Pataguas (LLP; 33,8°S, se expone en 1,15 km², sin vestigios de un edificio volcánico ni conductos alimentadores. La presencia de túmulos del tipo `flow lobe tumuli', alineados y elongados en dirección este-oeste, indica un flujo local desde el oeste sobre una superficie de muy baja pendiente. Estos antecedentes sugieren un ciclo eruptivo de tipo fisural. La edad de LLP de ca. 18 Ma resulta intermedia entre las formaciones Abanico (34-20 Ma y Farellones (20-10 Ma y coetánea a facies litorales de la Formación Navidad, expuestas 20 km al oeste. LLP presenta contenidos de sílice de 52,8-54,5%, en el rango de las traquiandesitas basálticas, y su alto contenido de álcalis (6,21-6,26% de K2O+Na2O las sitúa en la serie alcalina de diferenciación. Destaca la clara diferencia con los productos toleíticos de la Formación Abanico, y los típicamente calcoalcalinos de la Formación Farellones. Estas lavas están significativamente enriquecidas en tierras raras livianas, con una razón La/Sm de 3,4 y un patrón plano de tierras raras pesadas. Tanto el contenido de sílice como de MgO, indican un estado de diferenciación avanzado dominado por cristalización fraccionada de olivino, clinopiroxeno y magnetita. El contenido de Ba y Nb señalaría una contribución significativa del manto litosférico. El Th, y la anomalía de Ta-Nb indicarían, también, un sello cortical. Su particular petrogénesis, así como su posición occidental y aislada en el antearco, podría explicarse como respuesta a la desaceleración de la convergencia con que culmina el ciclo extensional vigente hasta el Mioceno Inferior alto y que acompañó al volcanismo representado por la Formación Abanico. De este modo, las lavas

  1. Integrated bioremediation techniques in a shrimp farming environment under controlled conditions

    SONG Xianli; YANG Qian; REN J. Shengmin; SUN Yao; WANG Xiulin; SUN Fuxin

    2016-01-01

    This study investigated the integrated bioremediation techniques for a shrimp culture system to reduce unconsumed feed and the contents of suspended solids (SS), nutrients and organic pollutants using barracuda, clamworm, scallop, large algae and a biofilter. A multi-pool internal circulation system was designed to test the effectiveness of the techniques in the laboratory. The experimental result has shown thatArgopecten irradians, Gracilaria lemaneiformis and the biofilter efficiently reduced the contents of SS, dissolved inorganic carbon (DIC) and dissolved organic carbon (DOC) in the breeding wastewater. The amount of unconsumed feed was significantly reduced by barracuda and clamworm, but there was an increase in the contents of SS, DIC and DOC in the water due to disturbance by the barracuda and clamworm. The capacity of macroalgae to extract inorganic nitrogen was insufficient. However, the balance of the nitrogen fixation rate of macroalgae and the biological exhaust nitrogen rate within the system should be fully considered. The use of the biofilter alone was not optimal for the remediation of organic matter in shrimp effluent so that auxiliary foam separation technology is needed to improve the ability of the system to remove macromolecules. This study provides a basis for the further development of remediation techniques to reduce the environmental impact of shrimp aquaculture.

  2. Cloning of a big defensin gene and its response to Vibrio parahaemolyticus challenge in the noble scallop Chlamys nobilis (Bivalve: Pectinidae).

    Yang, Jianqing; Luo, Jiafu; Zheng, Huaiping; Lu, Yeqing; Zhang, Hongkuan

    2016-09-01

    The noble scallop Chlamys nobilis has been an important marine cultured bivalve in the Southern Sea of China for decades. However, large-scale mortality events often occurred during the scallop' cultivation. As one of AMPs (antimicrobial peptides), big defensin is an important component of the innate immunity against pathogenic microorganisms in invertebrates. In order to investigate whether the big defensin can play a role in the immune defense against pathogenic microorganisms in noble scallop, a big defensin gene from the hemocytes of Chlamys nobilis (CnBD) was cloned, and the mRNA level was measured after an acute Vibrio parahaemolyticus challenge of 36 h. The CnBD cDNA contains an open reading frame (ORF) of 381 bp encoding a peptide of 126 amino acids residues. The deduce amino acid sequence of CnBD shows a high similarity with that from Argopecten irradians and displays common features of big defensin, indicating that CnBD is a new member of the big defensin family. Compared with the control group, the relative mRNA level of CnBD was significantly up-regulated at 3, 24 and 36 h. The present result indicated that CnBD played an immune role against bacterial infection in noble scallop. PMID:27474446

  3. Molecular identification of scallop planktonic larvae using species-specific microsatellites

    ZHAN Aibin; HU Xiaoli; BAO Lisui; LU Wei; PENG Wei; WANG Mingling; HU Jingjie

    2008-01-01

    The identification of scallop larvae is essential to understand the population structure and community dynamics and to assess the potential environmental impacts caused by scallop larvae released or escaped. However, the larvae identification by morphological characteristics is notoriously difficult, mainly due to the small size (usually being less than 150 μm) and vague morphological characteristics among different scallop species. A simple and accurate molecular method was developed to identify four economically farmed scallop species, the Zhikong scallop Chlamys farreri, the noble scallop C. nobilis, the bay scallop Argopecten irradians and the Yesso scallop Mizuhopecten yessoensis. The tests used the high degree of species-specific micresatellite markers, which was specified by transferability analyses, assessed by reference individuals and evaluated by BLAST searches. The sensitivity test indicated that the species-specific micresatellites were sensitive enough for the detection of 1%~2% larvae in mixed plankton samples, larvae collected from scallop hatcheries and their effluents and from the artificially controlled crosses were well identified to the species/hybrid level. The results demonstrated that the one-step PCR-based assay was technically simple, inexpensive and robust in identification analyses, and also less sensitive to initial quality of template DNA extracted from the ethanol-preserved samples for several years.

  4. Phylogenetic analysis of Pectinidae (Bivalvia) based on the ribosomal DNA internal transcribed spacer region

    2007-01-01

    The ribosomal DNA internal transcribed spacer (ITS) region is a useful genomic region for understanding evolutionary and genetic relationships. In the current study, the molecular phylogenetic analysis of Pectinidae (Mollusca: Bivalvia) was performed using the nucleotide sequences of the nuclear ITS region in nine species of this family. The sequences were obtained from the scallop species Argopecten irradians, Mizuhopecten yessoensis, Amusium pleuronectes and Mimachlamys nobilis, and compared with the published sequences of Aequipecten opercularis, Chlamys farreri, C. distorta, M. varia, Pecten maximus, and an outgroup species Perna viridis. The molecular phylogenetic tree was constructed by the neighbor-joining and maximum parsimony methods. Phylogenetic analysis based on ITS1, ITS2, or their combination always yielded trees of similar topology. The results support the morphological classifications of bivalve and are nearly consistent with classification of two subfamilies (Chlamydinae and Pectininae) formulated by Waller. However, A. irradians, together with A. opercularis made up of genera Amusium, evidences that they may belong to the subfamily Pectinidae. The data are incompatible with the conclusion of Waller who placed them in Chlamydinae by morphological characteristics. These results provide new insights into the evolutionary relationships among scallop species and contribute to the improvement of existing classification systems.

  5. AUTOCHTHONOUS BIOFACIES IN THE PLIOCENE LORETO BASIN, BAJA CALIFORNIA SUR, MEXICO

    MICHELE PIAZZA

    1998-07-01

    Full Text Available The present paper examines the molluscan and/or echinoid assemblages recovered from two lithostratigraphic units (Piedras Rodadas Sandstone and Arroyo de Arce Norte Sandstone outcropping in the Pliocene Loreto Basin, Baja California Sur, Mexico. Ten biofacies have been identified, i.e. Trachycardium procerum-Trachycardium senticosum Biofacies, Chione compta-Transennella modesta Biofacies, Laevicardium elenense-Chione kelletii Biofacies, Xenophora sp. 1-Strombus subgracilior Biofacies, Crassostrea californica osunai Biofacies, Myrakeena angelica Biofacies, Vermetid-Nodipecten Biofacies, Argopecten abietis abietis Biofacies, Aequipecten dallasi Biofacies and Encope Biofacies. The first four biofacies have been defined on the basis of statistical analyses (cluster analysis, MDS. The other six, which are monospecific or definitely low-diversity, were already identified during field work. The deduced paleoecological bearing of biofacies, largely relying upon the comparison to their closest modern counterparts, provides the basis for the paleoenvironmental reconstruction. The latter also considers sedimentological evidence and is framed within the tectonic and sedimentary context recently proposed by American workers. Biofacies point toward environments differing in terms of substrate texture, presence/absence of vegetal cover, energy level, variously distributed within the low tide mark-40 m bathymetric range. 

  6. Composition, abundance, biomass, and production of macrofauna in a New England estuary: comparisons among eelgrass meadows and other nursery habitats

    Heck, K.L., Jr.; Able, K.W.; Roman, C.T.; Fahay, M.P.

    1995-01-01

    Quantitative suction sampling was used to characterize and compare the species composition, abundance, biomass, and secondary production of macrofauna inhabiting intertidal mudflat and sandflat, eelgrass meadow, and saltmarshpool habitats in the Nauset Marsh complex, Cape Cod, Massachusetts (USA). Species richness and abundance were often greatest in eelgrass habitat, as was macroinvertebrate biomass and production. Most striking was the five to fifteen times greater rate of annual macrofaunal production in eelgrass habitat than elsewhere, with values ranging from approximately 23139 g AFDW m super(2) yr super(1). The marsh pool containing widgeon grass (Ruppia maritima) supported surprisingly low numbers of macroinvertebrates, probably due to stressfully low dissolved oxygen levels at night during the summer. Two species of macroinvertebrates, blue mussels (Mytilus edulis) and to a lesser extent bay scallops (Argopecten irradians), used eelgrass as 'nursery habitat.' Calculations showed that macroinvertebrate production is proportionally much greater than the amount of primary production attributable to eelgrass in the Nauset Marsh system, and that dramatic changes at all trophic levels could be expected if large changes in seagrass abundance should occur. This work further underscores the extraordinarily large impact that seagrass can have on both the structure and function of estuarine ecosystems.

  7. Dicty_cDB: Contig-U02008-1 [Dicty_cDB

    Full Text Available .9 1 ( FE778676 ) CCAG10325.b3 CCAG Petrolisthes cinctipes heart, g... 46 1.9 1 (...5C24 in l... 38 1.4 4 ( BV469818 ) G591P608585RB1.T0 Clint Pan troglodytes verus STS... 34 1.4 3 ( BX601643 ) Zebra...665 ) tigr-gss-dog-17000329822776 Dog Library Canis lup... 46 1.9 1 ( CU068638 ) AGENAE Rainbow trout multi-tissues libra...J255870 ) Mus musculus adult male brain cDNA, RIKEN full-le... 38 7.8 2 ( AC193012 ) Pan troglodytes BAC clone CH251-424B9 from chro...mosome 2 map 3323568... 34 8.3 6 ( AC184611 ) Strongylocentrotus purpuratus clone R3-3085G2, WO...

  8. Dicty_cDB: Contig-U10609-1 [Dicty_cDB

    Full Text Available :none) Boltenia villosa transmembrane rec... 86 7e-16 AE014188_55( AE014188 |pid:none) Plasmodium falci...1803 ) CV01005A2B04.f1 CV01-normalized library Manihot e... 46 1.4 1 ( BW801716 ) Branchiostoma floridae...nchiostoma floridae un... 56 0.001 1 ( AC180603 ) Strongylocentrotus purpuratus clone R3-3092N08,...er of clones 1 Number of EST 1 Link to clone list U10609 List of clone(s) est1= VFI267F ,1,564 Translated Amino Acid... 38 0.25 2 ( CD323116 ) StrPu537.001478 Sea urchin embryo 20hr blastula s... 38 0.26 2 ( CX678736 ) ydc31g02

  9. Dicty_cDB: Contig-U13932-1 [Dicty_cDB

    Full Text Available 08K3, WO... 38 4.0 3 ( AC178133 ) Strongylocentrotus purpuratus clone R3-3078F18, W... 34 4.0 6 ( AC189628 ) Brassica rapa subsp. pe...ngth = 679 Score = 1304 bits (658), Expect = 0.0 Identities = 672/679 (98%) Stran...h = 1740 Score = 38.2 bits (19), Expect = 0.012 Identities = 19/19 (100%) Strand = Plus / Plus Query: 223 ag...dv17h06, 3' end, single read. Length = 679 Score = 1158 bits (584), Expect(2) = 0.0 Identities = 584/584 (100%) Stra...c... 83 9e-15 CP000703_88( CP000703 |pid:none) Staphylococcus aureus subsp. aure... 83 9e-15 CP000316_3878(

  10. Dicty_cDB: Contig-U03858-1 [Dicty_cDB

    Full Text Available 0.003 (Q9FVX0) RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-spe... 45 0.004 CR940348_224( CR940348 |pid:none) Theileri....5 3 ( EU004203 ) Saccharomyces cerevisiae YJM789 mitochondrion, co... 34 1.6 7 ( AC201298 ) Strongylocentrotus purpuratus clone... Leishmania major strain Friedlin... 72 2e-11 AP007171_790( AP007171 |pid:none) Aspergillus oryzae RIB40 gen...... 45 0.005 EU692911_1( EU692911 |pid:none) Caenorhabditis brenneri clone 2A12.....44 FM992690_258( FM992690 |pid:none) Candida dubliniensis CD36 chromo... 42 0.044 ( P36630 ) RecName: Full=G2/mitotic-spe

  11. Dicty_cDB: Contig-U01577-1 [Dicty_cDB

    Full Text Available num E3 str. Alaska E43, complet... 36 0.27 18 ( CT573329 ) Zebrafish DNA sequence **...2 4.8 2 ( AC116924 ) Dictyostelium discoideum chromosome 2 map 6357117... 32 4.9 9 ( BX088595 ) Zebrafish DN.... 36 6.9 2 ( EJ270540 ) 1095353009890 Global-Ocean-Sampling_GS-27-01-01-1... 40 7.0 2 ( AL929239 ) Zebrafish...77376. 34 7.5 5 ( AC178390 ) Strongylocentrotus purpuratus clone R3-3107O18, W... 40 7.5 5 ( CP001247 ) Borrelia afzelii ACA-1 plas...num A3 str. Loch Maree, complet... 36 9.6 17 ( CR753902 ) Zebrafish DNA sequence from clone CH2

  12. Dicty_cDB: Contig-U15734-1 [Dicty_cDB

    Full Text Available equence, co... 40 1.7 6 ( AL731764 ) Mouse DNA sequence from clone RP23-75F12 on chrom... 42 1.7 10 ( EU746611 ) Nasonia girault...e) Schistosoma japonicum SJCHGC04034 ... 37 1.6 AY084712_1( AY084712 |pid:none) Arabidopsis thaliana clon...e) Zea mays clone 446343 prenyltransf... 33 2.2 BT053405_1( BT053405 |pid:none) Medicago truncatula clon...34 0.005 14 ( AC007891 ) Drosophila melanogaster, chromosome 3R, region 91... 44 0.005 5 ( BA000021 ) Wigglesworthia glossinid...... 38 0.66 11 ( AC175911 ) Strongylocentrotus purpuratus clone R3-12O6, WORK... 36 0.67 10 ( CP000685 ) Flavobacterium johnsoni

  13. Dicty_cDB: Contig-U11959-1 [Dicty_cDB

    Full Text Available U11959-1Q.Seq.d (1360 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant al...ig-U11959-1Q) /CSM_Contig/Contig-U11959-1Q.Seq.d (1360 letters) Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letter...000638_4( CP000638 |pid:none) Agrobacterium vitis S4 plasmid pAt... 49 6e-04 AX771881_1( AX771881 |pid:none) Sequence 93 from Patent...lone R3-4011I10, W... 52 0.056 1 ( AC176333 ) Strongylocentrotus purpuratus clone R3-3053K7, WO... 52 0.056 1 ( AC116984 ) Dictyoste...2.2 4 ( ER399326 ) 1095349040644 Global-Ocean-Sampling_GS-34-01-01-1... 36 2.4 2 ( AC184243 ) Strongylocentr

  14. Dicty_cDB: Contig-U15851-1 [Dicty_cDB

    Full Text Available DNA ... 36 4.5 2 ( EG686832 ) RCRB692TO Castor bean cDNA library from roots, 1.... 36 4.5 2 ( EG670343 ) RCRCH76TO Castor be...an cDNA library from roots, 1.... 36 4.5 2 ( EE256738 ) RFAAD56TH Castor bean cDNA library fro... Vitis v... 48 1.8 1 ( CU759384 ) A BAC library has been constructed from PN40024 g... 48 1.8 1 ( CG915134 )...5 1 ( FC850896 ) CBHN6554.rev CBHN Metridium senile tentacle Metri... 50 0.45 1 ( AC116977 ) Dictyostelium discoideum chro...se DhkG (d... 36 7.2 5 ( AC177109 ) Strongylocentrotus purpuratus clone R3-4014B6

  15. Animal mitochondrial DNA polymorphism:a valuable tool for evolutionary studies

    ZHANGYAPING; HONGLAN; 等

    1993-01-01

    Since the mitochondrial DNA(mtDNA) was discovered[1],a great amount of information have been accumulated about its sturcutres and functions[2],The complete nucleotide sequence of the mitochondrial genome has been determined for one individual in each of the following species:mouse(Mus musculus)[3],human(HOmo sapiens)[4],cow(Bos taurus)[5],Xenopus laevis[6],fruit fly(Drosophila yacuba)[7],sea urchin (Strongylocentrotus purpuratus)[8].rat(rattus novegicus)[9],fin whale(Balaenoptera physalus)[10],and harbor seal(Phoca vitulina)[11],More than 300 species of animals have been studied on mtDNA3.In the past 10 years.mtDNA has been a useful and powerful tool in the field of evolutionary biology and taxonomy.

  16. Dicty_cDB: Contig-U01659-1 [Dicty_cDB

    Full Text Available 5 5 ( AC178341 ) Strongylocentrotus purpuratus clone R3-3105C09, W... 34 0.58 6 ( CT573185 ) Zebrafish DNA seq....70 9 ( CU856289 ) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 0.71 5 ( AC116330 ) Dictyostelium dis...whol... 38 0.76 2 ( AL845419 ) Zebrafish DNA sequence from clone CH211-198O19 in...... 36 0.77 6 ( DE907714 ) Macropus eugenii DNA, BAC clone: MEB1-090A16_F, 5... 44 0.82 2 ( BX510307 ) Zebrafish DNA seq...s aculeatus c... 46 1.6 1 ( EU746612 ) Nasonia longicornis strain IV7 NADH dehydrogenase... 32 1.8 4 ( CU466265 ) Zebrafish DNA seq

  17. Dicty_cDB: Contig-U04682-1 [Dicty_cDB

    Full Text Available 35423 ) BE1093_H18_R IASMA L1 HindIII BAC library Vitis v... 44 5.2 1 ( AJ553508 ) Arabidopsis thaliana T-DNA flanking seq...centrotus purpuratus clone R3-3080O09, W... 34 2.6 7 ( BX323995 ) Zebrafish DNA sequence from clone RP71-86K...19 in l... 32 2.6 2 ( CR936835 ) Zebrafish DNA sequence *** SEQUENCING IN PROGRES...S... 32 2.6 2 ( CR382398 ) Plasmodium falciparum chromosome 6, complete sequ... 32 3.1 8 ( AL928870 ) Zebrafish DNA seq...1105A22, W... 34 4.0 5 ( CU074418 ) Zebrafish DNA sequence from clone CH73-20D8 i

  18. Dicty_cDB: Contig-U13647-1 [Dicty_cDB

    Full Text Available 986361 ) 206046 Tomato MboI BAC Library Solanum lycopersic... 44 6.6 1 ( CZ516602 ) GMW2-36N21a.b2 GMW2 Glycine...7,... 47 5e-04 CU466930_1697( CU466930 |pid:none) Candidatus Cloacamonas acidamin... 45 0.002 CP001037_287( CP001037 |pid:none...s hypothetica... 42 0.016 CP001322_1830( CP001322 |pid:none) Desulfatibacillum alkenivorans...) Pseudoalteromonas atlantica T6c... 39 0.18 CP000473_7482( CP000473 |pid:none) Solibacter usitatu...) Strongylocentrotus purpuratus alph... 33 7.5 CP000503_2692( CP000503 |pid:none) Shewanella sp. W3-18-1, compl

  19. Dicty_cDB: Contig-U11282-1 [Dicty_cDB

    Full Text Available ongylocentrotus purpuratus clone R3-3090I4, WO... 56 0.004 1 ( EL737564 ) Osmo01699 F. cylindrus osmotic str... contig VV78X003108.... 246 3e-69 AC166146_12( AC166146 |pid:none) Medicago trunc...0( CR954207 |pid:none) Ostreococcus tauri strain OTTH05... 194 7e-48 AC137986_3( AC137986 |pid:none) Medicago trun...617_5( AC144617 |pid:none) Medicago truncatula clone mth2-7m9... 46 2e-06 AM270400_14( AM270400 |pid:none) A...NA,... 55 8e-06 AY093112_1( AY093112 |pid:none) Arabidopsis thaliana unknown prot

  20. Dicty_cDB: Contig-U05345-1 [Dicty_cDB

    Full Text Available .073 (Q4V8I7) RecName: Full=Leucine-rich repeat-containing protein 8A... 41 0.073 CP001574_677( CP001574 |pid:none) Micromon...ngylocentrotus purpuratus clone R3-44M22, WOR... 50 0.17 1 ( CP000552 ) Prochlorococcus marinus str... ) rf50d06.y2 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 42 5.3 2 ( AM177607 ) Lycopersicon esculentum mRNA for putr...e) Magnetococcus sp. MC-1, complete... 36 0.066 CP001325_782( CP001325 |pid:none) Micromonas sp. RCC299 chro...=Leucine-rich repeat-containing protein 1;... 36 2.4 AJ276703_1( AJ276703 |pid:none) Aspergillus fumi

  1. Dicty_cDB: SHK255 [Dicty_cDB

    Full Text Available PQDDNNNESNEQIES NEDIENKDEDVENKDEDVENKDEDEEDQIEN*iykkf*ikikikk**kkyyffnfk Translated Amino Acid sequence (All Frames) Frame...e RPCI-23-89E14, genomic survey sequence. 36 0.004 3 CN775673 |CN775673.1 tae84a06.y1 Hydra EST Darmstadt I ...us purpuratus genomic clone Plate=1011 Col=7 Row=B, DNA sequence. 42 0.013 3 CN776161 |CN776161.1 tae78a10.y1 Hydra EST Darm.... 40 0.020 8 CN624142 |CN624142.1 tae59h05.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA seq...uence. 40 0.023 2 CN628860 |CN628860.1 tae96h10.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA

  2. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 μm diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs

  3. Dicty_cDB: Contig-U06578-1 [Dicty_cDB

    Full Text Available ( AC180017 ) Strongylocentrotus purpuratus clone R3-23H22, WOR... 46 0.21 1 ( EK579666 ) 1095521409324 Global-Ocean... clone R3-14K15, WOR... 36 0.90 3 ( EU643477 ) Adineta vaga clone Av_TEL_K_A retrotransposons Ju...guiculata geno... 42 3.3 1 ( EI881265 ) CAH1-65F19TR CAA1Ba Cicer arietinum genomic clone... 42 3.3 1 ( EI602591 ) Wang-VSVGgfp-Jur...th 106 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point 5390881 End point 5390775 Strand ...(PLUS/MINUS) MINUS Number of clones 1 Number of EST 1 Link to clone list U06578 List of clone(s) est1= VSD639F ,1,107 Tran

  4. Dicty_cDB: Contig-U15188-1 [Dicty_cDB

    Full Text Available Name: Full=Protein-L-isoaspartate O-methyltransferas... 57 3e-15 CP001322_810( CP001322 |pid:none) Desulfatibacillum al...9 4e-12 CP001600_3131( CP001600 |pid:none) Edwardsiella ictaluri 93-146, c... 50 4e-12 (A9N1H6) RecName: Full=Protein-L-isoasparta...6899 ) Strongylocentrotus purpuratus clone R3-1104P9, WO... 34 3.3 5 ( U31288 ) Arabidopsis thaliana L-isoaspart... 98 5e-38 AY496702_1( AY496702 |pid:none) Arabidopsis thaliana L-isoaspartyl... 93 2e-37 AY496702_2( AY49670...2 |pid:none) Arabidopsis thaliana L-isoaspartyl... 93 2e-37 AY496702_3( AY496702

  5. Dicty_cDB: Contig-U16221-1 [Dicty_cDB

    Full Text Available abase: 8402 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matri... ) AGENCOURT_56977043 D. grimshawi EST Drosophila gr... 32 7.3 3 ( EC384843 ) PMAH-aab09g10.g1 Lamprey_EST_Olfactory Petr... AGENCOURT_57320741 D. grimshawi EST Drosophila gr... 32 9.9 3 ( AC181324 ) Strongylocentrotus purpuratus cl...tccag 474 Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number o... ++ + G Sbjct: 969 RKAGKTG 975 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLO

  6. Dicty_cDB: Contig-U05215-1 [Dicty_cDB

    Full Text Available -05 AM884748_1( AM884748 |pid:none) Homo sapiens SRY gene for sex dete... 49 8e-05 AY235423_1( AY235423 |pid:none) Trachemy...17180 |pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05 AY172026_1( AY172026 |pid:none) Branchiostoma belche...ing tran... 49 8e-05 AY578709_1( AY578709 |pid:none) Branchiostoma belcheri tsing...parum 3D7 asexua... 46 1.4 1 ( CJ186583 ) Mus musculus 14.5 days embryo Rathke's pouches cD... 38 4.7 2 ( AL...hus sex-determin... 52 7e-06 EF062529_1( EF062529 |pid:none) Odocoileus hemionus

  7. Meisetz and the birth of the KRAB motif.

    Birtle, Zoë; Ponting, Chris P

    2006-12-01

    The largest family of transcription factors in mammals is of Cys(2)His(2) zinc finger-proteins, each with an NH(2)-terminal KRAB motif. Extensive expansions of this family have occurred in separate mammalian lineages, with approximately 400 such genes known in the human genome. Despite their widespread occurrence, the evolutionary provenance of the KRAB motif is unclear since previously it has not been found outside of the tetrapod vertebrates. Here, we show that homologues of the histone methyltransferase Meisetz are present within the sea urchin (Strongylocentrotus purpuratus) genome. Sea urchin and mammalian Meisetz sequences each contain an N-terminal KRAB motif, which thereby establishes an early origin of the KRAB motif prior to the divergence of echinoderm and chordate lineages. Finally, we present evidence that KRAB motifs derive from a novel family of KRI (KRAB Interior) motifs that were present in the last common ancestor of animals, plants and fungi. PMID:17032681

  8. Dicty_cDB: Contig-U13707-1 [Dicty_cDB

    Full Text Available brachys jingzhao cystine knot toxin (JZTX-49... 32 0.97 2 ( AC214212 ) Populus trichocarpa clon...ING DRAFT SEQU... 32 2.6 2 ( AC207216 ) Pongo abelii BAC clone CH276-180A1 from chromosom... 32 2.6 2 ( AE014841 ) Plasmodium fal..... 44 5.4 1 ( AC005623 ) Arabidopsis thaliana chromosome 2 clone T20P8 map... 44 5.4 1 ( AE014296 ) Drosophi...m... 42 0.015 CP000323_2122( CP000323 |pid:none) Psychrobacter cryohalolentis K5... 41 0.020 B86613( B86613 ) zinc metallo...tig VV78X101109.2, whole genome... 32 0.25 4 ( AC181049 ) Strongylocentrotus purpuratus clone R3-3050K15, W.

  9. AcEST: BP919022 [AcEST

    Full Text Available amydia pneum... 33 1.3 sp|P11761|SAPR_STRPU Sperm-activating peptides OS=Strongylocentr... 32 2.2 sp|Q255A6|...DEFGIAITLNADREGLGYQE 70 >sp|P11761|SAPR_STRPU Sperm-activating peptides OS=Strongylocentrotus purpuratus PE=...amily OS... 34 6.4 tr|Q25121|Q25121_HEMPU Sperm-activating peptide I OS=Hemicentrot... 34 6.4 tr|B3KZU2|B3KZ...GGALVLAGGTGLGKTALLDTARR 61 Query: 252 DGIGFQQRGF 223 D GF RGF Sbjct: 62 DVAGFDVRGF 71 >tr|Q25121|Q25121_HEMPU Sperm-activating pe...e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma

  10. Dicty_cDB: Contig-U12755-1 [Dicty_cDB

    Full Text Available ... 48 0.63 1 ( AC181857 ) Strongylocentrotus purpuratus clone R3-1020G24, W... 48 0.63 1 ( AU074405 ) Dictyostelium discoi...CR382135 |pid:none) Debaryomyces hansenii strain CBS... 57 1e-06 CP000496_423( CP000496 |pid:none) Pichia stipitis CBS 6054 chro...e-06 CU928166_118( CU928166 |pid:none) Kluyveromyces thermotolerans str... 56 2e-06 CR382126_555( CR382126 |pid:none) Kluyveromyces...130_396( CR382130 |pid:none) Yarrowia lipolytica strain CLIB1... 52 2e-05 CR382122_550( CR382122 |pid:none) Kluyveromyces lactis str...|pid:none) S.cerevisiae GTP-binding protein (VPS1... 51 7e-05 CU928174_56( CU928174 |pid:none) Zygosaccharomyces rouxii str

  11. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Sadhna Phanse

    2016-03-01

    Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1].

  12. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes.

    Phanse, Sadhna; Wan, Cuihong; Borgeson, Blake; Tu, Fan; Drew, Kevin; Clark, Greg; Xiong, Xuejian; Kagan, Olga; Kwan, Julian; Bezginov, Alexandr; Chessman, Kyle; Pal, Swati; Cromar, Graham; Papoulas, Ophelia; Ni, Zuyao; Boutz, Daniel R; Stoilova, Snejana; Havugimana, Pierre C; Guo, Xinghua; Malty, Ramy H; Sarov, Mihail; Greenblatt, Jack; Babu, Mohan; Derry, W Brent; Tillier, Elisabeth R; Wallingford, John B; Parkinson, John; Marcotte, Edward M; Emili, Andrew

    2016-03-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae) and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328), PPIs via BioGRID (185267); and interaction network projections via (http://metazoa.med.utoronto.ca) made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. PMID:26870755

  13. Dicty_cDB: Contig-U10060-1 [Dicty_cDB

    Full Text Available DRAFT SEQU... 38 1.8 8 ( EC241466 ) 72899 CK01 Drosophila melanogaster cDNA clone CK0... 38 1.8 2 ( CO286841 ) EK0640...2 ( CQ807072 ) Sequence 522 from Patent WO2004035803. 42 0.23 2 ( AX826010 ) Sequence 262 from Patent WO03072821....TJ CHORI103 Schistosoma mansoni gen... 34 0.69 3 ( AC168359 ) Strongylocentrotus purpuratus clone R3-4013O21...3 EF214995_1( EF214995 |pid:none) Callithrix jacchus clone G19-50.1_... 46 0.003 AL645941_14...main-containing protein 9; &BC049... 45 0.006 EF210363_7( EF210363 |pid:none) Salmo salar clone CH214-714P22 MHC... 45 0.00

  14. Dicty_cDB: Contig-U04535-1 [Dicty_cDB

    Full Text Available Group genomic DNA, chromoso... 36 6.5 5 ( AC220300 ) Bos taurus clone CH240-369A22, WORKING DRAFT SEQU... 36 7.1 2 ( CO217017 ) WS00...lone BACR06H06, complete... 40 5.5 4 ( DX924979 ) Bst5kb000721 bstricta5kb Boechera stricta genomic... 30 5....822 ) Plasmodium falciparum 3D7 chromosome 14 section 7... 34 0.058 7 ( AC177200 ) Strongylocentrotus purpuratus clone R3-40...NG IN PROGRESS *** f... 44 1.5 2 ( CU424463 ) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 1.5 4 ( CR382400...telium discoideum cDNA clone:dda53i02, 3' ... 38 2.4 2 ( AC218614 ) Bos taurus clone CH240-299E4, WORKING DR

  15. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Full Text Available 333882848 Dog Library Canis lup... 38 6.5 2 ( CO216067 ) WS0043.B21_N04 SS-R-A-5 Picea sitchensis cDNA clo... 40...2 Contig-U11407-1 (Contig-U11407-1Q) /CSM_Contig/Conti... 40 0.002 Contig-U11391-1 (Conti...595 ) Bos taurus clone CH240-391C9, WORKING DRAFT SEQUE... 46 1.4 1 ( AC221214 ) Bos taurus clone CH240...ylocentrotus purpuratus clone R3-3003C12, W... 40 2.6 5 ( AC114099 ) Rattus norvegicus clone CH230-66A14..., clone: LjT12M13, TM0... 40 3.4 2 ( BU910062 ) AGENCOURT_10487025 NICHD_XGC_Emb1 Xenopus laevis ... 32 3.5 2 ( DE948014

  16. Dicty_cDB: Contig-U04881-1 [Dicty_cDB

    Full Text Available AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 47 3e-04 AB005140_1( AB005140 |pid:none) Mus musculus li...ent WO0171042. 36 2.8 2 ( AC184568 ) Strongylocentrotus purpuratus clone R3-3106J12, W... 38 3.0 3 ( ER424660 ) 1092963741121 Globa...680059 ) ENTIA95TF Entamoeba histolytica Sheared DNA Entam... 32 3.3 2 ( EJ379203 ) 1092963755348 Global-Ocean-Sampli.... 40 1.8 5 ( EK125743 ) 1092978801507 Global-Ocean-Sampling_GS-31-01-01-1... 32 1...ana tabacum ge... 40 1.9 2 ( EK158830 ) 1095458016335 Global-Ocean-Sampling_GS-31-01-01-

  17. Dicty_cDB: Contig-U12053-1 [Dicty_cDB

    Full Text Available e) 43 0.030 AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 43 0.030 AB209531_1( AB209531 |pid:non... 48 0.88 1 ( AC177181 ) Strongylocentrotus purpuratus clone R3-4018C22, W... 48 0.88 1 ( ER286475 ) 1092343573088 Global...e CH251-682B11, ... 38 0.79 6 ( ER415983 ) 1092452150498 Global-Ocean-Sampling_GS-35-01-01-1... 3...us Phytoplasma mali strain AT complete ch... 36 0.72 17 ( AC192970 ) Pan troglodytes chromosome X clon...vegicus protein tyrosine... 91 1e-16 AB183035_1( AB183035 |pid:none) Ciona intestinalis Ci-VSP mRNA for... 8

  18. Dicty_cDB: Contig-U15684-1 [Dicty_cDB

    Full Text Available s for pharmacological ... 46 4.0 1 ( BD299093 ) Cloning, expression and characterization.... 38 4.5 3 ( AC177271 ) Strongylocentrotus purpuratus clone R3-43O10, WOR... 38 4.5 4 ( EJ509602 ) 1095407058338 Global-Ocean-Sampli... 44 1.4 2 ( BJ367367 ) Dictyostelium discoideum cDNA clone:ddc42o07, 5' ... 32 1.4 3 ( ER589928 ) 1093016193049 Global-Ocean-Sampli...472065 ) AYARK48TF pooled cDNA populations Arabidopsis tha... 34 10.0 2 >( BJ403383 ) Dictyostelium discoideum cDNA clon...avy chain kinas... 38 9.9 3 ( EK406030 ) 1095505002857 Global-Ocean-Sampling_GS-31-01-01-1... 34 10.0 2 ( EG

  19. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    Klein, S.B.

    1985-12-01

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 ..mu..m diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs.

  20. Dicty_cDB: Contig-U06368-1 [Dicty_cDB

    Full Text Available omi... 50 7e-05 AE2149( AE2149 ) hypothetical protein all2748 [imported] - Nostoc ... 50 7e-05 ( P16157 ) RecNam...RIKEN full-length enric... 40 0.003 2 ( EJ378046 ) 1092963750492 Global-Ocean-Sampling_GS-28-01-01-1... 40 0...( EJ834521 ) 1093017609386 Global-Ocean-Sampling_GS-30-02-01-1... 36 1.1 2 ( EJ870952 ) 1093018347150 Global-Ocean-Samp...ling_GS-30-02-01-1... 36 1.1 2 ( EK149681 ) 1095456042258 Global-Ocean-Sampling_GS-31-01-01-1... ...RE... 34 3.0 6 ( AC177682 ) Strongylocentrotus purpuratus clone R3-1017C9, WO... 34 3.0 2 ( EJ581400 ) 10929

  1. Dicty_cDB: Contig-U00294-1 [Dicty_cDB

    Full Text Available trongylocentrotus purpuratus clone R3-18G21, WOR... 46 3.5 1 ( ET096753 ) QM0AAA24CF02FM1 CCL1 Citrus clemen...eductase [NADH]; Short=... 139 1e-55 L11563_1( L11563 |pid:none) Petunia hybrida nitrate reductase apoe... 1...str. 7 DNA,... 55 4e-06 AL111168_5( AL111168 |pid:none) Campylobacter jejuni subsp. jejuni... 55 4e-06 CP000474_1511... Vitis vinifera contig VV78X087113.5, whole genome... 32 8.1 2 ( AC217677 ) Populus trichocarpa clone Pop1-97L1...00875_2850( CP000875 |pid:none) Herpetosiphon aurantiacus ATCC ... 119 4e-46 ( P2

  2. Dicty_cDB: Contig-U03670-1 [Dicty_cDB

    Full Text Available ) Strongylocentrotus purpuratus clone R3-3059I07, W... 50 0.049 1 ( ET089327 ) QM0AAA13DD03FM1 CCL1 Citrus c...99 ) Mus musculus BAC RP23-145M15 (Roswell Park Cance... 50 0.049 1 ( AC147260 ) Mus musculus BAC clone RP24-186L11...24-251O18 from chromosom... 48 0.19 1 ( AC141474 ) Mus musculus BAC clone RP24-192L11... 0.19 1 ( AC139062 ) Mus musculus chromosome 17, clone RP23-69L11, com... 48 0.19 1 ( AC138718 ) Mus musculu...6523 ) Mus musculus chromosome 9, clone RP24-349L11, com... 48 0.19 1 ( AC116482 ) Mus musculus chromoso

  3. Dicty_cDB: Contig-U15975-1 [Dicty_cDB

    Full Text Available iywiyv*ymytvyyilyilyiq ylci*iymnikynvyslilfillllllvisiykggrveivvfllfffflffif--- ---in**ticsif*rfqngl*ftnfkdfktr.... 46 2.9 1 ( AC177336 ) Strongylocentrotus purpuratus clone R3-46L23, WOR... 36 3.4 5 ( AC229836 ) Monodelphis domestica clon...tein ligase Itchy homolog... 91 1e-16 AP005590_16( AP005590 |pid:none) Oryza sativa Japonica Group ge...e) Aspergillus oryzae RIB40 genomic... 74 9e-12 AP004187_7( AP004187 |pid:none) Oryza sativa Japonica Gro...Y810307_1( AY810307 |pid:none) Schistosoma japonicum SJCHGC03644 ... 67 2e-09 BC172391_1( BC172391 |pid:none) Synthetic constr

  4. Dicty_cDB: Contig-U12694-1 [Dicty_cDB

    Full Text Available 6 CP000777_2353( CP000777 |pid:none) Leptospira biflexa serovar Pato... 176 1e-42 AP009493_6570( AP009493 |pid:none) Str...e) Oryza sativa Japonica Group cDNA c... 200 6e-50 EU200974_1( EU200974 |pid:none) Triticum aestivum neutr...00804_3748( CP000804 |pid:none) Roseiflexus castenholzii DSM 13... 34 6.9 CP000141_1555( CP000141 |pid:none) Carboxydothermus hydro...283 Number of successful extensions: 1811 Number of sequences better than 10.0: 562 length of query: 843 len...e CH240-195P7, WORKING DRAFT SEQUE... 44 8.4 1 ( AC168419 ) Strongylocentrotus purpuratus clone R3-

  5. Dicty_cDB: Contig-U16390-1 [Dicty_cDB

    Full Text Available 38 1.8 CP001034_767( CP001034 |pid:none) Natranaerobius thermophilus JW/N... 38 2.3 CP000686_2932( CP000686 |pid:none) Roseiflex... 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 40.0 %: extracellular, including cell wall 16.0 %: cytoplasmic 12.0 %: mitochon...te s... 46 7.1 1 ( AP008207 ) Oryza sativa (japonica cultivar-group) genomic DN... 46 7.1 1 ( AP0...s: 59344 Number of successful extensions: 6416 Number of sequences better than 10.0: 198 length of query: 2794 le...e:ddv43d20, 3' ... 198 8e-46 1 ( AC176379 ) Strongylocentrotus purpuratus clon

  6. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    Maurice R Elphick

    2015-02-01

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea, the sea cucumber Apostichopus japonicus (Holothuroidea and the starfish Patiria miniata (Asteroidea reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea and the feather star Antedon mediterranea (Crinoidea. We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea and Asterozoa (Asteroidea + Ophiuroidea in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids, which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialised to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the cocktails of SALMFamides that exist in echinoderms.

  7. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights.

    Elphick, Maurice R; Semmens, Dean C; Blowes, Liisa M; Levine, Judith; Lowe, Christopher J; Arnone, Maria I; Clark, Melody S

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here, we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea) and the feather star Antedon mediterranea (Crinoidea). We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus, and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif, and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea) and Asterozoa (Asteroidea + Ophiuroidea) in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids), which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialized to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the "cocktails" of SALMFamides that exist in echinoderms. PMID:25699014

  8. Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration

    Lane, M.C.

    1989-01-01

    Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous {beta}-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in {sup 35}SO{sub 4}-labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed.

  9. Dynamic evolution of toll-like receptor multigene families in echinoderms.

    Buckley, Katherine M; Rast, Jonathan P

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a 10-fold expansion relative to vertebrates. Given their stereotypic protein structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. A role for these receptors in immune defense is suggested by their similarity to TLRs in other organisms, sequence diversity, and expression in immunologically active tissues, including phagocytes. The complexity of the sea urchin TLR multigene families is largely derived from expansions independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll can be traced to an ancient eumetazoan ancestor. Several other echinoderm sequences are now available, including Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the mccTLR sequences are found in L. variegatus, although the L. variegatus TLR gene family is notably smaller (68 TLR sequences). The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel immune recognition functions and other, more stable, subfamilies that may

  10. Dynamic evolution of toll-like receptor multigene families in echinoderms

    Katherine M Buckley

    2012-06-01

    Full Text Available The genome of the purple sea urchin, Strongylocentrotus purpuratus, was the first to be sequenced from a long-lived large invertebrate. Analysis of this genome uncovered a surprisingly complex immune system in which the moderately sized sets of pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR genes, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a ten-fold expansion relative to vertebrates. Given their stereotypic structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. An immune defense role for these receptors is suggested by their sequence diversity and expression in immunologically active tissues, including phagocytes. This complexity of the sea urchin TLR multigene families largely derives from expansions that are independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll likely originated in an ancient eumetazoan ancestor. Several other invertebrate deuterostome genomes have been sequenced, including the cephalochordate, Branchiostoma floridae and the sea urchin Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the protostome-like sequences are found in L. variegatus. The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel functions and other, more stable, subfamilies that may function similarly to those of vertebrates.

  11. Substituting mouse transcription factor Pou4f2 with a sea urchin orthologue restores retinal ganglion cell development

    Mocko-Strand, Julie A.; Wang, Jing; Ullrich-Lüter, Esther; Pan, Ping; Wang, Steven W.; Arnone, Maria Ina; Frishman, Laura J.; Klein, William H.

    2016-01-01

    Pou domain transcription factor Pou4f2 is essential for the development of retinal ganglion cells (RGCs) in the vertebrate retina. A distant orthologue of Pou4f2 exists in the genome of the sea urchin (class Echinoidea) Strongylocentrotus purpuratus (SpPou4f1/2), yet the photosensory structure of sea urchins is strikingly different from that of the mammalian retina. Sea urchins have no obvious eyes, but have photoreceptors clustered around their tube feet disc. The mechanisms that are associated with the development and function of photoreception in sea urchins are largely unexplored. As an initial approach to better understand the sea urchin photosensory structure and relate it to the mammalian retina, we asked whether SpPou4f1/2 could support RGC development in the absence of Pou4f2. To answer this question, we replaced genomic Pou4f2 with an SpPou4f1/2 cDNA. In Pou4f2-null mice, retinas expressing SpPou4f1/2 were outwardly identical to those of wild-type mice. SpPou4f1/2 retinas exhibited dark-adapted electroretinogram scotopic threshold responses, indicating functionally active RGCs. During retinal development, SpPou4f1/2 activated RGC-specific genes and in S. purpuratus, SpPou4f2 was expressed in photoreceptor cells of tube feet in a pattern distinct from Opsin4 and Pax6. Our results suggest that SpPou4f1/2 and Pou4f2 share conserved components of a gene network for photosensory development and they maintain their conserved intrinsic functions despite vast morphological differences in mouse and sea urchin photosensory structures. PMID:26962139

  12. Molecular cloning of hsf1 and hsbp1 cDNAs, and the expression of hsf1, hsbp1 and hsp70 under heat stress in the sea cucumber Apostichopus japonicus.

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Yang, Hongsheng

    2016-08-01

    The heat shock response (HSR) is known for the elevated synthesis of heat shock proteins (HSPs) under heat stress, which is mediated primarily by heat shock factor 1 (HSF1). Heat shock factor binding protein 1 (HSBP1) and feedback control of heat shock protein 70 (HSP70) are major regulators of the activity of HSF1. We obtained full-length cDNA of genes hsf1 and hsbp1 in the sea cucumber Apostichopus japonicus, which are the second available for echinoderm (after Strongylocentrotus purpuratus), and the first available for holothurian. The full-length cDNA of hsf1 was 2208bp, containing a 1326bp open reading frame encoding 441 amino acids. The full-length cDNA of hsbp1 was 2850bp, containing a 225bp open reading frame encoding 74 amino acids. The similarities of A. japonicus HSF1 with other species are low, and much higher similarity identities of A. japonicus HSBP1 were shared. Phylogenetic trees showed that A. japonicus HSF1 and HSBP1 were clustered with sequences from S. purpuratus, and fell into distinct clades with sequences from mollusca, arthropoda and vertebrata. Analysis by real-time PCR showed hsf1 and hsbp1 mRNA was expressed constitutively in all tissues examined. The expression of hsf1, hsbp1 and hsp70 in the intestine at 26°C was time-dependent. The results of this study might provide new insights into the regulation of heat shock response in this species. PMID:26952354

  13. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    Elphick, Maurice R.; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here, we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea) and the feather star Antedon mediterranea (Crinoidea). We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus, and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif, and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea) and Asterozoa (Asteroidea + Ophiuroidea) in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids), which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialized to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the “cocktails” of SALMFamides that exist in echinoderms. PMID:25699014

  14. Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration

    Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous β-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in 35SO4-labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed

  15. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  16. Sedimentación pedemontana en las nacientes delRío Jáchal y Pampa de Gualilán, Precordillera de San Juan Piedmont sedimentation in the headwaters of theRío Jachal and Pampa de Gualilán, Precordillera of San Juan

    Julieta Suriano

    2009-11-01

    Full Text Available Se describen las características sedimentológicas delos depósitos de piedemontes desarrollados en cuencas intramontanas de laPrecordillera. Estudios detallados fueron desarrollados en el curso superiordel río Jáchal y en el área de la pampa de Gualilán, los que permitieronidentificar y caracterizar desde el punto de vista sedimentológico seis tiposprincipales de acumulaciones pedemontanas: 1 taludes, 2 abanicos coluvialesdominados por flujos de gravedad, 3 abanicos coluviales dominados por flujosfluidos, 4 sistema río colector-conoide, 5 piedemontes dominados por flujoscanalizados y 6 abanicos aluviales. Los depósitos de talud se caracterizan porel predominio de brechas clasto-soportadas (con exiguos porcentajes de matriz,frecuentemente macizas, fábrica planar o mostrando imbricación de alto ángulode clastos. En los abanicos coluviales dominados por flujos de gravedad dominanlas brechas matriz-soportadas y macizas y en menor proporción las brechasclasto-soportadas. Por su parte, los depósitos de abanicos coluviales dominadospor flujos fluidos, muestran menor tamaño de grano y están dominados porcanales amalgamados rellenos tanto de brechas clasto como matriz-soportadas, yescasas brechas gradadas. Las acumulaciones desarrolladas por el sistema ríocolector-conoide son las que muestran mayor variabilidad litológica, puesincluyen desde brechas matriz-soportadas macizas hasta conglomerados conestratificación entrecruzada e incluso fangolitas. En lo que respecta a lospiedemontes dominados por flujos canalizados, están formados por brechasclastosoportadas macizas y en menor proporción con clastos imbricados omostrando estructuras entrecruzadas. Los depósitos correspondientes a abanicosaluviales están mayormente compuestos por conglomerados clasto-soportados conestructuras entrecruzadas. En menor proporción y en los sectores proximales seencuentran conglomerados y brechas matriz-soportadas. Si bien la procedencia declastos es

  17. Late Triassic - Early Jurassic successions of the Atuel depocenter: sequence stratigraphy and tectonic controls Sucesiones del Triásico Tardío - Jurásico Temprano del depocentro Atuel: estratigrafía secuencial y controles tectónicos

    Silvia Lanés

    2008-12-01

    Full Text Available Biostratigraphic correlations of the Late Triassic - Early Jurassic successions of the Atuel depocenter allowed determining the accommodation changes and the possible tectonic controls on sedimentation. The Rhaetian - late Early Sinemurian deposits contain facies of slope-type fan deltas, braided fluvial systems and low sinuosity rivers with alternate bars deposited during a synrift phase. The late Early Sinemurian - Toarcian series host facies of intermediate (Gilbert to shelf type fan deltas, braided and low sinuosity fluvial systems, wave-dominated estuaries, transgressive storm-dominated and turbidite-influenced marine shelves which record the sag phase. According to different criteria two stratigraphic schemes are proposed, the first one considering tectosedimentary units (TSU and the second one using "Exxon-like" sequences. In the first scheme the synrift TSU matches the actual Precuyo Mesosequence and the sag TSU is partly equivalent to the Cuyo Mesosequence, mainly keeping the current mesosequence scheme for the Neuquén basin but assigning the fandeltaic deposits to the Precuyo Mesosequence. The second sequence scheme considers the whole Late Triassic - Early Jurassic succession as a part of the Cuyo Mesosequence, where the synrift deposits composes the detached lowstand system tract (LST and most of the sag deposits makes the transgressive system tract (TST. The basal sequence boundary does not crop out, the flooding surface at the TST base and the maximum flooding surface at the TST top are respectively marked by the lowest estuarine levels and by black shales with suboxic-compatible bivalves (Bositra sp..La correlación bioestratigráfica de las sucesiones del Triásico Tardío - Jurásico Temprano del depocentro Atuel permitió determinar los cambios del espacio de acomodación y los posibles controles tectónicos de la sedimentación. La sección del Retiano - Sinemuriano Temprano tardío contiene facies de abanicos deltaicos de

  18. La faja volcánica miocena de la Precordillera septentrional

    C. O. Limarino

    2002-09-01

    Full Text Available En este artículo se considera la espesa secuencia de rocas volcánicas y volcanicláticas de edad Miocena aflorante en el norte de la Precordillera. En trabajos anteriores estas rocas fueron asignadas al Triásico, sin embargo nuevas dataciones radimétricas (17,6 ± 0,5 Ma and 18,3 ± 0,7 Ma señalan una edad miocena para las volcanitas las que quedan comprendidas dentro de la Formación Cerro Morado. En el área analizada las rocas en cuestión descansan discordantemente sobre areniscas eólicas correspondientes a la Formación Vallecito (Mioceno y muestran en el tope una relación tectónica con las lutitas de la Formación Yerba Loca (Ordovícico. Sin embargo, hacia el sur, en el anticlinal de Huaco, la Formación Cerro Morado es cubierta por conglomerados y areniscas miocenas de la Formación Cauquenes (Mioceno Superior ?. Sobre la base de sus características litológicas, la Formación Cerro Morado ha sido dividida en cuatro asociaciones de facies. La asociación I está compuesta por coladas volcánicas y brechas que marcan la fase de máxima actividad volcánica en la región. La asociación II, formada por brechas sedimentarias y escasas coladas, seañala la disminución de la actividad volcánica, caracterizada por algunos flujos piroclásticos junto a depósitos de abanicos aluviales y de talud. La asociación III está dominada por conglomerados y brechas generadas por corrientes fluviales altamente concentradas y flujos de detritos depositados en áreas de abanicos aluviales y sistemas fluviales entrelazados proximales. Finalmente, la asociación IV comprende conglomerados y areniscas depositados principalmente en ríos entrelazados por flujos diluidos. La existencia de volcanitas neógenas en el norte de la Precordillera refuerza la hipótesis de la migración del arco volcánico como consecuencia de la progresiva disminución del ángulo de subducción de la Placa de Nazca durante el Mioceno.

  19. El Ventorrillo, a paleostructure of Popocatépetl volcano: insights from geochronology and geochemistry

    Sosa-Ceballos, G.; Macías, J. L.; García-Tenorio, F.; Layer, P.; Schaaf, P.; Solís-Pichardo, G.; Arce, J. L.

    2015-10-01

    Volcán Popocatépetl (México) was constructed over the remains of a volcanic paleostructure. Based on fieldwork, 40Ar/39Ar dating, U-Pb dating, and geochemistry, we have determined the age, chemistry, and location of this paleostructure and named it El Ventorrillo. Most remnants of El Ventorrillo are covered by deposits from subsequent activity of Popocatépetl, except for the El Abanico scarp and the Barranca de Nexpayantla, where the stratigraphy of El Ventorrillo eruptive products can be investigated. Inception of volcanism at El Ventorrillo occurred at 331 ± 10 ka with emission of the Nexpayantla andesitic lavas, and continued with extrusion of the Yoloxochitl (267 ± 31 ka) and microwave (227 ± 6 ka) domes. Intrusion of dikes occurred at 298 ± 94 and 230 ± 3 ka. Activity at El Ventorrillo continued with the emission of lavas that built the El Abanico scarp (193 ± 29 to 96 ± 8 ka) and continued until the Tutti Frutti eruption destroyed the cone 14.1 kyr ago. El Ventorrillo magmas produced rocks divided into two mineralogical groups. The first group contains biotite-amphibole-rich rocks and the second group consists of biotite-amphibole-free lavas. The rocks that contain biotite and amphibole are older than 198 ± 13 ka, whereas the rocks with no hydrous phases are younger than 227 ± 6 ka and contain skarn and granodiorite xenoliths. We interpret the change to an anhydrous mineral assemblage and the occurrence of skarn and granodiorite xenoliths as evidence for the formation of a new, shallower reservoir. A granodiorite xenolith was chosen for 40Ar/39Ar dating and U-Pb zircon analyses. The U-Pb method yielded an age of 540 ± 110 ka and the 40Ar/39Ar an age of 109 ± 24 ka. These ages are interpreted to indicate granodiorite crystallization (540 ± 110 ka), which metamorphosed the calcareous basement beneath Popocatépetl into skarn and an influx of magma (109 ± 24 ka) that reheated the granodiorite. Major and trace elements, Sr, Nd, and Pb isotopic

  20. La precipitación torrencial del año 2000 en Quebrada Chacarilla y el cálculo de recarga al acuífero Pampa Tamarugal, norte de Chile The year 2000 storm event in the Quebrada Chacarilla and calculation of recharge to the Pampa Tamarugal aquifer

    John Houston

    2001-12-01

    Full Text Available Una importante crecida repentina tuvo lugar en la cuenca de captación de Chacarilla en enero de 2000 como lo demuestran los depósitos de corriente de lodo supra-ribera en disposición regresiva. El caudal máximo se ha determinado en 450 (± 50 m³/s y es posible rastrear su origen hasta un evento de tormenta cuantificable en el Altiplano. Más abajo, la crecida infiltró el abanico aluvial para recargar los acuíferos. Un pozo de monitoreo al pie del abanico mostró un aumento del nivel de agua debido a infiltración de 0,45 m lo que representa un evento de recarga de 25 millones de m³.La tormenta que dio origen a esta recarga tiene un período de retorno de 4 años, de modo que la recarga anual media es equivalente a ~200 l/s. La respuesta de la cuenca de captación se ha establecido como no lineal con retroalimentación positiva, de modo que eventos aún más raros entregan una recarga proporcionalmente mayor. Las disminuciones del nivel de aguas subterráneas a largo plazo pueden deberse en parte a las fluctuaciones climáticas y las causas de dichas fluctuaciones son discutidasA major flash flood took place in the Chacarilla catchment in January 2000 as indicated by offlapping overbank mudflow deposits. The peak flood has been determined at 450 (± 50 m³/s and it is possible to trace the origin of this flood to a quantifiable storm event in the Altiplano. Downstream, the surface water flood infiltrated the alluvial fan to recharge groundwater aquifers. A monitoring well in the fan toe showed a water level rise due to infiltration of 0.45 m that can be translated into a recharge event of 25 million m³. The storm giving rise to this recharge has a return period of 4 years and so mean annual recharge is equivalent to ~200 l/s. The catchment response is shown to be non-linear with positive feedback, so that rarer events provide proportionately greater recharge. Long-term declines in groundwater level may be partly due to climatic

  1. De novo assembly and characterization of two transcriptomes reveal multiple light-mediated functions in the scallop eye (Bivalvia: Pectinidae.

    Autum N Pairett

    Full Text Available BACKGROUND: The eye has evolved across 13 separate lineages of molluscs. Yet, there have been very few studies examining the molecular machinary underlying eye function of this group, which is due, in part, to a lack of genomic resources. The scallop (Bivalvia: Pectinidae represents a compeling molluscan model to study photoreception due to its morphologically novel and separately evolved mirror-type eye. We sequenced the adult eye transcriptome of two scallop species to: 1 identify the phototransduction pathway components; 2 identify any additional light detection functions; and 3 test the hypothesis that molluscs possess genes not found in other animal lineages. RESULTS: A total of 3,039 contigs from the bay scallop, Argopecten irradians and 26,395 contigs from the sea scallop, Placopecten magellanicus were produced by 454 sequencing. Targeted BLAST searches and functional annotation using Gene Ontology (GO terms and KEGG pathways identified transcripts from three light detection systems: two phototransduction pathways and the circadian clock, a previously unrecognized function of the scallop eye. By comparing the scallop transcriptomes to molluscan and non-molluscan genomes, we discovered that a large proportion of the transcripts (7,776 sequences may be specific to the scallop lineage. Nearly one-third of these contain transmembrane protein domains, suggesting these unannotated transcripts may be sensory receptors. CONCLUSIONS: Our data provide the most comprehensive transcriptomic resource currently available from a single molluscan eye type. Candidate genes potentially involved in sensory reception were identified, and are worthy of further investigation. This resource, combined with recent phylogenetic and genomic data, provides a strong foundation for future investigations of the function and evolution of molluscan photosensory systems in this morphologically and taxonomically diverse phylum.

  2. Short- and long-term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    C. J. Gobler

    2013-04-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer-term implications of this sensitivity are unclear. Experiments were performed to assess the short-term (days and long-term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA : DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA : DNA ratios being highly correlated with larval growth rates (r2>0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10-day exposure later in larval development did not, demonstrating the extreme CO2 sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This "legacy effect" emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern-day bivalve populations.

  3. Short and long term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    C. J. Gobler

    2012-11-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer term implications of this sensitivity are unclear. Experiments were performed to assess the short term (days and long term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA:DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA:DNA ratios being highly correlated with larval growth rates r2 > 0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10 day exposure later in larval development did not, demonstrating the extreme CO2-sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This `legacy effect' emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern day bivalve populations.

  4. FAMILIA E HISTORIA SOCIAL. LOS SIGNIFICADOS DE LAS HERENCIAS Y EL FRÁGIL ORDEN DE LAS COSAS.

    Eduardo Cavieres Figueroa

    2011-10-01

    Full Text Available El problema. A propósito de un libro y de sus propuestas En agosto de 1999, me fue muy grato conocer a Giovanni Levi y compartir con él y otros colegas durante poco más de una semana. En el caso particular de Levi, además de un importante intercambio de opiniones sobre diversos temas, le he quedado reconocido —además de por su simpatía y sensibilidades profundas— por la excelente síntesis que ha logrado entre su posesionamiento de perspectivas históricas muy actualizadas y el ser un intelectual de viejo cuño en el mejor sentido de la palabra. Hombre inquieto, de cultura amplia, amante de la naturaleza, humanista de vasta formación. Fueron muchas las ideas que quedaron dando vueltas a propósito de largas y muy amenas conversaciones que se entremezclaron con actividades académicas, recorridos por la hermosa geografía de Costa Rica, paseos entre sus bosques, parques, jardines botánicos, etc. Historiador de la microhistoria, del estado moderno, de la sociedad, de la historia y de la historiografía en general. De este amplio abanico temático, me detengo en el caso particular de la historia de la familia.

  5. El tratamiento a largo plazo del trastorno bipolar

    Leonardo Tondo

    2015-07-01

    Full Text Available Las indicaciones medicamentosas para el tratamiento del trastorno bipolar (TB requieren de una ponderación de la necesidad de tratamiento del episodio en curso y su evolución a largo plazo. Los objetivos principales radicarán en estabilizar el ánimo, evitar un episodio de polaridad opuesta y prevenir posibles recaídas. Dentro del abanico de tratamientos disponibles se encuentran los estabilizadores del humor, los antipsicóticos, los antidepresivos, y las terapias no farmacológicas. En el presente trabajo se realiza un recorrido sobre las ventajas y desventajas de estos tratamientos. La evidencia empírica indica que el litio resulta el estabilizador del humor más utilizado siendo considerado como gold standard para la prueba de nuevos tratamientos. Los antipsicóticos suelen ser los fármacos de elección para episodios maníacos con o sin este tipo de síntomas y prefiriéndose a los atípicos por presentar menores efectos secundarios. El uso de antidepresivos debe ser cauteloso por el riesgo de polarización a estados maníacos. Finalmente, dentro de las terapias no farmacológicas, la terapia cognitivo conductual y la psicoeducación son consideradas las intervenciones más eficaces.

  6. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Ingrid Viviana Serrano Ramírez

    2012-07-01

    Full Text Available Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violencia sexual. Actualmente, dirige una investigación sobre el dolor corporal a lo largo de los dos últimos siglos. Entre sus libros están traducidos La Segunda Guerra Mundial: una historia de las víctimas Empúries, 2003; Paidós, 2002, Sed de sangre: historia íntima del combate cuerpo a cuerpo en las guerras del siglo XX (Crítica, 2008 y Los violadores: historia del estupro de 1860 a nuestros días (Crítica, 2009. Recientemente, ha publicado What it Means to be Human. Reflections from 1791 to the Present (Virago, 2011.

  7. Psicología política: aportes a los derechos humanos de Costa Rica

    Mirta González Suárez

    2012-12-01

    Full Text Available El artículo presenta un resumen de los avances contemporáneos de la incidencia política desde la Psicología costarricense con base en la difusión y la publicación de investigaciones y acciones que han impactado las políticas públicas. Se parte del análisis de las posiciones de derecha (neoliberal, centro e izquierda (socialista, para construir un abanico de avances logrados en derechos de las mujeres, derechos sexuales y reproductivos, derechos de las personas menores de edad, derechos de los hombres, derechos laborales, derechos de la población indígena, derechos de las personas catalogadas como “enfermas mentales”, derechos de los grupos de diversidad sexual, derechos de la población migrante y derechos al apoyo psicológico en situaciones de desastres. Se destaca la importancia de que los grupos profesionales se manifiesten ante los grandes problemas nacionales, como lo plantea el Colectivo Costarricense de Psicología de la Liberación.

  8. Análisis de las aportaciones de los blogs educativos al logro de la competencia digital

    Virginia Aznar Cuadrado

    2010-03-01

    Full Text Available Hoy en día se está imponiendo como herramienta educativa el uso de Blogs dentro del sistema educativo formal. Todo ello ha conformado un nuevo enfoque de colaboración donde el aprendizaje ha tomado una relación más íntima con nuevos medios de enseñanza y aprendizaje. Nuestro trabajo tiene como objetivo analizar, por un lado, qué modalidades de blogs son los que se utilizan en el aula, y por otro lado cuáles son las finalidades que se les dan a estos Edublogs en los diferentes niveles educativos no universitarios en nuestro país. Para este estudio se han tomado como muestra un total de 374 blogs educativos contenidos en los directorios de Blogs Científicos y Educativos de España, Blogfesores y Aulablog. Consideramos que estos directorios son algunos de los que recogen un amplio abanico de Edublogs.

  9. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    Jesús Vera

    2012-12-01

    Full Text Available Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contradictoria literatura relativa al mismo. Los objetivos perseguidos en este estudio han sido: a caracterizar el tipo de profesionales que en nuestro entorno identifican y tratan el TEL; b conocer la conceptualización del TEL que realizan dichos profesionales; c averiguar los tipos de procedimientos de identificación del TEL en relación a los modelos teóricos declarados. Mediante una encuesta elaborada al efecto se han obtenido resultados que permiten constatar la gran diversidad de profesionales que abordan el TEL en nuestro entorno cultural; que no existe un grado de consenso suficiente entre ellos ni sobre la caracterización del trastorno ni sobre los procedimientos diagnósticos utilizados y que los diagnósticos de dichos profesionales no responden a los tres criterios básicos que en la actualidad se utilizan en la identificación del TEL: discrepancia, especificidad y marcadores de riesgo.

  10. de calda e do espectro de gotas

    José Luís Aguiar Figueiredo

    2007-01-01

    Full Text Available Se evaluó la influencia de la norma de aplicación y del espectro de gotas durante la aplicación de insecticidas, en el control de la mosca blanca (Bemisia tabaci, en el cultivo de la berenjena. Los ensayos constaron de muestras de menores y adultas de la mosca blanca en los tercios cimero y mediano de la parte aérea de plantas de berenjena, a los 4,7,14 y 21 días después de la aplicación de los tratamientos y del espectro de la población de gotas obtenido durante las aplicaciones. Los tratamientos utilizados fueron resultados de la combinación del tipo de equipamiento, boquillas hidráulicas y normas de pulverización, además del testigo donde no hubo aplicación. El uso de menores normas de aplicación produjo gotas de menor tamaño y mejor cobertura, evaluadas en términos de impactos por unidad de área . El mejor control de las menores y adultas de la mosca blanca fue obtenido a través de la combinación de la mochila manual dotada de válvula de presión constante (2 bar, boquilla abanico (API 11003 y norma de pulverización de 500 L/ha.

  11. La organización germinal

    Xavier Soca Filella

    2013-08-01

    Full Text Available Las vicisitudes de estos últimos años en las economías occidentales, y sobre todo en las del arco mediterráneo, han sumido las empresas en un profundo callejón sin salida, dónde tras efectuar reducciones drásticas en sus estructuras ahora ven mermadas sus posibilidades de crecimiento. Surge el interrogante de qué tipo de crecimiento perseguimos y qué organización precisamos para conseguirlo. Vislumbramos a partir de lo acaecido en los últimos dos lustros que las organizaciones preferirán moverse dentro de unos patrones de crecimientos sostenibles, en lugar de las alocadas carreras de inicios de siglo. Este crecimiento sostenible comportará decidir que formas de organización permitirán gestionar mejor este crecimiento. Dentro del abanico de las posibilidades, planteo un tipo de organización en constante cambio que facilite la adaptación a los diversos tipos de mercados que puedan ir surgiendo en el futuro: LA ORGANIZACIÓN GERMINAL.

  12. Pamies Bertrán, Antonio y Rodríguez Simón, Francisca (2005. El lenguaje de los enfermos: Metáfora y fraseología en el habla espontánea de los pacientes. Frankfurt am Main: Peter Lang. Europäischer Verlag der Wissenschaften; 165 pp.

    Elena Mironesko Bielova

    2006-05-01

    Full Text Available Regresaba a casa angustiada y descontenta conmigo misma. Después de sufrir un grave accidente de tráfico acudía con frecuencia a las consultas médicas y siempre pasaba lo mismo. La dificultad de expresar todo el abanico de sensaciones dolorosas –tan personales, tan mías– multiplicado por la proverbial paciencia y aguante (atribuidos al carácter ruso, que considera un valor indiscutible no manifestar explícitamente el sufrimiento resultó ser un increíble –pero cierto– obstáculo en mi comunicación con los facultativos. Me consolaba evocando la observación de un escritor ruso de principios de siglo XX que declaraba que es imposible la comprensión humana en general, argumentando esta triste sentencia con un ejemplo: «si te duele la barriga, por mucho que lo expliques a tu prójimo, no le dolerá igual que a ti». En fin, nunca comprenderá tu sufrimiento; entonces, guárdatelo «y vívelo en solitario».

  13. Influencia de la psicopatología emocional y el tipo de pérdida en la intensidad de los síntomas de duelo

    Manuel Fernández-Alcántara

    2016-01-01

    Full Text Available La pérdida de un ser querido puede dar lugar a un duelo complicado, caracterizado por intensos síntomas de anhelo, tristeza o pérdida de sentido. La identificación del duelo complicado es central para poder ofrecer tratamientos adecuados. Sin embargo, no se conoce con claridad el perfil sintomatológico, ni la influencia que tienen el tipo de pérdida en la intensidad del duelo. En este estudio descriptivo participaron un total de 68 personas que habían sufrido una pérdida, al menos seis meses antes de la evaluación. Completaron una batería de pruebas sobre intensidad del duelo y psicopatología. Los resultados se˜nalan que todas las variables psicopatológicas mostraron altas relaciones significativas con la intensidad de síntomas de duelo. La centralidad con que se percibió la pérdida y los sentimientos de hostilidad predijeron en gran medida los valores de duelo complicado y con mayor intensidad de experiencias de duelo y de síntomas psicopatológicos. El perfil sintomatológico en duelo complicado se relaciona con un gran abanico de psicopatología. La pérdida

  14. La hidrología y su papel en ingeniería del agua

    Amanda García-Marín

    2014-07-01

    Full Text Available La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, sensores en Hidrología, agua subterránea, entre otras. Dicha revisión no pretende ser exhaustiva, dado el tamaño limitado de este formato de publicación, sino motivar la publicación en Ingeniería del Agua de artículos dentro de la temática Hidrología.

  15. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    H. Diederix

    2006-12-01

    Full Text Available La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La falla, vista en sensores remotos o desde el aire, aparenta ser una sola traza continua, pero una inspección más detallada revela que la misma está constituida por cizallas Riedel sintéticas dextrales conectadas por lomos de presión de dimensiones variables. Un levantamiento fotogeológico seguido por una inspección de campo permitió ubicar un sitio idóneo para la excavación de una trinchera paleosismológica situada sobre una pequeña cuenca de tracción no intervenida por el hombre. El levantamiento preliminar del afloramiento creado en la trinchera indicó un registro de ocho eventos sísmicos durante el Holoceno.

  16. Revisión estratigráfica y paleoambientes del Grupo Angulos (Neógeno, Sierra de Famatina, La Rioja: Su significado en el relleno del antepaís fragmentado Stratigraphic revision of the Angulos Group (Miocene Famatina Ranges, La Rioja province: Sedimentary environements and its bearing on the Central Andean broken foreland till

    F.M. Dávila

    2005-03-01

    Full Text Available Sobre la ladera oriental de la sierra de Famatina se expone una espesa sucesión sinorogénica terciaria (>1500 m, conocida como los "Estratos Calchaquenses", designada formalmente como Grupo Angulos. Este grupo fue originalmente subdividido en tres formaciones: del Abra, del Buey y El Durazno. Este trabajo redescribe la estratigrafía del Grupo Angulos, y modifica y subdivide la Formación El Durazno, al redefinir su sección basal de areniscas con megaestratificación cruzada como Formación Santo Domingo. Once facies sedimentarias caracterizan al Grupo Angulos con predominio de términos silicoclásticos, volcanoclásticos, por sobre los carbonáticos. La asociación de facies de la Formación del Abra permite interpretar un ambiente de abanicos aluviales proximales que evolucionaron hacia abanicos terminales, con procesos de baja eficiencia en la sección basal que son reemplazados paulatinamente por asociaciones de alta eficiencia hacia el tope de la formación. En transición, una asociación de facies de abanicos distales caracteriza a la Formación del Buey, con desarrollo de cuerpos tabulares de calizas biolaminadas y paleosuelos que sugieren un ambiente con escasa pendiente y reducidas tasas de sedimentación. Una alternancia de conjuntos con megaestratificación cruzada y conglomerados arenosos con superficies fuertemente incisivas componen la Formación Santo Domingo sugiriendo sistemas de interacción eólico-fluvial. En discordancia la Formación El Durazno muestra una evolución paleoambiental desde planicies fluviales entrelazadas con fuerte influencia volcánica hacia sistemas de abanicos dominados por procesos de alta eficiencia. Las unidades del Grupo Angulos se disponen en tres megasecuencias, una basal grano decreciente seguida de dos grano crecientes. La ubicación del Grupo Angulos entre el Mioceno Inferior (Formación del Crestón y niveles de tobas datadas en 4 Ma, junto otras evidencias paleontológicas y correlaciones

  17. Estudio de rocas detríticas en la U.T.S.-3 del Terciario Continental de la Cuenca del Júcar (provincia de Albacete

    Santos García, J. A.

    1987-08-01

    Full Text Available A syntesis of the recent knowledges about detritic materials of the U.T.S.-3 in the Jucar Basin is established according to an exhaustive study of twenty-four lithostratigraphic columns. The petrography, granulometric distributions, statistical parameters of these materials is studied in detail. An analysis is also made of the morphology of the sedimentation environments. Lateral and vertical variations of these materials have been analysed. A transition from alluvial fan and lacustrine deposits can be observed.Mediante el estudio detallado de 24 columnas litoestratigráficas, se realiza una síntesis de los conocimientos existentes sobre los materiales detríticos de la U.T.S.-3, en la cuenca del Júcar. Se estudia detenidamente la petrografía, distribuciones granométricas, parámetros estadísticos, etc. Se analiza la morfología del medio de sedimentación. Se estudia en este trabajo la variación lateral y vertical de los materiales, quedando representada por una transición entre depósitos de abanicos aluviales y depósitos de ambiente lacustre.

  18. Surdez e preconceito: a norma da fala e o mito da leitura da palavra falada

    Sílvia Andreis Witkoski

    2009-01-01

    Full Text Available Hablar sobre sordera y prejuicio es narrar una de las interfaces del ser sordo. En medio al inmenso abanico que lo envuelve, el artículo trae para la discusión la norma del habla y el mito de la lectura de la palabra hablada, por considerar que ambos legitiman una serie de prácticas orales, afectando peyorativamente la construcción de la identidad del ser sordo y su derecho a una comunicación y formación significativa. En nombre de una seudo integración entre sordos y oyentes, se disfrazan los prejuicios en relación a la sordera y a los sordos, al implícitamente no aceptar su diferencia lingüística, de percepción del mundo y de su forma de ser. Esta discusión es construida esencialmente a partir del recate de muchas vivencias de los propios sordos, con el intuito de mostrar sus matices, descubriendo algunos de los discursos que legitiman esos prejuicios, buscando descubrir las implicaciones dolorosas que generan en la vida de los sordos.

  19. IRCAM, Centro Pompidou París – Francia

    Piano, -

    1979-05-01

    Full Text Available IRCAM is an autonomous department of the well known Pompidou Centre. The main building, destined to many varied cultural purposes, consists of a broad, open structure combining different spaces and functions, with ample flexibility, capable of housing the most diversified activities. IRCAM is integrated in this wide range of functions as an underground cellular complex adjacent to the Centre. It contains very specific acoustic features to make it capable, under optimal conditions, of carrying out its main objective: acoustic musical research work.

    El IRCAM es un departamento autónomo del conocido Centro Georges Pompidou. El edificio principal, destinado a usos culturales muy diferentes, está constituido por una amplia y abierta estructura que combina distintos ambientes y funciones, dotada de mucha flexibilidad y apta para el desarrollo de las más diversas actividades. El IRCAM queda incorporado a este abanico de funciones como un departamento celular subterráneo, contiguo al Centro. Presenta características acústicas muy específicas que le posibilitan para el desarrollo en condiciones óptimas de su función: la investigación en el campo acústico-musical.

  20. Cuestionario de evaluación de la personalidad eficaz en segundo y tercer ciclo de educación primaria

    Eva Fueyo Gutiérrez

    2010-01-01

    Full Text Available Se presenta un cuestionario de evaluación del constructoPersonalidad eficaz en contextos educativos de segundo y tercer ciclo de la educación primaria, con resultados de fiabilidad 0.797, validez de constructo, validez concurrente con factores de personalidad de segundo orden de CPQ de Porter y Cattell, y normalización en función de la variable género. Cubrimos así el abanico de cuestionarios elaborados en torno al constructo en contextos de educación secundaria, bachillerato, formación profesional, universidad yambientes laborales diferenciados en población hispano hablante (España y Iberoammerica. Se compone de 22 items aplicado a una muestra de 1041 estudiantes de 2º y 3º ciclo de Educación Primaria del Principado de Asturias Se evalúan cinco dimensiones: dos relacionadas con las fortalezas y demandas del yo: autoestima académica y la autoestima personal; dos relacionadas con las relaciones del yo: autorrealización social y autonomía social; finalmente una dimensión relacionada con los retos del yo denominada Autonomía resolutiva.

  1. De cargar algo a cargarse a alguien: verbos y expresiones que se prestan a confusión

    Antonio Romero Zamora

    2013-01-01

    Full Text Available Nuestra propuesta práctica va a centrarse en presentar situaciones (graduadas en dificultad en las que el léxico a utilizar es muy parejo en lo que a la forma se refiere;no así su significado y sentido, muy distante de unas voces a otras. El abanico de variedades distintivas es amplio: vacilación (ausencia/presencia/cambio preposicional,derivaciones o reflexividad, etc. Se comenzará con la oposición de únicamente dos términos, haciendo notar su cercanía fónica y parecido gráfico para destacar su gran distancia semántica. Una segunda actividad ampliará tanto el repertorio de palabras y expresiones con estas características como el repertorio de disparidades, volviendo a hacer hincapié en el par «proximidad formal/distancia semántica». Una tercera y última actividad aumentará los elementos contrastados y servirá de repaso y evaluación de lo tratado. Se trabajarán, por igual, las cuatro destrezas.

  2. Geology of the hills in the region of the City of Santiago de Chile: New isotopic constraints

    Geological, geochronological and geochemical data demonstrate that the area where the city of Santiago de Chile is established used to be a huge volcanic field. At present, it is possible to distinguish in the area at least three volcanic cycles, which are geographically superimposed and deeply eroded. The first is Oligocene in age, the second Lower to Middle Miocene and the third is Middle to Upper Miocene. The Oligocene cycle is represented by volcanic and volcanoclastic rocks of the Provincia-San Ramon-Abanico and Conchali belts, and welded tuffs of the San Cristobal and Renca hills. The Lower to Middle Miocene cycle consists of subvolcanic rocks, mostly of basaltic to basaltic-andesite composition, characterized by the presence of clino- and orthopyroxene. The Middle to Upper Miocene cycle is composed predominantly of amphibole-bearing subvolcanic rocks of dacitic composition. The latter are found at the Manquehue hill, which limits the northern part of the city, and the hills at the Rinconada de Conchali. In this communication, we present new Sr-, Nd- and Pb- isotope data obtained from two subvolcanic samples of basaltic composition collected from the San Cristobal hill and at the Santa Lucia hill (Lower to Middle Miocene) and one amphibole-bearing subvolcanic sample of dacitic composition from the Manquehue hill (Middle to Upper Miocene) (au)

  3. Las facies Keuper al SW de la provincia de Soria

    Hernando, S.

    1988-08-01

    Full Text Available This paper deals with the sedimentological analysis of the materials that correspond to the Keuper facies in the area situated between the Iberian Ranges and the Central System. Acording to the obtained data, two main aspects are emphasized: - During the Upper Triassic, a c1ear retreat of the roast line towards the East took place, since this area constituted the litoral zone during the sedimentation of the Rot and Muschelkalk. - Facies change lateraly from West to East as proximal alluvial Can sediments pass into facies interpreted as distal alluvial fans and continental sabkha environment.Se analizan, desde el punto de vista sedimentológico, unos materiales correspondientes a las facies Keuper entre la Cordillera Ibérica y el Sistema Central. Dos aspectos resaltan tras este análisis: - Desplazamiento de la línea de costa (que durante la sedimentación del Rot y del Muschelkalk estaba situada en esta zona hacia el Este. - Marcado cambio lateral de facies desde el Oeste hacia el Este, pasando de unas facies proximales-medias de abanico aluvial a unas facies distales y ambiente de sabkha continental.

  4. MARKETING IN THE CONSTRUCTION INDUSTRY: STATE OF KNOWLEDGE AND CURRENT TRENDS

    GIOVANNA NARANJO

    2011-01-01

    Full Text Available Las empresas del sector de la construcción son conscientes de la importancia de vincular la comercialización (o marketing a las funciones primordiales de la empresa, como respuesta ante la necesidad de adaptarse a los continuos cambios del sector, satisfacer las demandas de sus clientes, ser competitivos y mejorar su estrategia de negocio. El presente artículo presenta los resultados obtenidos del análisis cuantitativo y cualitativo del estado actual de conocimiento del marketing en el sector de la construcción. El estudio se realizó mediante una búsqueda bibliométrica y el posterior procesamiento y análisis de los artículos encontrados. A pesar de los esfuerzos realizados en la última década, es difícil generalizar cómo aplicar el marketing en las empresas del sector de la construcción debido a las particularidades del sector. Sin embargo, existe un abanico de posibles estrategias que pueden ser usadas; una vez las empresas conozcan las necesidades de los clientes serán capaces de escoger las estrategias que deben aplicar. Se proponen futuras líneas de investigación como la implementación del marketing, diferenciación del marketing de acuerdo con el tipo de cliente, y aplicación de las tecnologías y sistemas de información.

  5. Fundamentos biológicos en la extracción de regularidades del habla

    Juan Manuel Toro

    2011-03-01

    Full Text Available Uno de los mayores problemas en el estudio del lenguaje es la comprensión desus fundamentos biológicos. Una forma de abordar este problema que ha resultadoefectiva es la de estudiar hasta qué punto compartimos con otros animalesalgunos de los mecanismos responsables de su procesamiento. En este artículose presentan una serie de experimentos que demuestran que las habilidadespara extraer regularidades rítmicas y estadísticas del habla están ya presentesen algunos roedores. A su vez, otros estudios sugieren que los animales tambiénpueden procesar ciertas estructuras abstractas tradicionalmente ligadasa la gramática. Estos estudios apuntan en la dirección de que muchos de loscomponentes básicos del procesamiento lingüístico son compartidos a través dediferentes especies animales. Sin embargo, existe todavía un amplio abanico defenómenos lingüísticos que deben ser estudiados desde una perspectiva comparadapara determinar hasta qué punto el lenguaje humano hace uso de habilidadesya existentes en otros animales.

  6. Procesos de documentación arqueológica y generación de modelos virtuales

    Josep Blasco Senabre

    2011-04-01

    Full Text Available En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de obtención de datos. La posibilidad de producir modelos 3D supone un añadido imprescindible para mostrar tridimensionalmente el estado actual del monumento, así como para la recreación virtual del mismo a través de las técnicas de la realidad virtual y la realidad aumentada.

  7. Un San Juan Bautista firmado por Juan Simón Gutiérrez

    Requena Bravo de Laguna, José Luis

    2003-12-01

    Full Text Available El conocimiento de la pintura sevillana de la segunda mitad del siglo XVII supone uno de los grandes retos de nuestra historiografía artística. Efectivamente, el amplio abanico de discípulos e imitadores del arte de Murillo necesita una profunda revisión metodológica que sepa clarificar la nada fácil tarea de aislar las distintas personalidades que constituyen este importante grupo de artistas. En este sentido la personalidad de Juan Simón Gutiérrez (h. 1634-1724 continua siendo bastante confusa si bien con algunos interrogantes se le van atribuyendo ciertas obras que puedan responder al todavía escaso conocimiento de su estilo frente al amplio grupo de pintores pertenecientes a la escuela de Murillo. Este inédito San Juan Bautista predicando en el desierto (fig. 1, firmado por Juan Simón Gutiérrez (figs. 2-3 procedente de una colección cordobesa…

  8. Difusión de las publicaciones académicas en acceso abierto de la Facultad de Ciencias Sociales de la Universidad de Costa Rica

    Ruth González-Arrieta

    2014-05-01

    Full Text Available El artículo registra las publicaciones que se originan en las Unidades Académicas, Posgrados, Unidades de Investigación y Unidades de Información de la Facultad de Ciencias Sociales de la Universidad de Costa Rica (UCR. Mediante el análisis de las fuentes de información divulgadas en las páginas web de estas instancias universitarias, se refleja el abanico de recursos bibliográficos que difunden los resultados de las investigaciones o del quehacer docente, que comunican y comparten el conocimiento en reciprocidad con los principios del acceso abierto de la información científica en la Internet, por lo que se insta a desarrollar repositorios para la preservación digital y proyección académica. The article records the publications originating from Academic Units, Postgraduate, Research Units and Units of Information in the Faculty of Social Sciences of the University of Costa Rica. By analyzing the sources of information disclosed on the websites of these instances university, reflected the spectrum of information resources that disseminate the results of research or teaching work to communicate and share knowledge in reciprocal with the principles of open access scientific information on the Internet, so you are encouraged to develop repositories for digital preservation and academic projection.

  9. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    Pablo Young

    2010-08-01

    Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.

  10. Distribución de los suelos en función del relieve y de la neotectónica en la región sureste de la provincia de San Juan

    G.M. Suvires

    2004-09-01

    Full Text Available Se analizan las relaciones suelo-paisaje-neotectónica en la depresión tectónica conocida como valle del Tulum, en el sector sudeste de la provincia de San Juan. El área de estudio se encuentra localizada en la intersección del paralelo 31°30' S y el meridiano 68°29'O. Se reconocen tres principales unidades de relieve, A abanico aluvial; B sector de transición entre A y C, y C planicie aluvial del río San Juan. Consecuentemente con las diferencias de relieves y materiales originarios, estas áreas presentan específicas asociaciones de suelos correspondientes a los Complejos El Salado, Médano de Oro y Ramón Franco respectivamente. Los relieves A y B se caracterizan por suelos Entisoles, mientras que el C por los Aridisoles. Asimismo, la actividad neotectónica, en la región, ha contribuido favorablemente en la formación de los suelos del Complejo Médano de Oro pertenecientes al Suborden Aquents.

  11. I+D+i aplicada al control de especies invasoras en ecosistemas fluviales mediterráneos. El caso de la caña común (Arundo donax L.

    J. Jiménez Ruiz

    2015-01-01

    Full Text Available La problemática relacionada con Arundo donax L. (caña común ha ido más allá de las implicaciones biológicas asociadas a las especies invasoras. La extensa ocupación de los cañaverales en los márgenes de los ríos en toda la región mediterránea genera un amplio abanico de graves impactos, que ha llevado a que se pusiera en marcha un proyecto de investigación específico para el control de la especie. El proyecto ha consistido en el ensayo de una batería de tratamientos para el control de la especie: herbicidas, tratamientos físicos, mecánicos y biológicos, además del conocimiento de su biología en las zonas donde se han llevado a cabo los tratamientos, mediante el censo de las poblaciones. Por último, se han experimentado técnicas de teledetección para conocer su distribución. Los resultados han mostrado que es posible alcanzar un control severo y duradero de la especie en las zonas donde se ha actuado, tanto por métodos químicos como por métodos biológicos y mecánicos.

  12. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing.

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host-pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina(®) Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  13. Comparison of the disposition of several nitrogen-containing compounds in the sea urchin and other marine invertebrates

    Landrum, P.F.; Crosby, D.G.

    1981-01-01

    1. The disposition of an aromatic amine and three aromatic nitro compounds was investigated in the sea urchin, Strongylocentrotus purpuratus. 2. The sea urchin rapidly eliminated injected compounds. The elimination rate constants decreased in the order p-toluidine greater than p-nitroanisole . p-nitrophenol greater than p-nitrotoluene. The fraction of total injected compound eliminated in 8 h was lowest for p-nitrophenol less than p-toluidine less than p-nitrotoluene less than p-nitroanisole. 3. Biotransformation for the sea urchin was primarily reduction of the nitro group followed by acetylation of the amine. 4. Other animals, starfish (Pisaster ochraceus), sea cucumber (Cucumaria miniata), gum boot chiton (Cryptochiton stelleri) and mussels (Mytilus californianus), injected with p-nitroanisole exhibited a trend toward oxidative biotransformation. 5. Elimination of parent compound was the major pathway for reducing body burden of xenobiotics for the invertebrates studied. 6. p-Toluidine oxidizes during analysis and was thus not suitable for studying biotransformation.

  14. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  15. Developmental expression of a cell surface protein involved in sea urchin skeleton formation

    The authors have previously used a monoclonal antibody (1223) to identify a 130 Kd cell surface protein involved in skeleton formation is sea urchin embryos. In the current study the authors have examined the expression of the 1223 antigen over the course of development of embryos of two species, Strongylocentrotus purpuratus and Lytechinus pictus. The 130 Kd protein is detected in S. purp eggs on immunoblots. Labeling with [3H] leucine and immunoaffinity chromatography show that it also is synthesized shortly after fertilization. Immunofluroescence reveals that at this early stage the 1223 antigen is uniformly distributed on all of the cells. Synthesis decreases to a minimum by the time of hatching (18 h), as does the total amount of antigen present in the embryo. A second period of synthesis commences at the mesenchyme blastula stage, when the spicule-forming primary mesenchyme cells (PMCs) have appeared. During this later stage, synthesis and cell surface expression are restricted to the PMCs. In contrast to S. purp., in L. pictus the 130 Kd protein does not appear until the PMCs are formed. Hybrid embryos demonstrate a pattern of expression of the maternal species. These results suggest that early expression of 1223 antigen in S. purp. is due to utilization of maternal transcripts present in the egg. In both species later expression in PMCs appears to be the result of cell-type specific synthesis, perhaps encoded by embryonic transcripts

  16. Mechanism of Calcite Co-Orientation in the Sea Urchin Tooth

    Killian, Christopher; Metzler, Rebecca; Gong, Y. U. T.; Olson, Ian; Aizenberg, Joanna; Politi, Yael; Wilt, Fred; Scholl, Andreas; Young, Anthony; Doran, Andrew; Kunz, Martin; Tamura, Nobumichi; Coppersmith, Susan; Gilbert, P. U. P. A.

    2009-12-01

    Sea urchin teeth are remarkable and complex calcite structures, continuously growing at the forming end and self-sharpening at the mature grinding tip. The calcite (CaCO{sub 3}) crystals of tooth components, plates, fibers, and a high-Mg polycrystalline matrix, have highly co-oriented crystallographic axes. This ability to co-orient calcite in a mineralized structure is shared by all echinoderms. However, the physico-chemical mechanism by which calcite crystals become co-oriented in echinoderms remains enigmatic. Here, we show differences in calcite c-axis orientations in the tooth of the purple sea urchin (Strongylocentrotus purpuratus), using high-resolution X-ray photoelectron emission spectromicroscopy (X-PEEM) and microbeam X-ray diffraction ({mu}XRD). All plates share one crystal orientation, propagated through pillar bridges, while fibers and polycrystalline matrix share another orientation. Furthermore, in the forming end of the tooth, we observe that CaCO{sub 3} is present as amorphous calcium carbonate (ACC). We demonstrate that co-orientation of the nanoparticles in the polycrystalline matrix occurs via solid-state secondary nucleation, propagating out from the previously formed fibers and plates, into the amorphous precursor nanoparticles. Because amorphous precursors were observed in diverse biominerals, solid-state secondary nucleation is likely to be a general mechanism for the co-orientation of biomineral components in organisms from different phyla.

  17. The PHD domain of the sea urchin RAG2 homolog, SpRAG2L, recognizes dimethylated lysine 4 in histone H3 tails.

    Wilson, David R; Norton, Darrell D; Fugmann, Sebastian D

    2008-01-01

    V(D)J recombination is a somatic gene rearrangement process that assembles antigen receptor genes from individual segments during lymphocyte development. The access of the RAG1/RAG2 recombinase to these gene segments is regulated at the level of chromatin modifications, in particular histone tail modifications. Trimethylation of lysine 4 in histone H3 (H3K4me3) correlates with actively recombining gene elements, and this mark is recognized and interpreted by the plant homeodomain (PHD) of RAG2. Here we report that the PHD domain of the only known invertebrate homolog of RAG2, the SpRAG2L protein of the purple sea urchin (Strongylocentrotus purpuratus) also binds to methylated histones, but with a unique preference for H3K4me2. While the cognate substrate for the sea urchin RAG1L/RAG2L complex remains elusive, the affinity for histone tails and the nuclear localization of ectopically expressed SpRAG2L strongly support the model that this enzyme complex exerts its activity on DNA in the context of chromatin. PMID:18499250

  18. Habitat structure is more important than nutrient supply in modifying mussel bed assemblage in an upwelling area of the Peruvian coast

    Firstater, Fausto N.; Hidalgo, Fernando J.; Lomovasky, Betina J.; Ramos, Elmer; Gamero, Patricia; Iribarne, Oscar O.

    2011-06-01

    Upwelling intensity modifies coastal primary production and influences individual traits of habitat-forming species. Along the Peruvian coast, beds of the mytilid Perumytilus purpuratus provide structurally complex habitats that harbour many organisms. We predict that in the nutrient-rich system of Central Peru, the modification of structural complexity would have stronger effects on the Perumytilus community than nutrient addition. We experimentally examined the effects of nutrient addition on the Perumytilus-dominated assemblage and we evaluated the potential effect of varying shell size on the Perumytilus-dominated assemblage. Nutrient addition to the mussel bed with slow-release fertilizers caused no changes in the total macro- and microalgal biomass and did not affect abundances or composition of the assemblage. To explore the effect of structural complexity on the Perumytilus assemblage, we manipulated mussel size with experimental bags containing small and large individuals. Predators, grazers and mobile organisms were more abundant among smaller mussels, with smaller gap volume, whereas the barnacle Jehlius cirratus was more abundant on larger mussels. In conclusion, point-source nutrient addition to the mussel bed did not enhance primary production. However, the modification of structural characteristics related to mussel size induced changes in the faunal assemblage. Thus, it seems that in this nutrient-rich system, nutrient enhancement would not significantly affect Perumytilus and its assemblage, whereas structural habitat seems to play an important role in shaping this community.

  19. Early development and neurogenesis of Temnopleurus reevesii.

    Yaguchi, Shunsuke; Yamazaki, Atsuko; Wada, Wakana; Tsuchiya, Yasutaka; Sato, Toshihiko; Shinagawa, Hideo; Yamada, Yutaro; Yaguchi, Junko

    2015-04-01

    Sea urchins are model non-chordate deuterostomes, and studying the nervous system of their embryos can aid in the understanding of the universal mechanisms of neurogenesis. However, despite the long history of sea urchin embryology research, the molecular mechanisms of their neurogenesis have not been well investigated, in part because neurons appear relatively late during embryogenesis. In this study, we used the species Temnopleurus reevesii as a new sea urchin model and investigated the detail of its development and neurogenesis during early embryogenesis. We found that the embryos of T. reevesii were tolerant of high temperatures and could be cultured successfully at 15-30°C during early embryogenesis. At 30°C, the embryos developed rapidly enough that the neurons appeared at just after 24 h. This is faster than the development of other model urchins, such as Hemicentrotus pulcherrimus or Strongylocentrotus purpuratus. In addition, the body of the embryo was highly transparent, allowing the details of the neural network to be easily captured by ordinary epifluorescent and confocal microscopy without any additional treatments. Because of its rapid development and high transparency during embryogenesis, T. reevesii may be a suitable sea urchin model for studying neurogenesis. Moreover, the males and females are easily distinguishable, and the style of early cleavages is intriguingly unusual, suggesting that this sea urchin might be a good candidate for addressing not only neurology but also cell and developmental biology. PMID:25754419

  20. Unusual Gene Order and Organization of the Sea Urchin Hox Cluster

    Cameron, R A; Rowen, L; Nesbitt, R; Bloom, S; Rast, J P; Berney, K; Arenas-Mena, C; Martinez, P; Lucas, S; Richardson, P M; Davidson, E H; Peterson, K J; Hood, L

    2005-10-11

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3 gene is Hox5. (The gene order is : 5-Hox1, 2, 3, 11/13c, 11/13b, 11/13a, 9/10, 8, 7, 6, 5 - 3). The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  1. Unusual Gene Order and Organization of the Sea Urchin HoxCluster

    Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen,Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, KevinJ.; Hood, Leroy

    2005-05-10

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3' gene is Hox5. (The gene order is : 5'-Hox1,2, 3, 11/13c, 11/13b, '11/13a, 9/10, 8, 7, 6, 5 - 3)'. The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  2. Lesions of Copper Toxicosis in Captive Marine Invertebrates With Comparisons to Normal Histology.

    LaDouceur, E E B; Wynne, J; Garner, M M; Nyaoke, A; Keel, M K

    2016-05-01

    Despite increasing concern for coral reef ecosystem health within the last decade, there is scant literature concerning the histopathology of diseases affecting the major constituents of coral reef ecosystems, particularly marine invertebrates. This study describes histologic findings in 6 species of marine invertebrates (California sea hare [Aplysia californica], purple sea urchin [Strongylocentrotus purpuratus], sunburst anemone [Anthopleura sola], knobby star [Pisaster giganteus], bat star [Asterina miniata], and brittle star [Ophiopteris papillosa]) with spontaneous copper toxicosis, 4 purple sea urchins with experimentally induced copper toxicosis, and 1 unexposed control of each species listed. The primary lesions in the California sea hare with copper toxicosis were branchial and nephridial necrosis. Affected echinoderms shared several histologic lesions, including epidermal necrosis and ulceration and increased numbers of coelomocytes within the water-vascular system. The sunburst anemone with copper toxicosis had necrosis of both epidermis and gastrodermis, as well as expulsion of zooxanthellae from the gastrodermis. In addition to the lesions attributed to copper toxicosis, our results describe normal microscopic features of these animals that may be useful for histopathologic assessment of marine invertebrates. PMID:26459519

  3. Cell mediated immune response of the Mediterranean sea urchin Paracentrotus lividus after PAMPs stimulation.

    Romero, A; Novoa, B; Figueras, A

    2016-09-01

    The Mediterranean sea urchin (Paracentrotus lividus) is of great ecological and economic importance for the European aquaculture. Yet, most of the studies regarding echinoderm's immunological defense mechanisms reported so far have used the sea urchin Strongylocentrotus purpuratus as a model, and information on the immunological defense mechanisms of Paracentrotus lividus and other sea urchins, is scarce. To remedy this gap in information, in this study, flow cytometry was used to evaluate several cellular immune mechanisms, such as phagocytosis, cell cooperation, and ROS production in P. lividus coelomocytes after PAMP stimulation. Two cell populations were described. Of the two, the amoeboid-phagocytes were responsible for the phagocytosis and ROS production. Cooperation between amoeboid-phagocytes and non-adherent cells resulted in an increased phagocytic response. Stimulation with several PAMPs modified the phagocytic activity and the production of ROS. The premise that the coelomocytes were activated by the bacterial components was confirmed by the expression levels of two cell mediated immune genes: LPS-Induced TNF-alpha Factor (LITAF) and macrophage migration inhibitory factor (MIF). These results have helped us understand the cellular immune mechanisms in P. lividus and their modulation after PAMP stimulation. PMID:27113124

  4. Maintenance of somatic tissue regeneration with age in short- and long-lived species of sea urchins.

    Bodnar, Andrea G; Coffman, James A

    2016-08-01

    Aging in many animals is characterized by a failure to maintain tissue homeostasis and the loss of regenerative capacity. In this study, the ability to maintain tissue homeostasis and regenerative potential was investigated in sea urchins, a novel model to study longevity and negligible senescence. Sea urchins grow indeterminately, regenerate damaged appendages and reproduce throughout their lifespan and yet different species are reported to have very different life expectancies (ranging from 4 to more than 100 years). Quantitative analyses of cell proliferation and apoptosis indicated a low level of cell turnover in tissues of young and old sea urchins of species with different lifespans (Lytechinus variegatus, Strongylocentrotus purpuratus and Mesocentrotus franciscanus). The ability to regenerate damaged tissue was maintained with age as assessed by the regrowth of amputated spines and tube feet (motor and sensory appendages). Expression of genes involved in cell proliferation (pcna), telomere maintenance (tert) and multipotency (seawi and vasa) was maintained with age in somatic tissues. Immunolocalization of the Vasa protein to areas of the tube feet, spines, radial nerve, esophagus and a sub-population of circulating coelomocytes suggests the presence of multipotent cells that may play a role in normal tissue homeostasis and the regenerative potential of external appendages. The results indicate that regenerative potential was maintained with age regardless of lifespan, contrary to the expectation that shorter lived species would invest less in maintenance and repair. PMID:27095483

  5. Dicty_cDB: Contig-U15437-1 [Dicty_cDB

    Full Text Available 0 1 ( DR553880 ) WS03227.C21_F14 WS-MC-N-A-20 Picea glauca cDNA cl... 50 0.030 1 ( CO240636 ) WS00715.B21_I1...7 WS-PS-N-A-8 Picea glauca cDNA clo... 50 0.030 1 ( CO221954 ) WS01014.B21_H24 SS-R-N-A-11 Picea sitchensis cDNA... 50 0.030 1 ( CO21...Contig-U15437-1 no gap 1000 6 891404 891199 MINUS 2 3 U15437 0 0 0 0 0 2 0 0 0 0 0 ...ngylocentrotus purpuratus clone R3-14B9, WORK... 40 0.002 4 ( AL627212 ) Mouse DNA sequence from clone RP23-14...one CH230-423G17, WORKING DRA... 36 0.005 2 ( BJ354964 ) Dictyostelium discoideum cDNA clone:dda55f07, 3' ... 42 0.005 2 ( CT737140

  6. Biological testing of sediment for the Olympia Harbor Navigation Improvement Project, 1988: Geoduck, amphipod, and echinoderm bioassays

    Ward, J.A.; Word, J.Q.; Antrim, L.D.

    1989-05-01

    The Olympia Harbor Navigation Improvement Project requires the dredging of approximately 330,000 cubic yards (cy) of sediment from the harbor entrance channel and 205,185 cy from the turning basin. Puget Sound Dredged Disposal Analysis (PSDDA) partial characterization studies were used to plan a full sediment characterization in which chemical analyses and biological testing of sediments evaluated the suitability of the dredged material for unconfined, open-water disposal. The US Army Corps of Engineers (COE), Seattle District, contracted with NOAA/NMFS, Environmental Conservation Division, to perform the chemical analysis and Microtox bioassay tests, and with the Battelle/Marine Sciences Laboratory (MSL) in Sequim to perform flow-through solid-phase bioassays utilizing juvenile (8 to 10 mm) geoduck clams, Panopea generosa, and static solid phase bioassays using the phoxocephalid amphipod, Rhepoxynius abronius, developing embryos and gametes of the purple sea urchin, Strongylocentrotus purpuratus, and the larvae of the Pacific oyster Crassostrea gigas. When the results of the biological tests were evaluated under PSDDA guidelines, it was found that all the tested sediment treatments from Olympia Harbor are suitable for unconfined open-water disposal. 14 refs., 12 figs., 3 tabs.

  7. cis-Regulatory control of the initial neurogenic pattern of onecut gene expression in the sea urchin embryo.

    Barsi, Julius C; Davidson, Eric H

    2016-01-01

    Specification of the ciliated band (CB) of echinoid embryos executes three spatial functions essential for postgastrular organization. These are establishment of a band about 5 cells wide which delimits and bounds other embryonic territories; definition of a neurogenic domain within this band; and generation within it of arrays of ciliary cells that bear the special long cilia from which the structure derives its name. In Strongylocentrotus purpuratus the spatial coordinates of the future ciliated band are initially and exactly determined by the disposition of a ring of cells that transcriptionally activate the onecut homeodomain regulatory gene, beginning in blastula stage, long before the appearance of the CB per se. Thus the cis-regulatory apparatus that governs onecut expression in the blastula directly reveals the genomic sequence code by which these aspects of the spatial organization of the embryo are initially determined. We screened the entire onecut locus and its flanking region for transcriptionally active cis-regulatory elements, and by means of BAC recombineered deletions identified three separated and required cis-regulatory modules that execute different functions. The operating logic of the crucial spatial control module accounting for the spectacularly precise and beautiful early onecut expression domain depends on spatial repression. Previously predicted oral ectoderm and aboral ectoderm repressors were identified by cis-regulatory mutation as the products of goosecoid and irxa genes respectively, while the pan-ectodermal activator SoxB1 supplies a transcriptional driver function. PMID:26522848

  8. Phylogeny and biogeography of the fruit doves (Aves: Columbidae).

    Cibois, Alice; Thibault, Jean-Claude; Bonillo, Céline; Filardi, Christopher E; Watling, Dick; Pasquet, Eric

    2014-01-01

    We reconstruct the phylogeny of fruit doves (genus Ptilinopus) and allies with a dense sampling that includes almost all species, based on mitochondrial and nuclear sequence data. We evaluate the most likely biogeographic scenario for the evolution of this group that colonized many islands of the Pacific Ocean. We also investigate the evolution of one of the main plumage character of fruit doves (the color of the crown), and we propose several revisions of the group's systematics. All Ptilinopus taxa formed a monophyletic group that includes two morphologically distinct genera, Alectroenas and Drepanoptila, confirming a previous result found with less species and genes. The divergence time analysis suggests that the basal divergences within Ptilinopus dated to the Early Oligocene, and the biogeographic analysis indicates that fruit doves originated most probably from the proto New Guinea region. The earliest dispersals from the New Guinea region to Oceania occurred with the colonization of New Caledonia and Fiji. A large group of Polynesian species (Central and Eastern), as well as the three taxa found in Micronesia and four species from the Guinean-Moluccan region, form the "purpuratus" clade, the largest diversification of fruit doves within Oceania, which also has a New Guinean origin. However, the eastbound colonization of fruit doves was not associated with a significant increase of their diversification rate. Overall, the Melanesian region did not act as a cradle for fruit doves, in contrast to the New Guinea region which is found as the ancestral area for several nodes within the phylogeny. PMID:24012584

  9. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en

  10. Evolución paleogeográfica de la depresión de Elche-Cuenca del Bajo Segura (España durante el pleistoceno

    Dabrio, C. J.

    1990-08-01

    Full Text Available The Elche Basin-Lower Segura Bains is located in the eastern end of the Betic Cordillera at the northern end of the La Depresión de Elche-Cuenca del Bajo Segura se sitúa en la Cordillera Bética, en el extremo septentrional del «corredor de desgarre sinistra» definido por Montenat et., al. (1987. El análisis geomorfológico y sedimentológico de este área demuestra que la configuración actual de este sector costero está íntimamente ligada a la actividad neotectónica del tramo final del «corredor» a lo largo del Cuaternario. Durante el Plioceno Superior el mar ocupaba una amplia extensión que llegaba hasta el pie de los relieves de la Sierra de Crevillente, Macizo del Segura, Sierra de Carrascoy y Sierra de Cartagena. En la plataforma somera se depositaron las calcarenitas amarillas fosilíferas con sentido de progradación hacia el sureste. Durante el Pleistoceno Inferior la elevación de los macizos antes citados provocó una regresión generalizada que hizo situarse a la línea de costa mucho más próxima a la posición actual. Testigo de este límite marino son las facies mixtas de islas barrera-Iagoon que hoy en día observamos en la Sierra del Molar, Sierra del Moncayo, Rojales, Puerto de San Pedro, etc., y que se han denominado «Unidad de transición Moncayo-EI Molar» (Somoza, 1989; Goy et. al., 1989 a. Dentro de esta Unidad el sentido de progradación se mantiene hacia el sureste. La elevación de los relieves circundantes favoreció también la formación de abanicos aluviales cuyas facies distales se sitúan encima de la «Unidad de Transición» en el área de El Molar, el Moncayo y la Sierra de Columbares. La reactivación del tramo final del «corredor de desgarre» durante el Pleistoceno Inferior- Medio como consecuencia de la unión del accidente de Palomares-Alhama y el de Vélez Rubio, junto con el rejuego de los accidentes N 120-130" E, lleva consigo un cambio paleogeográfico brusco en toda

  11. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino Stratigraphy of the La Yesera Formation (Cretaceous: basal synrift fill of the Salta Group, Northwest Argentina

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.The red beds of La Yesera Formation, which are the basal strata of the Salta Rift, accumulated from the Late Neocomian to the Cenomanian. The La Yesera Formation is thicker than 700 meters in the Alemanía sub-basin. The unit is made up of three sections: the lower and upper ones are dominated by conglomerates, and the middle section consists of sandstone and siltstone. It is proposed here to consider these sections as formal members. The lower section, or Yacutuy Member, is

  12. Transformaciones edaficas y diageneticas de los depositos aluviales distales del mioceno de la cuenca de Madrid, area de Paracuellos de Jarama

    Alonso-Zarza, A. Mª

    2003-08-01

    Full Text Available The distal aluvial fan and the palustrine deposits of the Paracuellos de Jarama area display a variety of specific pedogenic and diagenetic features. The processes affecting these sediments were controlled by: the sedimentary environment, the lithology and initia1 texture of the sediments and by the pedogenic-diagenetic environment in which the transformations occurred. Thus, in the distal alluvial areas (PEL profile the first processes were the formation of thin carbonate laminae and sepiolite, further, these deposits were silicified and later, a spheroidal dolomite is formed on the opaline chert. In lacustnne environments (UPC profile, drying and root activity led to the formation of palustrine carbonates that were silicified, and the initial texture and structure were preserved. The silicification consisted on a pseudomorphic replacement that produced mainly opal whereas quartz was formed mostly by cementation and ageing of previous opal. In both environments, when the silicification occurs on sepiolite, or micrite with sepiolite, atypical microfibrous opal is produced. This replacement can lead to the release of Mg, favounng a later formation of dolomite on the opaline chert, with evidence of bacteria1 activity. Al1 these processes occurred in a shallow phreatic or even vadose environment.Los depósitos distales de los abanicos aluviales arcósicos y también los carbonatos palustres del área de Paracuellos de Jarama presentan rasgos muy específicos debidos a los procesos edáficos y diagenéticos que han sufrido. Los procesos que han afectado a estos sedimentos, y su intensidad, estuvieron controlados por: el ambiente sedimentario, la litología y textura/estructura inicial del material y también por el ambiente pedogénico- diagenético superficial en el que se han desarrollado las transformaciones. Así, en las lutitas de las zonas distales de los abanicos (perfil PEL se forman inicialmente láminas de carbonato edáfico y sepiolita

  13. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina Structural analysis at the southern end of the Central Precordillera of San Juan

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.The Central Precordillera of San Juan is a thin-skinned fold and thrust belt bounded to the east by the thick-skinned structures of the Eastern Precordillera. The objective of this study is to describe and interpret the structural features found at the southern end of this fold and thrust belt. The lomas de Andapaico's folds are of asymmetric, open chevron type, and are genetically related to fault propagation. Toward the north, the folding becomes tighter and broken by faults

  14. Anomalías morfoestructurales del drenaje del Río Salado sobre las Lomadas de Otumpa (Santiago del Estero y Chaco detectadas por procesamiento digital Drainage morphostructural anomalies of the Rio Salado in Lomadas de Otumpa (Santiago del Estero y Chaco detected by digital processing

    Verónica G Peri

    2010-06-01

    Full Text Available Se estudia la morfología y dinámica del abanico aluvial del río Salado del Norte, localizado en la región del Gran Chaco (provincias de Santiago del Estero y Chaco, dentro del piedemonte distal que se desarrolla a partir del levantamiento andino. Mediante el procesamiento digital integrado de imágenes satelitales ópticas y modelo digital de elevaciones (MDE, se reconocieron direcciones de escurrimiento, morfologías y edades relativas de cuatro grupos de paleocauces que se le asocian. Además, se realizó una caracterización del drenaje a partir de anomalías de desviamiento local y/o modificaciones en los diseños de cursos, que se acomodan a las estructuras y/o topografías regionales, particularmente en áreas de bajo relieve. Así, se han evidenciado dos importantes cambios en su dinámica, uno a escala regional a partir del gradual desvío de su cauce principal hacia el sur, y otro local, asociado al levantamiento de las Lomadas de Otumpa. De esta manera, se detectan anomalías o cambios en el régimen hidrogeológico, donde el antiguo abanico aluvial fue modificado, interrumpiéndose progresivamente su pendiente natural al extremo, que ahora la invierte hacia el noroeste y desvía el curso principal hacia el sur, donde fluye actualmente. La cartografía digital, complementada con el conocimiento geológico de superficie y subsuelo, resulta una herramienta de interpretación morfoestructural localmente insustituible en zonas de llanura con relieve poco evidente, y contribuye al mejor manejo de los recursos naturales asociados.Morphology and dynamics of alluvial fan of Río Salado del Norte are studied and presented. The area is located in the Gran Chaco region (provinces of Chaco and Santiago del Estero, Argentina, within the distal piedmont that evolves from the Andean uplift. Through the integration of digital processing optical satellite imagery and digital elevation model (DEM, it is recognized runoff direction, morphology and

  15. Parents' social representations about adolescents' leisure

    Antonino Manuel de Almeida Pereira

    2011-01-01

    Full Text Available En los Estados Unidos de América hay tres posiciones filosóficas antes de la recreación de los adolescentes (Larson y Seepersad, 2003: las actividades no estructuradas, las actividades estructuradas y la combinación de estas dos. Teniendo en cuenta la realidad de la sociedad que es la posición adoptada por los padres en Portugal para el ocio de sus hijos adolescentes? La presente investigación trató de identificar las representaciones que los padres tienen sobre el ocio de sus hijos. El estudio incidió sobre 70 padres de adolescentes que frecuentaban el 3er Curso de ESO en escuelas públicas de las ciudades portuguesas de Coimbra y de Santarém, a los cuales fueron realizadas entrevistas semiestructuradas. La técnica de tratamiento de la información utilizada fue el ¿análisis de contenido¿ (Bardin, 2008. Para la mayoría de los padres el ocio de sus hijos tiene un significado connotado con el desarrollo. Representan tiempos en los cuales los adolescentes deben experimentar un vasto abanico de experiencias orientadas por un conjunto de principios de modo a contribuir para su formación. Los entrevistados entienden, sobre todo, que deben ejercer un papel de modelación junto a sus hijos debiendo desarrollar conductas capaces de influenciar sus opciones y comportamientos. En términos de actividades a desarrollar durante el ocio de sus hijos, los encuestados privilegian, principalmente, el deporte, por razones de salud y por el hecho de tal práctica ser desarrollada en presencia de adultos que las coordinan u orientan. En resumen, podemos decir que los puntos de vista mencionados por los padres parecen ir un poco en el sentido de defensa de las actividades estructuradas.

  16. Landscape changes in a coastal system undergoing tourism development: implications for Barra de Navidad Lagoon, Jalisco, Mexico

    Tara L. Holland

    2011-01-01

    Full Text Available Por medio de dos imágenes de satélite adquiridas en 1985 (Landsat TM y 2000 (Landsat ETM+, se analizan cuantitativamente los patrones de cambio de cobertura y uso del suelo ocurridos entre 1985 y 2000 en la laguna de Barra de Navidad, Jalisco, México y su cuenca de drenaje. El análisis de las imágenes se realizó mediante una clasificación supervisada y verificación en campo de seis categorías de uso/cobertura de suelo: lagunar, agricultura, selva seca tropical, manglar y sin vegetación. Los cambios espaciales en la composición del uso del suelo fueron evaluados utilizando una matriz de transición y los cambios de configuración se interpretaron utilizando la métrica del paisaje. Los resultados mostraron que las áreas urbanas y turísticas se expandieron, a costa de la selva baja y suelos sin cobertura. También el manglar mostró un gran decremento (-39% experimentando una severa fragmentación. Estos cambios parecen estar relacionados con el incremento de la sedimentación, resultado de la erosión del suelo aguas arriba y a la progradación de un abanico dentro de la laguna de Barra de Navidad. Los resultados obtenidos pueden servir como un modelo de comparación de otros sistemas que experimentan múltiples factores estresantes, especialmente cambios relacionados con el turismo y la intensificación del uso del suelo.

  17. Evolución tectónica, paleogeográfica y metalogénica durante el Cenozoico en los Andes de Chile norte y central e implicaciones para las regiones adyacentes de Bolivia y Argentina Tectonic, paleogeographic, and metallogenic evolution during the Cenozoic in the Andes of Central and Northern Chile and implication for the adjacent regions of Bolivia and Argentina

    Reynaldo Charrier

    2009-10-01

    Full Text Available La orogenia incaica dio origen a un importante relieve en el Eoceno Medio, el que se concentró en el ámbito del arco magmático precedente, la Cordillera Incaica. Este relieve positivo de orientación NNE se extendió desde el sur de Perú hasta la región central de Chile y separó dos dominios paleogeográficos que tuvieron evoluciones diferentes durante el resto del Cenozoico. El dominio occidental se caracterizó por el predominio de procesos de erosión y sedimentación. En el dominio oriental también existieron importantes episodios de erosión que originaron depósitos que se encuentran en la vertiente oriental de la cadena en la actualidad y presentan una cronología comparable con la de los depósitos del dominio occidental. Sin embargo, la evolución se caracterizó por presentar, a partir del Eoceno Tardío, diferencias al norte y sur de los ~27ºS. Al norte de esa latitud, en el ámbito del Altiplano-Puna, el arco magmático se mantuvo aproximadamente en la misma posición, coincidente con la del arco actual, y estuvo bordeado por una cuenca de antepaís de retroarco; mientras que, al sur de ~27ºS, se desarrollaron sucesivos arcos magmáticos con una marcada migración hacia el este. El arco magmático del Eoceno Tardío al Oligoceno Tardío - Mioceno Temprano se caracterizó por el desarrollo de una amplia cuenca extensional de intra-arco, la cuenca de Abanico. En esta cuenca se acumularon hasta 3.000 m de rocas volcánicas, volcaniclásticas y, subordinadamente, sedimentarias. A partir del límite oligoceno-mioceno, tuvo lugar un nuevo evento compresivo a lo largo de todo el orógeno que rejuveneció el núcleo de la Cordillera Incaica e invirtió la cuenca de Abanico permitiendo la generación de abundantes depósitos sintectónicos a ambos lados de los nuevos relieves. El inicio de este evento coincide con la orogenia pehuenche, los pulsos compresivos se mantuvieron hasta el Plioceno Temprano. En el Mioceno Temprano a Medio

  18. Código de buena práctica para el control del dolor oncológico

    J. R. González-Escalada

    2011-04-01

    Full Text Available En muchas ocasiones, los pacientes con cáncer no expresan su dolor por miedo a que el médico desvíe su atención hacia este síntoma, en lugar de centrarse en el tratamiento de su enfermedad principal. No obstante, el paciente debe saber que el tratamiento de su dolor no solo no interfiere con la terapia curativa, sino que colabora con ella. Entre los enfermos, es habitual el temor a que el avance de la enfermedad les lleve a situaciones de sufrimiento insostenible que supere todas las posibilidades médicas, pero es nuestro deber ayudarles a ser conscientes de que la medicina ofrece un abanico de terapias capaces de aliviar su dolor y evitar su sufrimiento. Este conocimiento es esencial para aumentar su confianza en el tratamiento y mejorar la relación médico-paciente. Frente a este desafío, SECPAL (Sociedad Española de Cuidados Paliativos, SED (Sociedad Española del Dolor, SEOM (Sociedad Española de Oncología Médica y SEOR (Sociedad Española de Oncología Radioterápica unen sus esfuerzos y crean ALIADO (Alianza Contra el Dolor Oncológico, un grupo de trabajo interdisciplinario que nace con el objetivo de concienciar e implicar a todo el colectivo médico en la necesidad de mejorar la calidad de vida del paciente con dolor oncológico. La primera iniciativa de ALIADO en este sentido es la elaboración del Código de buena praxis para el tratamiento del dolor oncológico, que pretende contribuir al avance en el conocimiento y el manejo de estos pacientes.

  19. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico Interstitial cystitis: A challenge for the clinician

    Pablo Young

    2010-08-01

    Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.Interstitial cystitis is characterized by over 6 months of chronic pain, pressure and discomfort felt in the lower pelvis or bladder. It is often relieved with voiding, along with daytime frequency and nocturia in the absence of an urinary tract infection. The disorder can be divided clinically into two groups -ulcerative and non-ulcerative- based on cystoscopic findings and response to treatment. Management follows an approach of applying the least invasive therapy that affords sufficient relief of symptoms. We report a case of a patient with interstitial cystitis. The diagnosis was performed by symptoms and lesion in the cystoscopy and excellent response to amitriptyline.

  20. Los Rinoceróntidos fósiles del Mioceno inferior de Buñel (Valencia

    Belinchón, M.

    1984-04-01

    Full Text Available We have studied the fossil Rhinocerotidae from Buñol (Valencia, Spain. It is realized as stratigraphic synthesis of the deposit and dated as Orleanium Mammal Age (lower-middle Aragonium, which is equivalent to the 4b Neogene MammaL Unit (zonation of Mein, 1976. We conclude that the fossil association is a thanatocoenosis, with strongly rounded elements. The paleoenvironment, in which this association was accumulated, was a marsh zone in the distal part of an alluvial fan. Two species of Rhinocerotidae have been determined, one of the ,genus Acerotherium and another of the genus Dicerorhinus. The second is more abundant than the former and probably it would be adapted to a marshy habitat. We describe and figure the more representative material of both species.

    Se han estudiado los Rinoceróntidos fósiles de Buñol (Valencia. Se realiza una síntesis estratigráfica del yacimiento, estableciéndose su edad orleaniense (Aragoniense inferior-medio, equivalente a la zona 4b de la zonación de Mein (1975. Se concluye que el yacimiento corresponde a una tanatocenosis, con elementos fuertemente rodados, acumulada en una zona palustre situada en la parte distal de un abanico aluvial. Se han determinado dos especies de Rinoceróntidos: una, correspondiente al género Aceratherium, está poco representada y otra, asignable al género Dicerorhinus, es más abundante y probablemente estaba adaptada a un hábitat pantanoso. Se describe y figura el material más representativo de ambas especies.

  1. Estudio sedimentológico de las facies Buntsandstein en el extremo NW de la Rama Castellana de la Cordillera Ibérica (prov. de Soria

    Matesanz Yagüe, J.

    1987-04-01

    Full Text Available A sedimentological study is made in three lithostratigraphic units of the Buntsandstein facies succesion. The outcrops are located in the area between Cuevas de Ayllón and Retortillo de Soria (Soria Province. Each of these units has been charactericed by a variety of facies associations. The T-1.2 unit is considered as a low sinuosity fluvial system. At least the lower and intermediate part of this unit are associated with an alluvial fan system related with the Somolinos Fault. The T-1.3 unit is interpreted as a gravelly low sinuosity braided system. To the East, this unit changes laterally into sandstones. The T-1.4 unit has been divided into three episodes corresponding, from base to top, to low, high and low sinuosity fluvial system respectively.En este trabajo se realiza un estudio sedimentológico en tres unidades litoestratigráficas de la sucesión del Buntsandstein. Los afloramientos considerados se encuentran en la zona comprendida entre Cuevas de Ayllón y Retortillo de Soria (Prov. de Soria. Cada una de estas unidades ha sido caracterizada por un conjunto de asociaciones de facies. La unidad T-1.2 se interpreta como un sistema fluvial de baja sinuosidad asociado, al menos en lo que respecta a los tramos basales e intermedios de la misma, con un sistema de abanicos aluviales, relacionados con la Falla de Somolinos. La unidad T-1.3 corresponde a un sistema fluvial de baja sinuosidad, con carga de fondo constituida principalmente por gravas. Hacia el E., esta unidad pasa lateralmente a areniscas. La unidad T-1.4 ha sido dividida en tres etapas, que corresponden, de base a techo, a medios fluviales de baja, alta y baja sinuosidad respectivamente.

  2. Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?

    Lucas Sebastián Gómez García

    2009-11-01

    Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identificó, refiriéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que “los desplazados” pueden ser calificados, por un lado, de “superciudadanos sociales”, gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como “subciudadanos políticos y civiles”, que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.

  3. Magmatic evolution of pre-ore volcanics and porphyry intrusives associated with the Altar Cu-porphyry prospect, Argentina

    Gatzoubaros, M.; von Quadt, A.; Gallhofer, D.; Rey, R.

    2014-11-01

    Altar is a Cu-porphyry deposit related to several small plagioclase porphyry intrusions of the late Miocene formed on the margin of the Flat-Slab segment along the Andean Cordillera in north-west Argentina. New stratigraphic and structural mapping supported by geochemistry and geochronology of pre-ore volcanics at Altar has revealed that a period of ˜6-7 Ma of volcanism during the late Oligocene-early Miocene formed ˜4000 m of volcano-stratigraphic succession making up the Pachón Formation. It represents a period dominated by explosive to effusive eruption in a dynamic arc basin with local ash fall and flow deposition in lacustrine and fluvial sites. Volcanism is typified by medium- to high-K calc-alkaline arc magmatism with a shift from mafic compositions at the base to felsic rocks at the top of the formation containing zircons aged 21.9 ± 0.2 Ma (2 Std.Dev, U-Pb). A clear geochemical separation exists between early Miocene pre-ore volcanics that show signatures akin to non-adakitic, normal arc, extensional tectonic settings conducive of chemical differentiation at shallow crustal levels and correlate with intra-regional Abanico and Farellones Formations; and the middle to late-Miocene Cu-mineralised porphyry intrusions. After a break of ˜9 Ma in the geological record at Altar, these Cu-fertile bodies are emplaced entirely within the Pachón Rhyolite and represent adakite-like magmas with fractionation trends evolving from a lower crustal MASH zone. This distinction is controlled by a change from an extensional to compressive tectonic regime in the region during the middle Miocene in which magmas were stalled in the lower crust for an extended period, subsequently became enriched in metals and then formed several Cu-porphyry bodies which were emplaced during a relatively short period towards the late Miocene.

  4. Cities are at the center of our environmental future

    Saskia Sassen

    2010-06-01

    Full Text Available The global environmental challenge becomes tangible and urgent in cities. Thus, it is critical that we understand the capabilities of cities to transform what is today a negative environmental impact to a positive one. We must make cities part of the solution. One point of entry to this question is to view cities as a type of socio-ecological system that has an expanding range of articulations with nature's ecologies. Today, most of these articulations produce environmental damage. How can we begin to use these articulations to produce positive outcomes - outcomes that allow cities to contribute to environmental sustainability? The complex systemic and multi-scalar capacities of cities provide massive potential for a broad range of positive articulations with nature's ecologies.El desafío ambiental global se hace tangible y urgente en las ciudades. Por ende, es necesario que comprendamos cuáles son las potencialidades de las ciudades para transformar lo que hoy es un impacto ambiental negativo en uno positivo. En este sentido, la ciudad debe ser considerada como parte de la solución. Una ventana para mirar este asunto es la que considera a las ciudades como sistemas socio-ecológicos con un abanico de articulaciones con los sistemas ecológicos naturales. Hoy en día, la mayoría de estas articulaciones produce daños. ¿Cómo podemos empezar a utilizarlas para producir impactos positivos, que permitan una contribución de las ciudades a la sostenibilidad ambiental? Las potencialidades de carácter complejo y multi-escalar de las ciudades representan un potencial de gran relevancia para explorar un amplio rango de articulaciones positivas con las dinámicas ecológicas naturales.

  5. (1750-1850

    Pedro José Chacón Delgado

    2007-01-01

    Full Text Available El concepto de historia durante el periodo 1750 a 1850 en España se refiere la mayoría de las veces a la narración verídica de acontecimientos del pasado. Pero, junto a esa significación dominante, se observa también una lenta, pero constante y cada vez más evidente alusión al pasado como tal, que implica una concepción totalizante del mismo que condiciona el presente y predispone a encarar el futuro. Esta nueva acepción de la palabra historia vendrá de la mano de los acontecimientos políticos trascendentales que se producen en España con el cambio de siglo y será utilizada por las diferentes corrientes políticas en liza, en función de sus particulares ideologías e intereses. En este artículo se analizan históricamente los diferentes usos del término historia, prestando especial atención a los adjetivos que acompañaron en cada momento al término principal: historia literaria, narrativa, filosófica, erudita, natural, civil, nacional, etc. Tal perspectiva permite al autor aproximarse a un abanico de usos argumentativos del término desde los diversos ámbitos de conocimiento y de actividad en que dicho concepto de historia entró en juego a lo largo de ese periodo crucial.

  6. Estudio de los estilos de enseñanza y estilos de aprendizaje en la universidad

    María Julieta Laudadío

    2014-12-01

    Full Text Available La interacción entre las características contextúales, el modo de aprender de los alumnos y el estilo de enseñanza de los docentes abre un abanico de temáticas y plantea la necesidad de que los docentes conozcan los factores que influyen en la configuración de una enseñanza eficaz. Asimismo la identificación de los estilos de enseñanza de los docentes exige la necesidad de contar con instrumentos adecuados para su evaluación que consideren los aspectos no sólo didácticos sino también pedagógicos que configuran dichos estilos. El presente trabajo busca conocer cuáles son las formas típicas de enseñanza de los profesores universitarios en relación con las distintas disciplinas de enseñanza. Los estilos de enseñanza fueron evaluados mediante el Cuestionario sobre la Orientación Docente del Profesor Universitario (Feixas, 2006. Se trabajó con una muestra de 188 docentes de universidades privadas del sistema educativo argentino. En relación con los estilos adoptados por los profesores no se observaron desde el punto de vista descriptivo diferencias en las distintas carreras analizadas. En las distintas áreas de conocimiento encontramos profesores que adoptan tanto el estilo centrado en el docente como el estilo centrado en el estudiante.

  7. [Des]igualdad y anarquismo. Derecha e izquierda en el ideario anarquista

    Garaventa, Carlos A.

    2011-12-01

    Full Text Available Dentro del ideario anarquista podemos encontrar muchísimas vertientes ideológicas diferentes que nos hacen imposible dar una definición unívoca de esta corriente de pensamiento o, mejor dicho, de vida. Podemos señalar, sin embargo, una característica común a todo ideal ácrata: la oposición al Estado. Es posible señalar también, en un anarquismo puro, el respeto de los tres pilares fundadores de la Revolución Francesa, pero con una dinámica diferente: en lugar de considerarlos aisladamente, para el anarquismo puro, el trinomio debe funcionar como un todo único. Esto da lugar al triángulo virtuoso de libertad, igualdad y fraternidad; sin embargo, no todos los anarquistas defienden íntegramente este triángulo. Hay autores que, por ejemplo, no prestan atención a la igualdad. Siguiendo el esquema de distinción política que da Norberto Bobbio en Derecha e izquierda podemos realizar una diferenciación entre los anarquistas de ambos lados del abanico político. Esta diferencia la marca, según Bobbio, la aspiración, o no, a una sociedad igualitaria. En consecuencia, serán de izquierda aquellos anarquistas que defiendan la igualdad y, por ende, el triángulo virtuoso. Serán anarquistas de derecha, en cambio, aquellos que deseen la abolición del Estado pero haciendo caso omiso de si la sociedad se vuelve o no igualitaria.

  8. Nuevas Terapias: Estimulación eléctrica percutánea en dolor lumbar y cervical New therapies: Neuromodulation in the treatment of low back and cervical pain

    V. Villanueva

    2007-04-01

    Full Text Available La elevada incidencia y prevalencia del dolor lumbar y del cervical en las sociedades industrializadas hace que se consideren patologías de primer orden en los sistemas sanitarios, ya que además del elevado consumo de recursos sanitarios generan una importante pérdida de horas laborales. Son múltiples las opciones terapéuticas para el tratamiento de estos procesos, planteándose la estimulación eléctrica percutánea (PNT como una novedad dentro del abanico de posibilidades de tratamiento. Como característica diferencial con otros sistemas de neuromodulación resulta menos invasiva y con un perfil de seguridad y eficacia realmente notable. Presentamos una recopilación de los datos publicados más relevantes que avalan esta técnica y un breve comentario de los resultados preliminares de su utilización en nuestro país.The high incidence and prevalence of low back and cervical pain in industrialized societies ensues its importance for health systems. These conditions generate a high consumption of health resources and a significant loss of working hours. Among the therapeutic options for the treatment of these processes, Percutaneous Neuromodulation Therapy (PNT is an innovative procedure within the range of therapies available. PNT, unlike other neuromodulation systems, is less invasive and has a considerable safety and efficacy profile. A review of the relevant published data regarding this technique and a brief report on its preliminary results for its use in our country are made.

  9. Cómo aplicar árboles de decisión en SPSS

    Vanesa Berlanga-Silvente

    2013-01-01

    Full Text Available Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con estadísticos más tradicionales. Los árboles de decisión son una técnica estadística para la segmentación, la estratificación, la predicción, la reducción de datos y el filtrado de variables, la identificación de interacciones, la fusión de categorías y la discretización de variables continuas. La función árboles de decisión (Tree en SPSS crea árboles de clasificación y de decisión para identificar grupos, descubrir las relaciones entre grupos y predecir eventos futuros. Existen diferentes tipos de árbol CHAID, CHAID exhaustivo, CRT y QUEST según el que mejor se ajuste a nuestros datos.

  10. Los depósitos aluviales del paleógeno basal en el sector suroriental de la Cuenca del Duero (provincia de Segovia: evolución y minerales de la arcilla característicos

    Garzón, M. G.

    1989-04-01

    Sequence», dominated by arid or semiarid alluvial fans. For this reason, this episode presents an important development of duricrusts and palygorskite is the characteristic clay mineral, probably related with the edafic processes found in the frequent calcrete profiles appearing in these units.En este trabajo se estudian las facies detríticas que constituyen el ciclo prearcósico y la base del ciclo arcósico (de edad paleógena del borde suroriental de la cuenca del Duero. La cartografía geológica y la correlación litológica realizadas han permitido diferenciar cuatro unidades litoestratigráficas que, asimismo, presentan distintas asociaciones de minerales de la arcilla: unidad T.1.1., compuesta por arcillas y arenas cuarzosas, en la que la asociación de minerales de la arcilla es illita + caolinita; unidad T.1.2., de arenas cuarzosas con paleosuelos ferruginosos y esmectita corno mineral de la arcilla característico; unidad T.2.1., de conglomerados polimícticos, arenas arcósicas y arcillas, con frecuentes niveles de calcreta y palygorskita como mineral de la arcilla característico; unidad T.2.2., compuesta por arenas arcósicas, con niveles de encostramiento similares a los de la unidad anterior y esmectita e illita como minerales de la arcilla principales. Las dos primeras unidades son transicionales y presentan una relación genética, correspondiendo a una «Primera Secuencia Deposicional», que es granocreciente y representa una evolución progradante desde un sistema braided distal (T.1.1. a un sistema braided proximal (T.1.2., correspondientes a abanicos aluviales húmedos. Las unidades T.2.1. y T.2.2. forman una «Segunda Secuencia Deposicional», granodecreciente a gran escala, y refleja la transición desde partes proximales (T.2.l. a medias (T.2.2. de abanicos aluviales áridos a semiáridos. A partir del estudio mineralógico y sedimentológico puede concluirse que durante la sedimentación de estos materiales tuvo lugar un importante

  11. Evaluación de dos estrategias de pigmentación en salmón coho (Oncorhynchus kisutch Evaluation of two pigmentation strategies in coho salmon (Oncorhynchus kisutch

    J Pokniak

    2005-01-01

    Full Text Available El objetivo del presente trabajo fue evaluar el efecto del sexo y de dos tiempos de incorporación de astaxantina (AXT en la dieta sobre indicadores productivos, la coloración y pigmentación del salmón coho (Oncorhynchus kisutch a la cosecha. La experiencia se efectuó en balsas jaula (5x10x10 con 1368 salmones coho distribuidos al azar en cuatro jaulas con 342 peces cada una, asignados a dos tratamientos: control (80 ppm AXT por 105 días y experimental (80 ppm AXT por 53 días. Las características controladas fueron: peso, factor de condición, rendimiento de la canal, índices hepatosomático y gonadosomático, color y pigmentación del filete y steak. El grado de coloración se evaluó con Carta Color Roche®, Abanico Colorimétrico Salmo-Fan Roche® y Minolta Chroma Meter CR-200. La pigmentación en steaks y filete se registró con NIR (Near Infrared Reflectance. La respuesta productiva fue similar para ambos tratamientos, destacó un importante crecimiento gonadal en ambos tratamientos, lo que se reflejó en el alto índice gonadosomático alcanzado, superior a 5,5%. Las correlaciones encontradas fueron bajas y presentaron distintos niveles de significación. La coloración y pigmentación de steaks y filetes fueron mayores (P £ 0,05 para el tratamiento que recibió pigmento por 105 días. El efecto sexo originó diferencias significativas tanto en steaks como en filetes a favor de los machos. Los filetes de ambos tratamientos lograron la coloración mínima comercialmente exigida para ese corte, correspondiente a 15 según Carta Color Roche®, pero aquéllos del tratamiento experimental lograron un valor bajo el mínimo exigido con el abanico colorimétrico Roche®. De acuerdo a las condiciones de este ensayo los salmones coho alimentados con una dieta pigmentada por un periodo de 53 días no fue suficiente para lograr una apropiada coloración de sus filetes, cuando la evaluación se efectúa con una pauta más refinada como el

  12. Mercury contents in shellfish sold in Qingdao City and their health risk:Distribution and health risk assessment%青岛市售贝类中总汞含量分布及人群健康风险

    张磊; 张磊

    2014-01-01

    In order to understand the status of mercury pollution in the shellfish of Qingdao City, and mercury health risk for the population via consumption of shellfish production, a total of 181 samples for 8 types of shellfish including Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinine, Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse, were collected from the markets of 8 administrative regions in Qingdao from October in 2012 to April in 2013. The mercury contents in the shellfish samples were determined by the cold vapor atomic absorption spectrophotometry. The range of mercury contents in all the kinds of shellfish was from 0.001 mg·kg-1 to 0.098 mg·kg-1 . The average mercury content in Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinina Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse was 0.02, 0.039, 0.012, 0�013, 0.031, 0.030, 0.021, 0.020 mg·kg-1 , respectively. Among the production areas of shellfish in Qingdao, the samples from Hong Island had the highest average mercury content of 0.046 mg·kg-1 , followed by that from Longkou of 0. 027 mg·kg-1 . Shellfish samples from Rushan and Rizhao had the lowest mercury contents, which were 0. 002 mg·kg-1 and 0. 003 mg·kg-1 , respectively. The mercury concentrations were under the limit of national permitted levels in foods ( GB 2762-2012, 0.5 mg·kg-1 ) . The results of the assessments of mercury intake indicated that the amount of mercury intake through consumption of shellfish was far below the acceptable daily intake recommended by FAO/WHO. However, the calculation results of the target hazard quotient ( THQ) based on the new reference dose set by US Environmental Protection Agency showed that there was high mercury health risk for children living in the target areas through the exposure path of the consumption of shellfish products.%为了解青岛

  13. Consumption and digestion of animal food by rocky intertidal herbivores: an evaluation of digestive flexibility and omnivory in three grazing species Consumo y digestión de alimento animal por herbívoros del intermareal rocoso: evaluación de flexibilidad digestiva y omnivoría en tres especies de pastoreadores

    Patricio A Camus

    2009-01-01

    Full Text Available The ingestion of invertebrates by herbivores on rocky intertidal shores is traditionally considered a casual phenomenon. However, a recent study of 29 species in northern Chile shows that animal consumption is widespread, consistent, and important, suggesting that some of these herbivores may actually be omnivores. Therefore, we examined the capability of three common Chilean herbivores (the key-hole limpets Fissurella limbata and Fissurella pida and the polyplacophoran Chiton granosus to digest animal food. For each species, we conducted no-choice feeding experiments using artificial foods based on either algal or animal tissue from one of their frequent prey (Ulva rigida, Perumytilus purpuratus. After the feeding trials, we evaluated the total proteolytic activity (availability of free amino acids in the digestive contents of the species studied and, as a reference, we evaluated this activity in animals obtained directly from the field. We found that all three species were able to eat animal food, and this consumption was not significantly different from that of algal food, suggesting that both foods were not only edible but at least similarly palatable. In addition, we detected comparable levels of proteolytic activity under the three feeding conditions for the three species. No statistical differences were found for C. granosus, but activity was significantly higher with animal food in F. limbata and with algal food in F. pida. Our data show the high digestive flexibility of these species, suggesting their ability for adaptive modulation and the possibility that they are true omnivorous consumers. We discuss the implications of these results for our current view of the structure of rocky intertidal food webs.La ingestión de invertebrados por herbívoros de costas intermareales rocosas se considera tradi-cionalmente un fenómeno casual. Sin embargo, un estudio reciente en 29 especies del norte de Chile muestra que el consumo animal es

  14. Cathepsin L of the sea cucumber Apostichopus japonicus-molecular characterization and transcriptional response to Vibrio splendidus infection.

    Yang, Jingwen; Liu, Huihui; Zheng, Gang; Xiang, Xiaowei; Lv, Zhenming; Wang, Tianming

    2016-02-01

    Cathepsin L, a lysosomal endopeptidase, has been noted for its involvement in the innate immune response in invertebrates. Here, the cathepsin L cDNA of the sea cucumber Apostichopus japonicus (AjCatL) is identified from an EST library and then cloned by the rapid amplification of the cDNA ends (RACE) PCR. The full-length cDNA is 1678 bp long containing an open reading frame (ORF) of 1002 bp, an 80 bp 5' UTR and a 599 bp 3' UTR. The cDNA encodes 333 amino acid residues with a predicted molecular mass of 37.07 kDa and a theoretical isoelectric point (pI) of 5.01. The full-length AjCatL contains three active sites of eukaryotic thiol (cysteine) protease at positions 133-144, 278-288 and 295-314. Analysis of the predicted tertiary structure of prepro-CatL (17-333 aa) and mature-CatL (116-333 aa) reveals that the propeptide region (17-115 aa) blocks access to the substrate-binding cleft. Phylogenetic analysis shows that the AjCatL is clustered together with two other CatLs from Strongylocentrotus purpuratus. The enzymatic activity of AjCatL was verified using a substrate hydrolyzing assay with recombinant mAjCatL. Further analysis of real time-PCR demonstrates that the expression of AjCatL mRNA is significantly up-regulated in the coelomocytes in cases of infection with the common bacterial pathogen, Vibrio splendidus. This suggests that the AjCatL is likely to be involved in the immune response. PMID:26777896

  15. Transcriptome sequencing and characterization for the sea cucumber Apostichopus japonicus (Selenka, 1867.

    Huixia Du

    Full Text Available BACKGROUND: Sea cucumbers are a special group of marine invertebrates. They occupy a taxonomic position that is believed to be important for understanding the origin and evolution of deuterostomes. Some of them such as Apostichopus japonicus represent commercially important aquaculture species in Asian countries. Many efforts have been devoted to increasing the number of expressed sequence tags (ESTs for A. japonicus, but a comprehensive characterization of its transcriptome remains lacking. Here, we performed the large-scale transcriptome profiling and characterization by pyrosequencing diverse cDNA libraries from A. japonicus. RESULTS: In total, 1,061,078 reads were obtained by 454 sequencing of eight cDNA libraries representing different developmental stages and adult tissues in A. japonicus. These reads were assembled into 29,666 isotigs, which were further clustered into 21,071 isogroups. Nearly 40% of the isogroups showed significant matches to known proteins based on sequence similarity. Gene ontology (GO and KEGG pathway analyses recovered diverse biological functions and processes. Candidate genes that were potentially involved in aestivation were identified. Transcriptome comparison with the sea urchin Strongylocentrotus purpuratus revealed similar patterns of GO term representation. In addition, 4,882 putative orthologous genes were identified, of which 202 were not present in the non-echinoderm organisms. More than 700 simple sequence repeats (SSRs and 54,000 single nucleotide polymorphisms (SNPs were detected in the A. japonicus transcriptome. CONCLUSION: Pyrosequencing was proven to be efficient in rapidly identifying a large set of genes for the sea cucumber A. japonicus. Through the large-scale transcriptome sequencing as well as public EST data integration, we performed a comprehensive characterization of the A. japonicus transcriptome and identified candidate aestivation-related genes. A large number of potential genetic

  16. Molecular cloning of heat shock protein 10 (Hsp10) and 60 (Hsp60) cDNAs and their expression analysis under thermal stress in the sea cucumber Apostichopus japonicus.

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Ru, Xiaoshang; Zhao, Ye; Yang, Hongsheng

    2014-05-01

    Hsp10 and Hsp60 are important heat shock proteins (HSPs), which might be indispensable in the heat shock response and many other physiological processes. We obtained full-length cDNAs of genes hsp10 and hsp60 and classified their mRNA expression levels under thermal stress in the sea cucumber Apostichopus japonicus. Full-length hsp10 cDNA was 1528 bp containing a 5' untranslated region (UTR) of 83 bp, a 3' UTR of 1133 bp and an open reading frame (ORF) of 312 bp encoding 103 amino acid residues. Full-length hsp60 cDNA was 2560 bp containing a 118-bp 5' UTR, a 678-bp 3' UTR and a 1764-bp ORF encoding 586 amino acid residues. The deduced amino acid sequences of Hsp10 and Hsp60 shared the highest identity with sequences of the sea urchin Strongylocentrotus purpuratus, and phylogenetic trees showed that the evolution of Hsp10 and Hsp60 was almost in accord with the evolution of species. Further analysis by real-time PCR showed that the expression of hsp10 and hsp60 mRNA was highly up-regulated at 26 °C compared with other three groups (20, 22, 24 °C), and their expression in the intestine was in a time-dependent manner at 26 °C. The results suggested that hsp10 and hsp60 were involved in the heat-shock response in the sea cucumber A. japonicus. PMID:24721556

  17. The protein precursors of peptides that affect the mechanics of connective tissue and/or muscle in the echinoderm Apostichopus japonicus.

    Maurice R Elphick

    Full Text Available Peptides that cause muscle relaxation or contraction or that modulate electrically-induced muscle contraction have been discovered in the sea cucumber Apostichopus japonicus (Phylum Echinodermata; Class Holothuroidea. By analysing transcriptome sequence data, here the protein precursors of six of these myoactive peptides (the SALMFamides Sticho-MFamide-1 and -2, NGIWYamide, stichopin, GN-19 and GLRFA have been identified, providing novel insights on neuropeptide and endocrine-type signalling systems in echinoderms. The A. japonicus SALMFamide precursor comprises eight putative neuropeptides including both L-type and F-type SALMFamides, which contrasts with previous findings from the sea urchin Strongylocentrotus purpuratus where L-type and F-type SALMFamides are encoded by different genes. The NGIWYamide precursor contains five copies of NGIWYamide but, unlike other NG peptide-type neuropeptide precursors in deuterostomian invertebrates, the NGIWYamide precursor does not have a C-terminal neurophysin domain, indicating loss of this character in holothurians. NGIWYamide was originally discovered as a muscle contractant, but it also causes stiffening of mutable connective tissue in the body wall of A. japonicus, whilst holokinins (PLGYMFR and derivative peptides cause softening of the body wall. However, the mechanisms by which these peptides affect the stiffness of body wall connective tissue are unknown. Interestingly, analysis of the A. japonicus transcriptome reveals that the only protein containing the holokinin sequence PLGYMFR is an alpha-5 type collagen. This suggests that proteolysis of collagen may generate peptides (holokinins that affect body wall stiffness in sea cucumbers, providing a novel perspective on mechanisms of mutable connective tissue in echinoderms.

  18. The evolution and diversity of SALMFamide neuropeptides.

    Maurice R Elphick

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Two types of SALMFamides have been identified: L-type (e.g. the starfish neuropeptides S1 and S2 with the C-terminal motif LxFamide (x is variable and F-type with the C-terminal motif FxFamide. In the sea urchin Strongylocentrotus purpuratus (class Echinoidea there are two SALMFamide genes, one encoding L-type SALMFamides and a second encoding F-type SALMFamides, but hitherto it was not known if this applies to other echinoderms. Here we report the identification of SALMFamide genes in the sea cucumber Apostichopus japonicus (class Holothuroidea and the starfish Patiria miniata (class Asteroidea. In both species there are two SALMFamide genes: one gene encoding L-type SALMFamides (e.g. S1 in P. miniata and a second gene encoding F-type SALMFamides plus one or more L-type SALMFamides (e.g. S2-like peptide in P. miniata. Thus, the ancestry of the two SALMFamide gene types traces back to the common ancestor of echinoids, holothurians and asteroids, although it is not clear if the occurrence of L-type peptides in F-type SALMFamide precursors is an ancestral or derived character. The gene sequences also reveal a remarkable diversity of SALMFamide neuropeptides. Originally just two peptides (S1 and S2 were isolated from starfish but now we find that in P. miniata, for example, there are sixteen putative SALMFamide neuropeptides. Thus, the SALMFamides would be a good model system for experimental analysis of the physiological significance of neuropeptide "cocktails" derived from the same precursor protein.

  19. Search for eukaryotic motility proteins in spirochetes: immunological detection of a tektin-like protein in Spirochaeta halophila.

    Barth, A L; Stricker, J A; Margulis, L

    1991-01-01

    The serial endosymbiotic theory (SET) for the spirochete origin of undulipodia (cilia and eukaryotic flagella) predicts that a greater number of axonemal proteins will show homology to spirochete than to other bacterial proteins. To continue testing, the SET proteins associated with eukaryotic motility (tektin, centrin and calmodulin) were sought in Spirochaeta halophila. Western blot immunological detection techniques (for tektin and centrin) and two-dimensional gel analysis (for calmodulin) were used. Tektins are filamentous proteins extending the length of the axoneme in sperm tails and other undulipodia. Whole cell extracts of S. halophila were probed with antibodies made against three sea urchin (Lytechinus pictus) sperm axonemal tektins (tektins A, B, and C). In the spirochetes, one tektin-like protein was detected as a band on Western blots (a C tektin.) An antibody made against Lytechinus pictus sperm tail axonemes, affinity-purified against the C tektin of another sea urchin, Stronglyocentrotus purpuratus, bound to a 30 kDa protein from Spirochaeta halophila. The C tektin epitope was not detected in Escherichia coli. Both the poly- and monoclonal anti-centrin antibodies cross-reacted with multiple proteins in the control alga (Tetraselmis striata) and in the putatively negative control bacterium E. coli. No cross reaction was seen between any anti-centrin antibody and S. halophila. Neither did a two-dimensional gel analysis reveal the presence of calmodulin in these spirochetes or in the two other prokaryotes tested (Spiroplasma citri, Acholeplasma laidlawii). Although neither centrin nor calmodulin were detected, a 30 kDa tektin-like protein apparently is present in these spirochetes. PMID:1863720

  20. De novo assembly and analysis of tissue-specific transcriptomes revealed the tissue-specific genes and profile of immunity from Strongylocentrotus intermedius.

    Chen, Yadong; Chang, Yaqing; Wang, Xiuli; Qiu, Xuemei; Liu, Yang

    2015-10-01

    Strongylocentrotus intermedius is an important marine species in north China and Japan. Recent years, diseases are threating the sea urchin aquaculture industry seriously. To provide a genetic resource for S. intermedius as well as overview the immune-related genes of S. intermedius, we performed transcriptome sequencing of three cDNA libraries representing three tissues, coelomocytes, gut and peristomial membrane respectively. In total 138,421 contigs were assembled from all sequencing data. 96,764 contigs were annotated according to bioinformatics databases, including NT, nr, Swiss-Prot, KEGG, COG. 49,336 Contigs were annotated as CDS. In this study, we obtained 24,778 gene families from S. intermedius transcriptome. The gene expression analysis revealed that more genes were expressed in gut, more high expression level genes in coelomocytes when compared with other tissues. Specific expressed contigs in coelomocytes, gut, and peristomial membrane were 546, 1136, and 1012 respectively. Pathway analysis suggested 25, 17 and 36 potential specifically pathways may specific progressed in peristomial membrane, gut and coelomocytes respectively. Similarities and differences between S. intermedius and other echinoderms were analyzed. S. intermedius was more homology to Strongylocentrotus purpuratus than others sea urchin. Of 24,778 genes, 1074 genes are immune-related, immune genes were expressed with a higher level in coelomocytes than other tissues. Complement system may be the most important immune system in sea urchin. We also identified 2438 SSRs and 16,236 SNPs for S. intermedius. These results provide a transcriptome resource and foundation to study molecular mechanisms of sea urchin immune system. PMID:26253994

  1. Species sensitivity distribution evaluation for chronic nickel toxicity to marine organisms.

    DeForest, David K; Schlekat, Christian E

    2013-10-01

    In Europe, the European Union's Existing Substances Regulation (EEC 793/93), the REACH Regulation, and Water Framework Directive all share common guidance for conducting environmental effects assessments, which can be further used to derive predicted no effect concentrations (PNECs) and environmental quality standards (EQS) for chemical substances. To meet the criteria for using a species sensitivity distribution (SSD) in the effects assessment of Ni for marine organisms, chronic toxicity data from the published scientific literature were augmented with toxicity testing of several additional marine species including: a unicellular alga (Dunalliela tertiolecta), a diatom (Skeletonema costatum), 2 macroalgae (Champia parvula, Macrocystis pyrifera), 2 mollusks (Crassostrea gigas, Mytilus galloprovincialis), 2 echinoderms (Dendraster excentricus, Strongylocentrotus purpuratus), a polychaete (Neanthes arenaceodentata), and a fish (Cyprinodon variegatus). Based on this updated database, which includes chronic Ni toxicity data for a total of 17 marine species, HC5 values (hazardous concentrations to 5% of the species) were derived using an SSD. The most sensitive species is a tropical sea urchin from the Caribbean region, Diadema antillarum, which has an EC10 that is approximately 6-fold less than the EC10 for the second most sensitive species tested. There is some uncertainty in the representativeness of D. antillarum to temperate European marine waters because 1) a European sea urchin species (Paracentrotus lividus) is approximately 48-fold less sensitive to Ni, and (2) ambient marine Ni concentrations in at least some European waters closely approach the D. antillarum EC10. The HC5 values with and without D. antillarum included in the SSD are 3.9 and 20.9 μg/L, respectively. Site-specific toxicity testing with local species may be warranted for locations where Ni concentrations fall between the range in HC5s of 3.9 to 20.9 μg/L. PMID:23553986

  2. Characterization of the deleted in autism 1 protein family: implications for studying cognitive disorders.

    Azhari Aziz

    Full Text Available Autism spectrum disorders (ASDs are a group of commonly occurring, highly-heritable developmental disabilities. Human genes c3orf58 or Deleted In Autism-1 (DIA1 and cXorf36 or Deleted in Autism-1 Related (DIA1R are implicated in ASD and mental retardation. Both gene products encode signal peptides for targeting to the secretory pathway. As evolutionary medicine has emerged as a key tool for understanding increasing numbers of human diseases, we have used an evolutionary approach to study DIA1 and DIA1R. We found DIA1 conserved from cnidarians to humans, indicating DIA1 evolution coincided with the development of the first primitive synapses. Nematodes lack a DIA1 homologue, indicating Caenorhabditis elegans is not suitable for studying all aspects of ASD etiology, while zebrafish encode two DIA1 paralogues. By contrast to DIA1, DIA1R was found exclusively in vertebrates, with an origin coinciding with the whole-genome duplication events occurring early in the vertebrate lineage, and the evolution of the more complex vertebrate nervous system. Strikingly, DIA1R was present in schooling fish but absent in fish that have adopted a more solitary lifestyle. An additional DIA1-related gene we named DIA1-Like (DIA1L, lacks a signal peptide and is restricted to the genomes of the echinoderm Strongylocentrotus purpuratus and cephalochordate Branchiostoma floridae. Evidence for remarkable DIA1L gene expansion was found in B. floridae. Amino acid alignments of DIA1 family gene products revealed a potential Golgi-retention motif and a number of conserved motifs with unknown function. Furthermore, a glycine and three cysteine residues were absolutely conserved in all DIA1-family proteins, indicating a critical role in protein structure and/or function. We have therefore identified a new metazoan protein family, the DIA1-family, and understanding the biological roles of DIA1-family members will have implications for our understanding of autism and mental

  3. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    L. Courtney Smith

    2012-04-01

    Full Text Available The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10 members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus SNPs within the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. An Sp185/333-positive BAC insert has a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes. RNA editing is detectible throughout the messages and putative post-translational modifications to the proteins result in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full-length and truncated proteins, including some with missense sequence. Current results suggest that both native and a recombinant Sp185/333 protein bind bacteria and are likely important in sea urchin

  4. An ancient evolutionary origin of the Rag1/2 gene locus.

    Fugmann, Sebastian D; Messier, Cynthia; Novack, Laura A; Cameron, R Andrew; Rast, Jonathan P

    2006-03-01

    The diversity of antigen receptors in the adaptive immune system of jawed vertebrates is generated by a unique process of somatic gene rearrangement known as V(D)J recombination. The Rag1 and Rag2 proteins are the key mediators of this process. They are encoded by a compact gene cluster that has exclusively been identified in animal species displaying V(D)J-mediated immunity, and no homologous gene pair has been identified in other organisms. This distinctly restricted phylogenetic distribution has led to the hypothesis that one or both of the Rag genes were coopted after horizontal gene transfer and assembled into a Rag1/2 gene cluster in a common jawed vertebrate ancestor. Here, we identify and characterize a closely linked pair of genes, SpRag1L and SpRag2L, from an invertebrate, the purple sea urchin (Strongylocentrotus purpuratus) with similarity in both sequence and genomic organization to the vertebrate Rag1 and Rag2 genes. They are coexpressed during development and in adult tissues, and recombinant versions of the proteins form a stable complex with each other as well as with Rag1 and Rag2 proteins from several vertebrate species. We thus conclude that SpRag1L and SpRag2L represent homologs of vertebrate Rag1 and Rag2. In combination with the apparent absence of V(D)J recombination in echinoderms, this finding strongly suggests that linked Rag1- and Rag2-like genes were already present and functioning in a different capacity in the common ancestor of living deuterostomes, and that their specific role in the adaptive immune system was acquired much later in an early jawed vertebrate. PMID:16505374

  5. Regulation of membrane fusion and secretory events in the sea urchin embryo

    Membrane fusion and secretory events play a key role in fertilization and early development in the sea urchin embryo. To investigate the mechanism of membrane fusion, the effect of inhibitors of metalloendoprotease activity was studied on two model systems of cell fusion; fertilization and spiculogenesis by primary mesenchyme cells in the embryo. Both the zinc chelator, 1,10-phenanthroline, and peptide metalloprotease substrates were found to inhibit both fertilization and gamete fusion, while peptides that are not substrates of metalloproteases did not affect either process. Primary mesenchyme cells form the larval skeleton in the embryo by deposition of mineral and an organic matrix into a syncytial cavity formed by fusion of filopodia of these cells. Metalloprotease inhibitors were found to inhibit spiculogenesis both in vivo and in cultures of isolated primary mesenchyme cells, and the activity of a metalloprotease of the appropriate specificity was found in the primary mesenchyme cells. These two studies implicate the activity of a metalloprotease in a necessary step in membrane fusion. Following fertilization, exocytosis of the cortical granules results in the formation of the fertilization envelope and the hyaline layer, that surround the developing embryo. The hatching enzyme is secreted by the blastula stage sea urchin embryo, which proteolyzes the fertilization envelope surrounding the embryo, allowing the embryo to hatch. Using an assay that measures 125I-fertilization envelope degradation, the hatching enzyme was identified as a 33 kDa metalloprotease, and was purified by ion-exchange and affinity chromatography from the hatching media of Strongylocentrotus purpuratus embryos. The hatching enzyme showed a substrate preference for only a minor subset of fertilization envelope proteins

  6. Aggregation of sea urchin phagocytes is augmented in vitro by lipopolysaccharide.

    Majeske, Audrey J; Bayne, Christopher J; Smith, L Courtney

    2013-01-01

    Development of protocols and media for culturing immune cells from marine invertebrates has not kept pace with advancements in mammalian immune cell culture, the latter having been driven by the need to understand the causes of and develop therapies for human and animal diseases. However, expansion of the aquaculture industry and the diseases that threaten these systems creates the need to develop cell and tissue culture methods for marine invertebrates. Such methods will enable us to better understand the causes of disease outbreaks and to develop means to avoid and remedy epidemics. We report a method for the short-term culture of phagocytes from the purple sea urchin, Strongylocentrotus purpuratus, by modifying an approach previously used to culture cells from another sea urchin species. The viability of cultured phagocytes from the purple sea urchin decreases from 91.6% to 57% over six days and phagocyte morphology changes from single cells to aggregates leading to the formation of syncytia-like structures. This process is accelerated in the presence of lipopolysaccharide suggesting that phagocytes are capable of detecting this molecular pattern in culture conditions. Sea urchin immune response proteins, called Sp185/333, are expressed on the surface of a subset of phagocytes and have been associated with syncytia-like structures. We evaluated their expression in cultured phagocytes to determine their possible role in cell aggregation and in the formation of syncytia-like structures. Between 0 and 3 hr, syncytia-like structures were observed in cultures when only ~10% of the cells were positive for Sp185/333 proteins. At 24 hr, ~90% of the nuclei were Sp185/333-positive when all of the phagocytes had aggregated into syncytia-like structures. Consequently, we conclude that the Sp185/333 proteins do not have a major role in initiating the aggregation of cultured phagocytes, however the Sp185/333 proteins are associated with the clustered nuclei within the

  7. Phylogeny of Echinoderm Hemoglobins.

    Ana B Christensen

    Full Text Available Recent genomic information has revealed that neuroglobin and cytoglobin are the two principal lineages of vertebrate hemoglobins, with the latter encompassing the familiar myoglobin and α-globin/β-globin tetramer hemoglobin, and several minor groups. In contrast, very little is known about hemoglobins in echinoderms, a phylum of exclusively marine organisms closely related to vertebrates, beyond the presence of coelomic hemoglobins in sea cucumbers and brittle stars. We identified about 50 hemoglobins in sea urchin, starfish and sea cucumber genomes and transcriptomes, and used Bayesian inference to carry out a molecular phylogenetic analysis of their relationship to vertebrate sequences, specifically, to assess the hypothesis that the neuroglobin and cytoglobin lineages are also present in echinoderms.The genome of the sea urchin Strongylocentrotus purpuratus encodes several hemoglobins, including a unique chimeric 14-domain globin, 2 androglobin isoforms and a unique single androglobin domain protein. Other strongylocentrotid genomes appear to have similar repertoires of globin genes. We carried out molecular phylogenetic analyses of 52 hemoglobins identified in sea urchin, brittle star and sea cucumber genomes and transcriptomes, using different multiple sequence alignment methods coupled with Bayesian and maximum likelihood approaches. The results demonstrate that there are two major globin lineages in echinoderms, which are related to the vertebrate neuroglobin and cytoglobin lineages. Furthermore, the brittle star and sea cucumber coelomic hemoglobins appear to have evolved independently from the cytoglobin lineage, similar to the evolution of erythroid oxygen binding globins in cyclostomes and vertebrates.The presence of echinoderm globins related to the vertebrate neuroglobin and cytoglobin lineages suggests that the split between neuroglobins and cytoglobins occurred in the deuterostome ancestor shared by echinoderms and vertebrates.

  8. Unique system of photoreceptors in sea urchin tube feet

    Ullrich-Lüter, Esther M; Dupont, Sam; Arboleda, Enrique; Hausen, Harald; Arnone, Maria Ina

    2011-01-01

    Different sea urchin species show a vast variety of responses to variations in light intensity; however, despite this behavioral evidence for photosensitivity, light sensing in these animals has remained an enigma. Genome information of the recently sequenced purple sea urchin (Strongylocentrotus purpuratus) allowed us to address this question from a previously unexplored molecular perspective by localizing expression of the rhabdomeric opsin Sp-opsin4 and Sp-pax6, two genes essential for photoreceptor function and development, respectively. Using a specifically designed antibody against Sp-Opsin4 and in situ hybridization for both genes, we detected expression in two distinct groups of photoreceptor cells (PRCs) located in the animal's numerous tube feet. Specific reactivity of the Sp-Opsin4 antibody with sea star optic cushions, which regulate phototaxis, suggests a similar visual function in sea urchins. Ultrastructural characterization of the sea urchin PRCs revealed them to be of a microvillar receptor type. Our data suggest that echinoderms, in contrast to chordates, deploy a microvillar, r-opsin–expressing PRC type for vision, a feature that has been so far documented only in protostome animals. Surprisingly, sea urchin PRCs lack any associated screening pigment. Indeed, one of the tube foot PRC clusters may account for directional vision by being shaded through the opaque calcite skeleton. The PRC axons connect to the animal internal nervous system, suggesting an integrative function beyond local short circuits. Because juveniles display no phototaxis until skeleton completion, we suggest a model in which the entire sea urchin, deploying its skeleton as PRC screening device, functions as a huge compound eye. PMID:21536888

  9. Distribution and evolution of the serine/aspartate racemase family in invertebrates.

    Uda, Kouji; Abe, Keita; Dehara, Yoko; Mizobata, Kiriko; Sogawa, Natsumi; Akagi, Yuki; Saigan, Mai; Radkov, Atanas D; Moe, Luke A

    2016-02-01

    Free D-amino acids have been found in various invertebrate phyla, while amino acid racemase genes have been identified in few species. The purpose of this study is to elucidate the distribution, function, and evolution of amino acid racemases in invertebrate animals. We searched the GenBank databases, and found 11 homologous serine racemase genes from eight species in eight different invertebrate phyla. The cloned genes were identified based on their maximum activity as Acropora millepora (Cnidaria) serine racemase (SerR) and aspartate racemase (AspR), Caenorhabditis elegans (Nematoda) SerR, Capitella teleta (Annelida) SerR, Crassostrea gigas (Mollusca) SerR and AspR, Dugesia japonica (Platyhelminthes) SerR, Milnesium tardigradum (Tardigrada) SerR, Penaeus monodon (Arthropoda) SerR and AspR and Strongylocentrotus purpuratus (Echinodermata) AspR. We found that Acropora, Aplysia, Capitella, Crassostrea and Penaeus had two amino acid racemase paralogous genes and these paralogous genes have evolved independently by gene duplication at their recent ancestral species. The transcriptome analyses using available SRA data and enzyme kinetic data suggested that these paralogous genes are expressed in different tissues and have different functions in vivo. Phylogenetic analyses clearly indicated that animal SerR and AspR are not separated by their particular racemase functions and form a serine/aspartate racemase family cluster. Our results revealed that SerR and AspR are more widely distributed among invertebrates than previously known. Moreover, we propose that the triple serine loop motif at amino acid positions 150-152 may be responsible for the large aspartate racemase activity and the AspR evolution from SerR. PMID:26352274

  10. Cis-regulatory control of the nuclear receptor Coup-TF gene in the sea urchin Paracentrotus lividus embryo.

    Lamprini G Kalampoki

    Full Text Available Coup-TF, an orphan member of the nuclear receptor super family, has a fundamental role in the development of metazoan embryos. The study of the gene's regulatory circuit in the sea urchin embryo will facilitate the placement of this transcription factor in the well-studied embryonic Gene Regulatory Network (GRN. The Paracentrotus lividus Coup-TF gene (PlCoup-TF is expressed throughout embryonic development preferentially in the oral ectoderm of the gastrula and the ciliary band of the pluteus stage. Two overlapping λ genomic clones, containing three exons and upstream sequences of PlCoup-TF, were isolated from a genomic library. The transcription initiation site was determined and 5' deletions and individual segments of a 1930 bp upstream region were placed ahead of a GFP reporter cassette and injected into fertilized P.lividus eggs. Module a (-532 to -232, was necessary and sufficient to confer ciliary band expression to the reporter. Comparison of P.lividus and Strongylocentrotus purpuratus upstream Coup-TF sequences, revealed considerable conservation, but none within module a. 5' and internal deletions into module a, defined a smaller region that confers ciliary band specific expression. Putative regulatory cis-acting elements (RE1, RE2 and RE3 within module a, were specifically bound by proteins in sea urchin embryonic nuclear extracts. Site-specific mutagenesis of these elements resulted in loss of reporter activity (RE1 or ectopic expression (RE2, RE3. It is proposed that sea urchin transcription factors, which bind these three regulatory sites, are necessary for spatial and quantitative regulation of the PlCoup-TF gene at pluteus stage sea urchin embryos. These findings lead to the future identification of these factors and to the hierarchical positioning of PlCoup-TF within the embryonic GRN.

  11. In-depth, high-accuracy proteomics of sea urchin tooth organic matrix

    Mann Matthias

    2008-12-01

    Full Text Available Abstract Background The organic matrix contained in biominerals plays an important role in regulating mineralization and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin tooth, which is an important model for developmental biology and biomineralization, only few matrix components have been identified. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of genes potentially coding for matrix proteins, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy proteomic analysis. Results We identified 138 proteins in the matrix of tooth powder. Only 56 of these proteins were previously identified in the matrices of test (shell and spine. Among the novel components was an interesting group of five proteins containing alanine- and proline-rich neutral or basic motifs separated by acidic glycine-rich motifs. In addition, four of the five proteins contained either one or two predicted Kazal protease inhibitor domains. The major components of tooth matrix were however largely identical to the set of spicule matrix proteins and MSP130-related proteins identified in test (shell and spine matrix. Comparison of the matrices of crushed teeth to intact teeth revealed a marked dilution of known intracrystalline matrix proteins and a concomitant increase in some intracellular proteins. Conclusion This report presents the most comprehensive list of sea urchin tooth matrix proteins available at present. The complex mixture of proteins identified may reflect many different aspects of the mineralization process. A comparison between intact tooth matrix, presumably containing odontoblast remnants, and crushed tooth matrix served to differentiate between matrix components and possible contributions of cellular remnants. Because LC-MS/MS-based methods directly

  12. Beyond BLASTing: tertiary and quaternary structure analysis helps identify major vault proteins.

    Daly, Toni K; Sutherland-Smith, Andrew J; Penny, David

    2013-01-01

    We examine the advantages of going beyond sequence similarity and use both protein three-dimensional (3D) structure prediction and then quaternary structure (docking) of inferred 3D structures to help evaluate whether comparable sequences can fold into homologous structures with sufficient lateral associations for quaternary structure formation. Our test case is the major vault protein (MVP) that oligomerizes in multiple copies to form barrel-like vault particles and is relatively widespread among eukaryotes. We used the iterative threading assembly refinement server (I-TASSER) to predict whether putative MVP sequences identified by BLASTp and PSI Basic Local Alignment Search Tool are structurally similar to the experimentally determined rodent MVP tertiary structures. Then two identical predicted quaternary structures from I-TASSER are analyzed by RosettaDock to test whether a pair-wise association occurs, and hence whether the oligomeric vault complex is likely to form for a given MVP sequence. Positive controls for the method are the experimentally determined rat (Rattus norvegicus) vault X-ray crystal structure and the purple sea urchin (Strongylocentrotus purpuratus) MVP sequence that forms experimentally observed vaults. These and two kinetoplast MVP structural homologs were predicted with high confidence value, and RosettaDock predicted that these MVP sequences would dock laterally and therefore could form oligomeric vaults. As the negative control, I-TASSER did not predict an MVP-like structure from a randomized rat MVP sequence, even when constrained to the rat MVP crystal structure (PDB:2ZUO), thus further validating the method. The protocol identified six putative homologous MVP sequences in the heterobolosean Naegleria gruberi within the excavate kingdom. Two of these sequences are predicted to be structurally similar to rat MVP, despite being in excess of 300 residues shorter. The method can be used generally to help test predictions of homology via

  13. Sea urchin vault structure, composition, and differential localization during development

    Dickey-Sims Carrie

    2005-02-01

    Full Text Available Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Results The sequence of the sea urchin major vault protein (MVP was assembled from expressed sequence tags and genome traces, and the predicted protein was found to have 64% identity and 81% similarity to rat MVP. Sea urchin MVP includes seven ~50 residue repeats in the N-terminal half of the protein and a predicted coiled coil domain in the C-terminus, as does rat MVP. A cryoelectron microscopy (cryoEM reconstruction of isolated sea urchin vaults reveals the assembly to have a barrel-shaped external structure that is nearly identical to the rat vault structure. Analysis of the molecular composition of the sea urchin vault indicates that it contains components that may be homologs of the mammalian vault RNA component (vRNA and protein components (VPARP and TEP1. The sea urchin vault appears to have additional protein components in the molecular weight range of 14–55 kDa that might correspond to molecular contents. Confocal experiments indicate a dramatic relocalization of MVP from the cytoplasm to the nucleus during sea urchin embryogenesis. Conclusions These results are suggestive of a role for the vault in delivering macromolecules to the nucleus during development.

  14. Estratigrafía y paleoambientes de la Formación Los Llanos (La Rioja: una secuencia condensada Miocena en el antepaís fragmentado andino central

    M. Ezpeleta

    2006-06-01

    Full Text Available En la región central de las Sierras Pampeanas, un conjunto de afloramientos saltuarios conocidos como Formación Los Llanos, se disponen irregularmente a través de las sierras Brava, Los Llanos y Ulapes-Las Minas, formando parte de la cubierta cenozoica. Esta sucesión sedimentaria está dominantemente compuesta por niveles de calcretes y depósitos fluvio-eólicos, y su espesor raramente supera los ~40 m. Desde su definición, existen escasos trabajos de detalle sobre su estratigrafía desde una óptica moderna. El mapeo y análisis detallado de facies permitieron dividir a la unidad en miembros inferior y superior, y caracterizar sus paleoambientes sedimentarios. Para el conjunto se definieron ocho facies: 1 conglomerados clastos soportados, 2 brechas y microbrechas, 3 areniscas con megaestratificación cruzada, 4 conglomerados arenosos calcáreos fuertemente cementados, 5 areniscas y arcilitas con estructura columnar, 6 areniscas conglomerádicas con cemento silícico, 7 limo-arcilitas pardo-rojizas, y 8 brechas fangosas. Estas facies fueron agrupadas en las asociaciones de facies (I fluvio-eólica y (II aluviales con paleosuelos, que parcialmente coinciden con los miembros reconocidos. El conjunto permite deducir un paleoambiente de abanicos aluviales medios a distales periódicamente afectados por formación de paleosuelos. Estos últimos reflejan sectores distales con escasa influencia de relieve indicativos de episodios de condensación. Debido a los escasos registros paleontológicos con procedencia documentada, y hasta tanto se tengan edades geocronológicas precisas, nuestras interpretaciones paleoclimáticas permitirían realizar una correlación con los eventos climáticos del Mioceno Medio- Plioceno ampliamente difundidos en el antepaís andino, que habrían afectado a los depósitos sinorogénicos desarrollados en una zona de domamiento periférico.

  15. Cambios en las representaciones sociales e identidades genéricas de mujeres profesionales Changes in social representations of women and gender identities professionals

    Luciana Manni

    2010-12-01

    Full Text Available Los grandes cambios producidos en el mercado de trabajo, el aumento de la actividad económica de las mujeres en un abanico de ocupaciones cada vez más extenso, junto con una mayor profesionalización por parte de las mismas, han generado una atención particular hacia las mujeres profesionales, el desempeño de actividades cada vez más intensivas y la necesidad de conciliación con los roles tradicionalmente adjudicados a los géneros. Sin embargo, aún la mujer que debido a su trabajo, logra independizarse económicamente del hombre, no se encuentra por ello en una condición social, cultural y psicológica, igual a la de aquel. La forma en que aborde su profesión y la entrega que tenga hacia su trabajo dependerán del contexto de su vida. Este estudio intenta en parte visibilizar una dimensión poco abordada como lo es la percepción que las mujeres -un grupo específico, en este caso, de mujeres profesionales-tienen de su propia inserción laboral en la realidad social a la que pertenecen.The great changes in the labor market, increasing economic activity of women in a range of occupations increasingly extensive, with greater professionalism on the part of them, have generated particular attention to women professionals, the performance of increasingly intensive activities and the need for reconciliation with the roles traditionally awarded to the genera. However, even the woman because of her work, succeeds economically independent of man, is not so in a social, cultural and psychological equal of that. The way that addresses their profession and the delivery that has to work depend on the context of his life. This study attempts to partly visible dimensions addressed soon as it is the perception that women-specific group, in this case, professional women-have their own job possibilities in social reality to which they belong.

  16. Combined assessment of the environmental, economic and social impacts of structural solutions for residential construction

    Fraile-García, E.

    2015-09-01

    Full Text Available Sustainable development in construction is based on three fundamental pillars: economic, environmental and social. This type of approach aims to identify the best possible solutions for sustainably developing structures by conducting a joint evaluation of the impact on those three pillars. The proposed methodology incorporates metadata on the Spanish construction sector. First, a discrete database is generated with 360 alternatives covering a range of common solutions in residential building. A Pareto algorithm is utilized to select the optimal choices and the wide range of solutions is reduced to the 5 % of the initial group. The project manager is therefore provided with an objective assessment of suitable structural alternatives including the overall joint economic, social, and environmental impact. The results obtained demonstrate the importance and utility of the proposed methodology for sustainable construction.El desarrollo sostenible aplicado a la construcción se basa en tres pilares fundamentales: económico, medioambiental y social. El objetivo principal es identificar las mejores soluciones en términos de desarrollo sostenible de alternativas estructurales a partir de la evaluación conjunta de los impactos en dichos pilares. La metodología propuesta incorpora metadatos con información del sector de la construcción en España. Primero se genera una base de datos discreta de 360 alternativas estructurales que cubren el rango de soluciones habituales en edificación residencial. La selección de alternativas óptimas se realiza mediante el algoritmo de Pareto. El abanico de soluciones se reduce al 5 % de las iniciales. Se aporta una valoración objetiva que orienta al proyectista en la selección de alternativas estructurales idóneas, visualizando de forma conjunta el impacto económico, social y ambiental. Los resultados obtenidos muestran la importancia y utilidad de la metodología propuesta en el campo de la construcci

  17. Alergia al látex: Manifestaciones clínicas en la población general y reactividad cruzada con alimentos Latex allergy: Clinical manifestations in the general population and reactivity crossed with foodstuffs

    M. Anda

    2003-01-01

    Full Text Available La alergia al látex en los últimos años ha adquirido una gran importancia médica, no sólo para el personal sanitario sino también, aunque en menor medida, para la población general, debido a su ubicuidad. Son múltiples los objetos que manejamos en nuestra vida cotidiana que están fabricados con látex, y que por tanto pueden suponer un riesgo para los pacientes alérgicos a este material. Además del personal sanitario, existe otro subgrupo de pacientes en los que la alergia al látex tiene una mayor incidencia que en la población general; se trata de los pacientes multintervenidos, y especialmente los niños con espina bífida y mielomeningocele. Las manifestaciones clínicas de alergia al látex, abarcan un amplio abanico: dermatitis de contacto, urticaria, angioedema, rinoconjuntivitis, asma y en ocasiones anafilaxia, dependiendo la presencia de una u otra clínica de la vía de contacto con el látex y también del tiempo de exposición al mismo. Además como ocurre con otros aeroalergenos, existen múltiples reactividades cruzadas con alimentos, por lo que los pacientes alérgicos al látex en muchas ocasiones asocian alergias alimentarias que se deben diagnosticar, ya que su desconocimiento puede suponer un riesgo añadido para el paciente.Because of widespread latex manufacturing in the last decades, latex allergy has become an important clinical problem, not only in high-risk groups (health-workers but also among the general population. Latex is used to produce a large variety of natural rubber products (medical equipment, household gloves, condoms, balls and balloons,footwear, baby pacifiers… employed in the ordinary life, with high risk for patients allergic to latex. Among general population, children affected by myelomeningocele or spina bifida, have a higher risk to develop latex allergy. Clinical manifestations range from local reactions(contact dermatitis, urticaria, rhino-conjunctivitis, asthma, pharyngeal edema to

  18. La actuación pública para el fomento de nuevas empresas: Hacia un enfoque de política económica

    Agustín Villanueva Pazos

    2002-07-01

    Full Text Available Desde aproximadamente la última parte del siglo XX hasta la actualidad, y como consecuencia del reconocimiento científico y socio-económico de la importancia de las PYME´s en las economías modernas, se ha retomado con intensidad la investigación en el campo del empresario y las nuevas empresas. Del mismo modo, este renovado interés ha dado lugar a continuas y novedosas intervenciones desde la posición del responsable en materia de política económica, algo que ha desembocado en un amplio abanico de actuaciones diferenciadas y un creciente número de organismos implicados. A lo largo de este trabajo abordaremos la tarea de analizar el perfil de las distintas actuaciones y la potencial existencia de una política económica específica de creación de empresas, tras lo que trataremos de establecer, en su caso, una posible estructura de la misma. Para alcanzar sendos propósitos intentaremos: a presentar el perfil de las actuaciones públicas para el fomento de nuevas empresas; b revisar las líneas generales de los diferentes programas puestos a disposición de los potenciales emprendedores, señalando su vinculación a las fases del proceso de creación de las empresas y los factores determinantes del proceso emprendedor en los que tiende a concentrarse la actuación pública; c analizar el papel de policy maker en el moderno enfoque de las políticas de PYME´s y, por ende, en las actuaciones para el fomento de nuevas empresas; d establecer los principales objetivos de actuación, presentar alguna pauta de ordenamiento de las distintas intervenciones, y los mayores obstáculos a la implementación de las intervenciones para la promoción de la "vitalidad empresarial"; e para finalizar realizaremos algunas reflexiones sobre la evaluación de los resultados derivados de la implementación de las políticas públicas previamente aludidas, presentaremos las conclusiones clave y reconoceremos aquellos apartados donde sea necesario

  19. REVISTA INTERNACIONAL DE RELACIONES PÚBLICLa gestión cultural y del ocio como estrategia de relación con los públicos / Cultural and entertainment management as a strategy of public relation

    Mónica Viñarás Abad

    2013-12-01

    Full Text Available La cultura y el ocio son en la actualidad una de las herramientas de participación y relación entre las organizaciones y la sociedad que mayor desarrollo viven. Las empresas saben que formar parte de los momentos de disfrute y entretenimiento de los públicos con los que se relacionan es una manera eficaz de participar y mejorar el vínculo con ellos. Las formas y técnicas que existen para fomentar y formar parte de esta oferta es muy variada, desde las acciones de patrocinio hasta nuevas estrategias basadas en la Responsabilidad Social Corporativa (RSC. Entre ambas, cabe todo un abanico de opciones para interactuar con lospúblicos a través de la cultura, pero no todas igual de eficaces. Este trabajo, tras elaborar un marco teórico sobre estas disciplinas, propone un modelo para poder determinar la eficacia de estas iniciativas, basado en dos criterios: el grado de gestión y el nivel de vinculación de la empresa con la acción cultural. Estos criterios permiten dar un valor cuantitativo a la eficacia de estas acciones basándose en la participación que generan. / Nowadays culture and entertainment has become one of the tools of participation and relation between an organizations and stakeholders that have reached a top development. Companies know that to be part of the moments of joy and entertainment of their publics is an effective way of engagement and improving the link between them. The ways and technologies that exist to promote a company and to be part of this offer is very plural, it goes from actions of sponsorship to new strategies based on the corporate social responsibility (RSC. Between both, there is a whole range of options to interact with the public using cultural initiatives, but not all of them have the same level of effectiveness. After building a theoretical frame on these disciplines, this paper suggests a model able to determine the efficiency of these initiatives, based on two criteria: the nature of the

  20. El valor de la Red en la reunificación: ciencia y comunicación

    Dra. Rocío Jiménez Ramón

    2002-01-01

    Full Text Available Gracias a la Red se democratiza el acceso a la información. Cada periodista se apoya en varios proyectos en busca del pull de los mejores. El acceso a las galeradas telemáticas de los científicos es actualmente una realidad; periódicos como El País, por ejemplo, recurre a las galeradas telemáticas de los científicos de la Universidad de Los Álamos (EEUU. Las galeradas telemáticas son documentos que se colocan en el servidor remoto para consulta por sus autores a modo de pruebas de imprenta, sin conexión al cuerpo del sitio web, como páginas flotantes en la web (José Manuel de Pablos: 2001b, 264 y que en el caso de la información científica da a los periodistas un amplio abanico de posibilidades para seleccionar las noticias más adecuadas según lo que se necesite transmitir en ese momento. Otro recurso es la posibilidad de suscripción de los periodistas a Iris, para pertenecer a listas de correo electrónico con los últimos avances en el campo de la ciencia y la tecnología, a estas listas hasta hace poco sólo tenían acceso los científicos. Abstract Thanks to the Net the access to the information is democratized. Every journalist rests on several projects in search of the pull of the best. The access to the telematic galleys of the scientists is nowadays a reality, newspapers since as El País newspaper ,for example, it resorts to the telematic galleys of the scientists of the University of Los Alamos (USA . The telematic galleys are documents that they place in the remote servant for consultation for its authors like tests of press, without connection to the body of the web site, as floating pages in the web (J. Pablos: 2002; 264 and that in case of the scientific information gives a wide fan of possibilities to the journalists to select the most suitable news according to what it is necessary to transmit in this moment. Another resource is the possibility of subscription to Iris of the journalists to belong to lists of e

  1. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia Morphotectonic modeling of the Ibagué strike-slip fault, Colombia

    H. Diederix

    2006-12-01

    Full Text Available La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La falla, vista en sensores remotos o desde el aire, aparenta ser una sola traza continua, pero una inspección más detallada revela que la misma está constituida por cizallas Riedel sintéticas dextrales conectadas por lomos de presión de dimensiones variables. Un levantamiento fotogeológico seguido por una inspección de campo permitió ubicar un sitio idóneo para la excavación de una trinchera paleosismológica situada sobre una pequeña cuenca de tracción no intervenida por el hombre. El levantamiento preliminar del afloramiento creado en la trinchera indicó un registro de ocho eventos sísmicos durante el Holoceno.The Ibagué Fault is a dextral strike-slip fault which runs in an ENE direction. It is by far the most notable feature of a transverse shear zone, which affects the Central Cordillera of the Colombian Andes. The fault, on leaving the east flank of the Cordillera, crosses an extensive alluvial plain of largely Pleistocene age, known as the Ibagué Fan. It is along this stretch across the plain that the fault displays abundant morphologic features characteristic of strike-slip movement. The fault, as seen in remote sensing imagery and on aerial photos, appears as one continuous trace, but closer inspection reveals that in fact it is in most places made up of sequences of synthetic dextral Riedel shears connected by pressure ridges varying greatly in size. A photogeologic survey followed by fieldwork permitted the selection of a suitable

  2. Distribución y diversidad de hábitats en el humedal de la Reserva Natural Presidente Sarmiento, San Juan, Argentina Distribution and habitats diversity on the wetland of President Sarmiento Natural Reserve, San Juan, Argentina

    Daniel Germán Flores

    2012-03-01

    Full Text Available En el Área Natural Protegida Presidente Sarmiento (APN, ubicada en la depresión intermontaña del valle de Zonda, región del centro-oeste de Argentina, se cartografiaron los factores relieve, consistencia y estado de humedad de los suelos y vegetación, con el fin de contribuir al manejo del humedal. Éste se ubica en la porción distal de un extenso abanico aluvial, en coincidencia con la zona de descarga de agua. Se efectuó un análisis multidisciplinar para establecer relaciones entre la diversidad de hábitats y relieves, la vegetación y los suelos. Se identificaron y clasificaron genéticamente 10 ambientes regionales en la cuenca, donde el ANP ocupa 2 de estos 10 ambientes. A escala local, con fotos aéreas y trabajo de campo, se identificaron 7 sitios con sus variaciones en consistencia de suelos y vegetación. Se clasificaron 37 especies agrupadas en 18 familias. Las Fabaceae y Asteraceae son predominantes. En la reserva, el tamarindo (Tamarix gallica resultó ser la especie exótica más adaptable; invade y desplaza a las especies nativas. La metodología de trabajo resultó ser muy útil, comenzando desde lo regional hasta el análisis del relieve local.In the Natural Area Protected President Sarmiento (APN, situated in an intermountain depression of an arid region of the Zonda valley, a multidisciplinary analysis was performed, to stablish a relationship between habitat diversity, relief, soils and vegetation. This wetland, Provincial Park Reserve President Sarmiento, is lies in a desertic area of central-western part of Argentina. Ten regional environment units within the basin, and 7 sites within the Park were identified and classified. The sites are located in the distal part of an extensive alluvial fan. The survey of the vegetation identified a total of 37 plant species grouped into 18 families. The Fabaceae and Asteraceae are dominants. The tamarindo (Tamarix gallica was the exotic flora most adaptable to this environment

  3. Al Este del Cerro Pampa: ampliación del área de disponibilidad de obsidiana de la Pampa del Asador (Provincia de Santa Cruz East of the Cerro Pampa: enlargement of the obsidian availability area from Pampa del Asador (Santa Cruz Province

    Juan Bautista Belardi

    2006-12-01

    Full Text Available La Pampa del Asador ha sido identificada como el lugar de proveniencia de distintos tipos de obsidiana, mayoritariamente negra, y el Cerro Pampa, ubicado en el extremo suroeste de la pampa, ha sido un punto central a partir del cual se ha medido la dispersión de los artefactos confeccionados en esta materia prima. Sobre la base de la interpretación de imágenes satelitales, análisis químicos y trabajos de campo se presenta y discute la evidencia provista por nódulos y artefactos de obsidiana recuperados en paleocauces y un abanico aluvial que se origina en la Pampa del Asador. Los resultados muestran la ampliación del área de disponibilidad de obsidiana 65 km hacia el este y 75 km al noreste del Cerro Pampa y, aunque presentando menor frecuencia relativa de nódulos y el decrecimiento de sus tamaños, el área se amplía a lo largo de la Pampa La Chispa. Estos resultados tienen implicaciones tanto en términos de la distribución de frecuencias de artefactos de obsidiana en el registro arqueológico regional como en los costos de aprovisionamiento de la roca.Pampa del Asador has been identified as the source of distinct types of obsidian (generally black, and Cerro Pampa, located in the extreme southwest of the Pampas, has been the central point from which the dispersal of artifacts fashioned from this obsidian has been measured. Based on the interpretation of satellite images, geochemical analysis, and field work, we present and discuss evidence provided by nodules and artifacts of obsidian recovered from paleo-drainage channels and an alluvial fan which originates in Pampa del Asador. The results expand the area of availability of obsidian 65 km east and 75 km northeast of Cerro Pampa, and also across Pampa La Chispa, although the relative frequency of nodules decreases and smaller size increases. These results have implications both in terms of the distribution and frequency of obsidian artifacts in the regional archaeological record

  4. Interpretación paleoambiental de los depósitos de la Formación Saldeño (Cretácico superior, en la alta Cordillera de Mendoza, Argentina Paleoenvironmental interpretation of the deposits of the Saldeño Formation (Upper Cretaceous in the High Cordillera of Mendoza (Argentina

    MA Tunik

    2003-09-01

    Full Text Available La Formación Saldeño aflora en la Alta Cordillera de Mendoza, en una franja de continuidad meridianal, desde las estribaciones del Mesón de San Juan (33° 33´ LS hasta el área de la Laguna del Diamante (34° 06´ LS. Esta unidad está compuesta por 250 metros de pelitas, areniscas, conglomerados y calizas y puede ser dividida en tres secciones. La sección inferior está integrada por conglomerados, sabulitas y areniscas que fueron depositadas en un ambiente de abanicos aluviales. Las otras dos secciones, están integradas por pelitas, areniscas y rocas calcáreas y reflejan el desarrollo de una planicie carbonática fangosa que es reemplazada por una planicie de marea con características restringidas. La sección conglomerádica basal carece de relación genética con las otras dos y serían depósitos de borde de cuenca residuales, mientras que las secciones media y superior corresponden a depósitos relacionados con la ingresión marina maastrichtiana que alcanzó la región cordillerana proveniente desde el sudeste. En la sección marina se han identificado ciclos somerizantes y se hallaron por primera vez fósiles marinos en esta unidad. La edad de la misma es maastrichtiana obtenida a partir del hallazgo de nanofósiles calcáreos y palinoflora.The Saldeño Formation consists of up to 250 m of siltstones, sandstones, conglomerates and limestones located in almost a continuous belt from the Mesón de San Juan (33° 33´ SL up to Laguna del Diamante area (34° 06´ SL, in the high Cordillera of Mendoza. A paleoenvironmental interpretation has been made for these deposits. The lower section of the unit was deposited in an alluvial fan environment and it is not genetically related with the uppermost sections. The analyses of the middle and upper section of the unit suggested that the deposition took place in a transitional environment from a muddy distal fluvial system to a restricted shallow marine environment with intervals laid under

  5. Las trabajadoras extranjeras en la España mediterránea. La perspectiva empresarial

    Gozálvez Pérez, Vicente

    2006-12-01

    mbito territorial a 77 empresas y organismos empresariales que emplean a mujeres inmigrantes: los encuestados ofrecen un amplio abanico de opiniones sobre sus motivos para contratar extranjeras, sobre las características de estas trabajadoras o las repercusiones para el sector económico o para los empresarios, en caso de desaparecer esta mano de obra.

  6. EL PAPEL DE LAS TECNOLOGÍAS DE LA INFORMACIÓN Y LA COMUNICACIÓN EN LAS EMPRESAS DE ECONOMÍA SOCIAL/THE ROLE OF INFORMATION AND COMMUNICATION TECHNOLOGIES IN THE COMPANIES OF THE SOCIAL ECONOMY

    Ana GARGALLO CASTEL

    2009-01-01

    Full Text Available Estudios recientes sugieren que las tecnologías de la información y la comunicación (TICs y el comercio electrónico pueden ofrecer amplias oportunidades a las organizaciones, tales como facilitar la expansión del abanico de productos, la mejora del servicio al cliente, la mejor respuesta a la demanda, la mejora de las relaciones con proveedores y clientes, etc.. Las empresas que constituyen la economía social o tercer sector tampoco están exentas de estas posibilidades. Sin embargo, los trabajos existentes al respecto para las organizaciones de la economía social son escasos. El principal objetivo de este trabajo es analizar el estado de la cuestión para el caso español, presentando información sobre las características diferenciadoras de las empresas de economía social frente al resto, en cuanto a su eficiencia y al uso de este tipo de tecnologías. Los resultados ofrecen información sobre los aspectos a tener en cuenta para conseguir que las empresas de la economía social aprovechen también las oportunidades brindadas por las nuevas tecnologías. Las principales conclusiones del trabajo resultan útiles tanto para los gestores de estas organizaciones, como para los responsables de las políticas públicas relacionadas con la fomento y promoción de la economía social. /Recent studies suggest that information and communication technologies (ICT and the electronic commerce can offer wide opportunities to organizations, such as facilitating the expansion of the range of products, the improvement of the service to the client, the best response to the demand, the improvement of the relations with suppliers and clients, etc. Firms of the social economy or the third sector are not exempt from these technologies. However, papers in the field of organizations of the social economy are scanty. The main aim of this article is to analyse the state of the art for the Spanish case, presenting information about the own characteristics of the

  7. Darwin y la religión

    Carlos Alvarado de Piérola

    2011-05-01

    Full Text Available Desde que hiciera su aparición El origen de las especies y empezara adifundirse la teoría darwinista de la evolución, ésta suscitó las más encendidaspolémicas. Desde diversos sectores, partieron en mayor o en menorgrado ataques muy duros, algunos de los cuales no carecían de un sólidofundamento. Pero los golpes más violentos llegaron desde el terreno dela religión, que se sintió particularmente afectada. Aún hoy, cuando celebramosel bicentenario del nacimiento de Darwin, las aguas no parecenhaberse aquietado alrededor suyo. Todavía, algunos influyentes sectoresfundamentalistas siguen considerándola, inclusive en su versión actual,la teoría sintética de la evolución, como un peligro para la fe religiosa.Los ataques se producen bajo la forma de un amplio abanico de modalidades:desde un rechazo rotundo en defensa de los textos bíblicos hastauna descalificación supuestamente científica que, aparentando situarseen una perspectiva no religiosa, cuestiona los fundamentos de la teoría ypropone la doctrina del llamado diseño inteligente.A pesar de todo, debemos reconocer que, actualmente, a 150 añosde la publicación de El origen, la situación ha variado. Ya no existe la unanimidaden la condena. Hasta ha habido quien, como Teilhard de Chardin,sacerdote católico, intentó construir con ayuda del darwinismo unametafísica cristiana, aunque haciéndose merecedor de la condena de lajerarquía eclesiástica de su tiempo. Incluso el papa Juan Pablo II declaróen su momento: “Hoy en día, (... nuevos conocimientos llevan a reconoceren la teoría de la evolución más que una hipótesis”1,

  8. Arte, Diseño e Ingeniería: tres fuentes de la creación = Art, Design and engineering: three sources of creation

    José Antonio Oché

    2012-09-01

    Full Text Available Resumen Este trabajo es de acercamiento y por tanto no pretende responder al modelo de ensayo o tesis; arranca sin hipótesis previa y expresa; discurre por una serie no exhaustiva de temas relacionados con las tres disciplinas de la revista, en busca de áreas de interés sobre las que en trabajos posteriores tengan cabida ensayos de mayor profundidad. Algunos son más evidentes, como es el caso de diseño e ingeniería, o artefactos y mejora de la vida cotidiana; otros están menos relacionados tradicionalmente con el avance técnico, como la capacidad del Arte de prefigurar escenarios. Teoría como valor añadido, la evolución de la actividad del diseño, el valor de la mentalidad del ingeniero, su papel y responsabilidad moral, la conveniencia de la independencia de crítica y práctica, y la importancia de los resultados, conforman el abanico central de temas que entendemos importantes a tener en cuenta en el debate. La tercera parte toca herramientas metodológicas como creatividad y automanejo, autoconfianza, y abandono del problema equivocado con el modelo de los cuatro marcos, concluyendo con unas máximas de utilidad para el desarrollo de la carrera profesional. Palabras clave: Arte e ingeniería, diseño e ingeniería, diseño y arte. Abstract This approach is not intended to respond to an essay or thesis model, so it starts without an express prior hypothesis, and runs a non-exhaustive set of issues related to the three disciplines of the magazine, looking for areas of interest that could have a place later works. Some are more obvious, as it happens to design and engineering, or artifacts and improving everyday life; others are less traditionally associated with technical advances such as the ability to prefigure Art scenarios. The value of Theory and the evolution of design activity, the value of the mindset of the engineer, his role and moral responsibility, the independence of critical and practical, and the importance of the

  9. Normas de comunicación impresa de las marcas de textil y calzado deportivo en publicaciones de baloncesto. (Print advertising of footwear and apparel sports brands in basketball magazines.

    José Antonio Martínez García

    2012-07-01

    Full Text Available Esta investigación realiza una descripción de las diferentes formas de comunicación que han realizado las empresas de textil y calzado deportivo en las revistas de baloncesto españolas y publicaciones periódicas en los últimos 32 años (1980-2011. Para ello, se han analizado 3122 ejemplares de publicaciones, que representan más del 97,5% de los números lanzados en todos estos años, además de decenas de entrevistas personales a profesionales vinculados con las marcas y los medios de comunicación. La publicidad, las relaciones públicas y la promoción se entremezclan en un amalgama de opciones que las empresas tienen a su disposición y que, en muchos casos, suelen negociar con las publicaciones para obtener condiciones ventajosas y producir sinergias en la integración de sus decisiones de comunicación. Así, el abanico de posibilidades que esta investigación muestra para ambas partes, marcas y medios de comunicación, es sin duda, una de las principales contribuciones que este estudio aporta al mundo de la gestión y comunicación de marketing en el deporte.AbstractThis research shows in detail the different ways of communication footwear and apparel sports brands have used in basketball magazines and newspapers since 1980. To achieve this aim, 3122 issues of the available publications have been analyzed, which it is more than 97.5% of the total population. In addition several personal interviews have been carried out to executive and practitioners linked with sports brand and mass media. Therefore, this study depicts more than 50 different options brands may use to achieve communication actions, providing an unique resource regarding how brands have made advertising, publicity and promotion within these publications. These three forms of communications interact among them, providing companies multiple options to marketing managers. Within this context, deals between brands and magazines are commonly achieved in order to obtain

  10. Políticas radiofónicas de comunicación local. El caso de Catalunya

    Lic. Esteban Crespo Haro

    1998-01-01

    Full Text Available Las grandes cadenas españolas, SER, RNE, Onda Cero y COPE, dedican un porcentaje muy escaso de su programación a las necesidades comunicativas del ámbito local. Esta política de desprecio refuerza el carácter de "mero repetidor" que poseen la mayoría del amplio abanico de emisoras de reducida cobertura que conforman las cadenas citadas. Además, esta realidad coincide en Catalunya con un mal momento para las redes municipales, inmersa en un estancamiento infraestructural como programático. La evolución del sistema radiofónico español ha estado marcada por una concentración empresarial, la emisión en cadena y tal homogeneización programática. Una mayor competitividad mediática, la necesidad de una rentabilidad económica, la lucha por audiencias y la incorporación de nuevas tecnologías son buena parte de las razones que permiten entender las transformaciones antes comentadas. Las radios locales han acabado siendo repetidores de la cadena, no sólo por una cuestión de rentabilidad económica, sino porque esa idiosincrasia permite explotar una imagen corporativa útil para captar la publicidad, para los índices de audiencia y para la penetración del medio local en el territorio. Un análisis exhaustivo de la programación en desconexión de las cadenas generalistas españolas revela como los espacios locales se sitúan en las franjas horarias en las que desciende de manera muy acusada, la audiencia de radio. También se ha comprobado que la programación en desconexión es subsidiaria de la cadena y mantiene un alto grado de homogeneización. El caso de Catalunya es paradigmático, ya que el uso que se hace del catalán ha traspasado el límite puramente lingüístico para convertirse en una cuestión de identidad cultural. Sin embargo, las cadenas generalistas españolas utilizan este idioma en escasa proporción en su programación territorial. Esta circunstancia no sólo es propia de Catalunya, ya que en otras comunidades

  11. Developmental coordination disorders and its treatment in school children: An overview Los problemas evolutivos de coordinación motriz y su tratamiento en la edad escolar: estado de la cuestión

    J. A. Moreno

    2010-09-01

    Full Text Available

    It is necesary to accept the presence of children with motor coordination problems in our schools. Research in the last decade has demostrated this situation and together with the clasical expresion of clumsy, the interest of educators, physicians and psychologists for this syndrome have increased, and new expresions and considerations have emerged. The development of intervention programs with the objective of remediating this problem has manifested different approaches, rationales and theories that support them. Some of them maintain the necessity of developing the processes that underlying children’s motor behavior and the other promote to develop the specific motor skills that permit them to interact and to be competent with others, and objetcs, in the playground and the gymnasium. This review analyzes the role of these approaches and their empirical support, and emphasizes the role that physical education can have in this process of developing motor competence in the school.
    Key words: Motor Competence, developmental coordination problems, clumsiness, physical education, intervention, schoolchildren

    La presencia de escolares con dificultades y problemas evolutivos de coordinación motriz es un hecho patente y presente en numerosas investigaciones llevadas a cabo en las últimas décadas. A la clásica noción de torpeza motriz se le unen en la actualidad un conjunto de denominaciones que manifiestan el interés que por estos problemas tienen pedagogos, médicos y psicólogos. El desarrollo de procedimientos de intervención para remediar o paliar estas dificultades ha mostrado un amplio abanico de propuestas y de metodologías, unas fundamentadas en la necesidad de fortalecer los componentes procesuales del comportamiento motor de los escolares y otras centradas en desarrollar las habilidades específicas necesarias para desenvolverse de

  12. Modelos para el análisis de los negocios inclusivos: construcción mediante el estudio de casos

    Oscar D. Licandro

    2013-01-01

    Full Text Available El concepto de Negocios Inclusivos (NI con la Base de la Pirámide (BDP ha sido formulado para describir y sistematizar un conjunto de experiencias surgidas en los años 2000, orientadas a generar inclusión social mediante la creación de emprendimientos asociativos de personas pobres, incorporados a la cadena de valor de empresas. El desarrollo teórico y la investigación empírica sobre esta estrategia de inclusión económica y social son todavía incipientes. No obstante ello, el análisis de un amplio abanico de experiencias ha permitido elaborar algunas herramientas conceptuales útiles para orientar la reflexión teórica, la investigación empírica y el análisis estratégico de este tipo de negocio. Este documento tiene como objetivo presentar algunas de esas herramientas que han sido diseñadas en base al estudio de casos de NI en Uruguay. El documento parte de una revisión bibliográfica sobre el tema, que recorre los principales abordajes teóricos (Prahalad y Hammond, 2005; Austin y Chu, 2006; AVINA, 2010; Casado, 2011; Simanis et al., 2008 e investigaciones empíricas basadas en el estudio de casos (PNUD, 2008; Marquez et al., 2010. Luego, fundamenta la pertinencia del enfoque de NI como nueva estrategia para abordar el problema de la pobreza, formula una breve reseña de la evolución del concepto y culmina con la descripción de cinco herramientas conceptuales elaboradas a partir del estudio de 16 casos en Uruguay. Este estudio se realizó mediante entrevistas a distintos actores que participaron en el proceso de creación de cada uno de los emprendimientos, el análisis de documentos internos de los emprendimientos y páginas web y la revisión de artículos de prensa.

  13. Dime qué tango quieres y te diré quién eres

    María de los Angeles Montes

    2016-01-01

    Full Text Available [es] Las músicas populares representan lugares de incalculable valor para la construcción de narrativas identitarias, especialmente en el ámbito de su recepción. Escuchar tango, salsa o cuarteto cordobés es también un modo de decirle al mundo el lugar social que ocupamos o, más exactamente, en qué lugar simbólico queremos ser ubicados, en función de los valores que atribuimos a esas músicas. En el presente trabajo se analiza cómo las opciones realizadas en el ámbito de la recepción del tango por parte de los milongueros de la ciudad de Córdoba, les sirven a estos milongueros a para construir sus identidades sociales, una imagen valorada de sus propias competencias y, con ella, de sí mismos. Es, precisamente, en la puesta en valor de sus propias competencias donde podemos encontrar claves para comprender la selección del tango (y de cuáles tangos, dentro del vasto abanico de músicas populares a su disposición. Esta comunicación ofrece una lectura en clave sociodiscursiva de la recepción del tango en Córdoba, atravesada por cuestiones de clase, de identidad nacional y de género. [en] Popular music represents a place of invaluable importance when it comes to the construction of a narrative identity, particularly, in the field of its reception. Listening to tango, salsa, or the popular music of Córdoba (called “Cuarteto Cordobés is also a way of telling the world the social place we occupy or, more precisely, in which symbolic place we want to be located, depending on the values we confer to that music. In this paper, I analyze the way in which the choices made in the reception of tango by the dancers of the city of Córdoba are used by these milongueros (social tango dancers to build their social identities, an appraised image of their own competences, thus of themselves. It is in that very appraisal of their competences where we can find the key to understand their choosing tango (and which tango songs within a vast

  14. Los Entornos Virtuales de Enseñanza y Aprendizaje en la Universidad Nacional de La Plata. Una aproximación a los usos y opiniones de los estudiantes

    Cecilia Inés Nóbile

    2015-06-01

    Full Text Available En los últimos años el desarrollo de las Tecnologías de la Información y Comunicación han ofrecido un abanico de herramientas con un potencial muy importante para contribuir a la labor docente. Más allá de las posibilidades de realizar cursos y carreras de grado y posgrado a distancia, la educación tradicional, típicamente presencial, también se ha visto modificada por ello. Por tanto, este trabajo tiene como objetivo general lograr una primera aproximación a la percepción de los estudiantes de la UNLP sobre el uso de los Entornos Virtuales de Enseñanza y Aprendizaje, como contribución a la calidad educativa. El marco general del presente trabajo es el proyecto “La calidad de la educación superior. Un estudio sobre la percepción de los Estudiantes”, el cual se encuentra acreditado en el Programa de Incentivos impulsado por el Ministerio de Educación, Ciencia y Tecnología de la Nación. La metodología utilizada se corresponde con la aplicada en el mencionado proyecto siendo la información presentada aquí una parte de la relevada. Dicha metodología es de carácter descriptiva, tratándose de una investigación no experimental con un diseño transversal en la cual las fuentes de información básica utilizadas son de tipo primaria, recabada por medio de cuestionarios auto-administrados. La información aquí presentada permite plantear la necesidad de desarrollar mayores investigaciones que aborden aspectos tales como opiniones y acciones de docentes y estudiantes para dar cuenta cuál es la contribución de las Tecnologías de la Información y Comunicación a la calidad educativa y cuál es el rol que cumplen los docentes en este proceso.

  15. Estudio sedimentar10 del neogeno de la subcuenca de Alcolea de Calatrava (Ciudad Real, España

    Díez Ruiz, A.

    2002-12-01

    Full Text Available The sub-basin of «Alcolea de Calatrava~ (Ciudad Real, Spain is composed exclusively of Neogene and Quaternary deposits, the first consisting of detrital, palustrine and lacustrine materials, notably influenced by the volcanism of the region (volcanism of «Campo de Calatrava». These Neogene materials have been arranged in three informal stratigraphic units: detrital, carbonate and detrital-carbonate; which follows one another in a gradual way except the latter, limited underneath by a discontinuity related to volcanic collapses. Altogether these units represent a sedimentary succession which starts with the accumulation of alluvial fan deposits that evolve laterally and vertically to marshy sediments with more or less subaerial exposure features and finally to lacustrine sediments of small extent, which correspond to ancient ponds installed inside the depressions formed by volcanic collapses. The important mammal locality of «Las Higueruelas » is located in one of these depressions.La subcuenca de Alcolea de Calatrava (Ciudad Real, España se compone exclusivamente de depósitos neógenos y cuaternarios, consistentes los primeros en sedimentos detríticos, palustres y laguneros, marcadamente influenciados por el vulcanismo de la región (vulcanismo del Campo de Calatrava. Estos materiales neógenos se han dispuesto, merced al estudio de numerosas secciones estratigráficas, en tres unidades informales: detrítica, carbonatada y detrítica-carbonatada, que se suceden de forma gradual excepto la última, limitada en su base por una discordancia relacionada con colapsos volcánicos. En conjunto representan una sucesión sedimentaria que comienza con la formación de abanicos aluviales que evolucionan lateral y verticalmente hacia zonas pantanosas con mayor o menor exposición subaérea, cuya etapa final, compuesta por sedimentos lacustres de pequeña extensión, corresponde a antiguas lagunas instaladas en el interior de las

  16. Evolución litofacial y edad de La Formación Cañón del Colorado (Jurásico Inferior, Precordillera oriental, San Juan

    Ricardo N Martínez

    2011-03-01

    Full Text Available La Formación Cañón del Colorado aflora en el extremo sur de la sierra de Mogna, al noreste de la provincia de San Juan. Esta formación ha sido objeto de debate en cuanto a su estratigrafía y edad. En el presente trabajo, se caracterizó la Formación Cañón del Colorado en base a cinco perfiles estratigráficos (P1, P2, P3, P4, y P5 distribuidos uniformemente a lo largo de los afloramientos. El perfil estratigráfico P3, ubicado en la zona central del afloramiento, se definió como el perfil tipo de la unidad por presentar la sucesión más completa y atravesar la localidad fosilífera más rica. Se definieron tres miembros denominados de la base al techo: miembros inferior, medio y superior. Además, se identificaron las facies presentes y se definieron cuatro asociaciones de facies, denominadas: asociación de facies pelítica (AFP, psamo-pelítica (AFPP, conglomerádico-are-niscosa (AFCA y conglomerádica (AFC. La sucesión observada se caracterizó como un sistema de bajada aluvial integrado por facies finas de playa -lake (asociación de facies pelítica y psamo-pelítica con intercalaciones de la asociación de facies conglomerádica sin matriz y facies de abanico aluvial distal a medio (asociación de facies conglomerádica con matriz y conglo-merádico-areniscosa. Estas facies se distribuyen en dos secuencias depositacionales progradantes, la primera formada por la asociación de facies pelítica y la conglomerádica y la segunda, por la asociación de facies psamo-pelítica y la conglomerádico-areniscosa, posiblemente vinculadas al relleno del borde pasivo de una cuenca de rift desarrollada a lo largo del lineamiento de Pie de Palo Norte. Finalmente, mediante la correlación bioestratigráfica de los paleovertebrados presentes en el miembro medio, se le asignó edad Jurásico Inferior (Hettangiano-Toarciano a la Formación Cañón del Colorado.

  17. Influencia de la diagénesis en la mineralogía de los materiales terciarios del sector central de la depresión del Ebro (Zaragoza

    López Aguayo, F.

    1990-04-01

    Full Text Available Four profiles built of sandstones, lutites and marls, dated Upper Oligocene-Lower Miocene, and located at the southern central sector of the Ebro basin have been studied, in order to know the postdepositional changes undergone by the original deposits, and the possible use of the inherited clay minerals as paleogeographic and paleoclimatic indicators for this basin. The mineralogical study concludes that illite is the main clay mineral along randon interstratified I-Sm clay minerals. The SEM study confirms that the main process in the deposil of these materials was the inheritance. The postdepositional processes are limited to early diagenesis represented by the development of interstratified I-Sm minerals in degradative processes and by carbonatic cementation of sandstones, in which the effect oí several stages of dissolution and reprecipitation oí carbonates and crystallization oí sulfates and chlorides can be observed.Se ha seleccionado el Sector Central de la Depresión del Ebro para tratar de conocer la incidencia que la diagénesis tiene sobre la asociación mineralógica primaria, considerada fundamentalmente compuesta por minerales heredados. En este contexto, se han estudiado cuatro perfiles, desarrollados en abanicos aluviales, en los que se han analizado separadamente los niveles de areniscas y de margas lutíticas. El estudio por SEM y EDAX confirma la composición mineralógica ya conocida, así como la composición bimodal de las ilitas (moscovita y fengitas. Por otra parte, se observa que las esmectitas presentes son, más bien, interestratificados al azar ilita (fengita-esmectita (beidellita-nontronita. Este estudio confirma que la herencia es el mecanismo de depósito principal y que los procesos posteriores se limitan a una etapa de diagénesis precoz, representada por la presencia de interestratificados por degradación de ilitas y por la cementación carbonatada de las areniscas, junto con la precipitación de sulfatos y

  18. Searching Structural Control on the Evolution of the Reservoir Permeability in the Porphyry Copper-Molybdenum Rio Blanco - Los Bronces District: Structural Geology and Passive Seismic Tomography

    Comte, D.; Carrizo, D.; Vela, I.; Silva, W.

    2013-05-01

    Understand main factors that controls the crustal permeability related to giant ore deposits is a crucial goal for improving metallogenic models. Subsurface data at distrital scales, remains a key factor to reach that goal, however use of regional geophysical methodologies are still extremely expensive and poorly developed on ore exploration. We present the results associated to distrital structural analyses, combined with passive seismic tomography in a case study in Central Andes. Tectono-magmatic evolution of the Rio Blanco-Los Bronces District (Porphyry Cu-Mo Deposit) involves a complex interaction of different processes along the time which includes: Pre-Mesozoic structural inheritance, Oligo-Miocene extension, Mio-Pliocene orogenic shortening with the respective tectonic inversion associated to the uplift of the Andean western margin. Miocene volcano sedimentary units (Abanico Formation) and Pliocene syn-orogenic volcanic units form the deformed host distrital structure. These rocks are part of a trench-linked Andean deformation belt that accommodates EW shortening by NS- strike faults and NS-axes fault related folds. This structural belt controls the uplift of the western margin of the Andes by tectonic inversion of Miocene rift-type structural geometries. The reservoir structure is interpreted by the emplacement of a batholith in the core of the transfer zone between two NS-strike reverse faults, where the ore bodies are located in the center of an anticline general structure showing NW-SE mineralization trend. In turn, NE trending faults dislocate ore bodies in the transfer zone. The reservoir structure is interpreted by the emplacement of a Mio-Pliocene syntectonic batholith in the middle of a transfer zone between two NS-strike reverse faults, where the ore bodies are located in the axis of the anticlinal general structure. Passive seismic tomography results suggest a NNW-strike zone formed by fractured or/and hydrated rocks. This zone is spatially

  19. El megadeslizamiento del cerro Uritorco, ladera occidental de la Sierra chica de Córdoba

    Claudio A Carignano

    2014-03-01

    Full Text Available En el extremo norte de la Sierra Chica de Córdoba, sobre el flanco oeste del cerro Uritorco (1.949 m s.n.m., se ha identificado un megadeslizamiento (30°49'55,46"S y 64°29'50,31"O. Los materiales movilizados del frente del escarpe de la falla Sierra Chica, han cubierto parcialmente el granito de Capilla del Monte y los abanicos aluviales pleistocenos del piedemonte. El lóbulo y bloques rotados del deslizamiento conforman un alto topográfico que oficia de límite entre los valles de Punilla (al sur y de Charbonier (al noroeste. Mediante técnicas de procesamiento e interpretación de imágenes satelitales multiespectrales de media (Landsat-ETM y muy alta resolución (GeoEye-1, análisis digital del terreno a partir de modelos de elevación (SRTM y Aster-GDEM y el correspondiente control de campo, se ha delimitado y caracterizado esta megageoforma nunca antes advertida. Dada la elevada sismicidad actual e histórica de la zona y los indicios morfotectónicos que señalan como activas a las fallas Sierra Chica y Pajarillo-Copacabana-Masa, se estima que este deslizamiento posiblemente fue gatillado por un evento sísmico, acontecido en alguna de esas estructuras. Tanto el depósito del deslizamiento como su cicatriz de despegue presentan un significativo grado de erosión hídrica. Por análisis comparativos con otros deslizamientos ya datados y de características similares, situados en el escarpe occidental de las Sierras de San Luis, se le asigna una edad pleistocena medio-tardía. Por su volumen y características (2,1 x109 m³ se estableció que se trata de un megadeslizamiento único en las Sierras de Córdoba y constituye uno de los deslizamientos de mayor tamaño entre los registrados hasta el presente en Argentina.

  20. La investigación en el Área de Pintura Flamenca y Escuelas del Norte del Museo del Prado

    Vergara Sharp, Alejandro

    2006-02-01

    Full Text Available This article describes different research projects undertaken in the Area of Flemish and Northern European Painting at the Prado museum. One was devoted to the Adoration of the Magi, a painting by Rubens which has offers unusual insight into his creative personality. A second project was devoted to the study of a series of tapestries designed by Rubens, which show episodes of the life of Achilles. In this case the project was the result of a collaboration with the Boijmans Van Beuningen Museum in Rotterdam. At present, the Prado is conducting research into the art of Joachim Patinir, an landscape artist active in Antwerp in the early sixteenth century. In all three cases the Prado is responding to its responsibility to study its own collections.El Museo Nacional del Prado posee una de las colecciones de pintura flamenca de los siglos XV, XVI y XVII de mayor calidad y tamaño que existen, y también es depositario de obras de arte de gran importancia de origen alemán (entre ellas varios cuadros de Durero, holandés (Rembrandt y de otros países cuyo arte se engloba dentro del Área de Conservación de Pintura Flamenca y Escuelas del Norte del museo. Al margen de conservar estas obras y de mostrar al público el mayor número de ellas en condiciones idóneas, también dedicamos una parte importante de nuestra actividad a la investigación. La calidad superlativa de la colección del Prado nos confiere una gran responsabilidad: tenemos la obligación de ser líderes, a nivel mundial, en el estudio de las cuestiones que plantea la historia del arte respecto de los artistas y los cuadros de la colección. En las siguientes páginas se explican tres proyectos de investigación desarrollados por el Área de Pintura Flamenca recientemente, que muestran el abanico de proyectos los que trabajamos en el Prado, los criterios que nos guían a la hora de seleccionarlos, y la forma en que se desarrollan.