WorldWideScience

Sample records for abanico argopecten purpuratus

  1. Morphological alterations in cryopreserved spermatozoa of scallop Argopecten purpuratus Alteraciones morfológicas en espermatozoides criopreservados de concha de abanico Argopecten purpuratus

    Carlos Espinoza

    2010-01-01

    Full Text Available The present work identifies and quantifies the morphological alterations of scallop Argopecten purpuratus spermatozoa caused by long-term cryopreservation. Percentages of motility, fertilization and injured spermatozoa were quantified by optic microscopy and scanned electron microscopy. These parameters were evaluated in sperm without treatment (CTR, spermatozoa incubated in cryoprotective solution but not freezed (ICS and freezed-thawed spermatozoa (FTS. Spermatozoa of ICS treatment remained motile longer than those of CTR, whereas those of FTS treatment were lowest. Morphology of the spermatozoa was affected in several ways by the freeze-thawing treatment; some had their head deformed or swollen, others had their cell membrane folded or broken; acrosome reaction; anomalous positions or absence of mitochondria as well as broken, stiff or loss of lineal structure of tail. CTR and ICS treatments had higher percentages of undamaged sperm (87.7% and 79.0% respectively, while FTS samples had 14.2% of undamaged sperm. The tail was the spermatic structure most commonly injured in FTS (77.0%, the percentage of sperm with head injury was 55.1% and with acrosome reaction was 28.7%, whereas middle piece was affected in 23.9% of sperm. Percentages of fertilization were 68.3%, 67.9% and 58.2% for CTR, ICS and FTS respectively, which were not significantly different. There was a higher correlation between injuries and motility than between injuries and fertilization success. Correlation between motility and fertilization was low (0.605 and 0.668 with motility at 5 and 30 min, respectively.El presente trabajo identifica y cuantifica las alteraciones morfológicas en espermatozoides de concha de abanico A. purpuratus causadas por la criopreservación en nitrógeno líquido. Porcentajes de motilidad, fecundación de ovocitos frescos y espermatozoides lesionados (en cabeza, acrosoma, pieza media y flagelo fueron determinados bajo microscopía óptica y electr

  2. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) in laboratory condition

    Lucio Encomendero; Enrique Dupré

    2003-01-01

    Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por ...

  3. Inactivation of Vibrio cholerae O1 El Tor inoculated into Peruvian ''choro'' mussels (Aulacomya ater) and two species of clams (Argopecten purpuratus and Gari solida) using medium-dose irradiation

    The radiation decimal reduction dose (D10) for Vibrio cholerae O1 biotype El Tor inoculated through the natural feeding system into three species of bivalve mollusks from the Peruvian Pacific coast: ''choro'' mussels (Aulacome ater), ''abanico'' clams (Argopecten purpuratus), and common clams (Gari solida), was determined in vivo. The D10 value obtained in vivo was 0.14 kGy in all mollusks tested. Concurrent studies conducted to determine the potential use of irradiation to extend the microbiological shelf-life of the mollusks during post-irradiation storage at 0-1 deg. C indicated that a dose of 1.0 kGy was optimal for choro mussels and abanico clams, whereas 2.0 kGy produced the best results when treating common clams. Shelf-life extension thus achieved was 31 days for choro mussels, 16 days for abanico clams, and 21 days for common clams. Non-irradiated control samples of all mollusks spoiled after 17 days of refrigerated storage. There were no significant (p<.05) adverse effects from the application of the optimal radiation treatments on the sensory characteristics (i.e. appearance, odor, flavor, and texture) of the mollusks. Total volatile basic nitrogen (VBN) and pH values were examined for use as indexes of seafood freshness. (author)

  4. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification

    Ramajo, Laura

    2015-12-08

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.

  5. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification.

    Ramajo, Laura; Marbà, Núria; Prado, Luis; Peron, Sophie; Lardies, Marco A; Rodriguez-Navarro, Alejandro B; Vargas, Cristian A; Lagos, Nelson A; Duarte, Carlos M

    2016-06-01

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers. PMID:26644007

  6. Congelamiento de espermatozoides de Argopecten pupuratus Congelamiento de espermatozoides del ostión del norte Argopecten purpuratus mediante congelador mecánico Freezing of spermatozoa of the scallop Argopecten purpuratus using a mechanical freezing system

    Enrique Dupré

    2004-11-01

    Full Text Available El congelamiento de espermatozoides es una técnica utilizada en acuicultura que permite almacenar los excedentes que fueron obtenidos durante la época reproductiva, para utilizarlos posteriormente. El proceso de criopreservación, requiere disminuir la temperatura gradualmente y de manera controlada para minimizar los daños ocasionados por el choque osmótico o por formación de cristales de hielo, lo cual es difícil lograr en terreno donde no se dispone de un equipo automático para realizarlo. Este estudio presenta un dispositivo manual portátil que permite descender gradualmente la temperatura, permitiendo repetir en forma exacta cada uno de los protocolos cada vez que se requiera. El equipo consta de un termo Dewar para nitrógeno líquido, un sistema de poleas graduadas, una placa porta-muestras de acrílico y un termómetro para bajas temperaturas. Para verificar su eficiencia, se procedió a criopreservar trozos de la parte masculina de la gónada de Argopecten purpuratus a diferentes tasas de congelamiento (1,1; 2,2; 4,6; 6,5; 8,8; 12,9; 19,2; 32,2 y 96,5 C°min-1. Se utilizó una solución crioprotectora compuesta por leche descremada liofilizada, ME2SO y sucrosa a una tasa de descongelamiento de 573°C·min-1. La tasa óptima de congelamiento fue de 8,8° C·min-1, con la cual se obtuvo 51,3 ± 6,6% de espermatozoides móviles. El congelador mecánico mostró ser eficiente para la criopreservación de espermatozoides de A. purpuratus a diferentes tasas de congelamiento, ya que permitió regular el descenso de las muestras en los vapores de nitrógeno líquido a diferentes velocidades

  7. Artificial collection and early growth of spat of the scallop Argopecten purpuratus (Lamarck, 1819), in La Rinconada Marine Reserve, Antofagasta, Chile

    Avendaño D., Miguel; Cantillánez S., Marcela; Thouzeau, Gérard; Peña, Juan B.

    2007-01-01

    Artificial collection of early juveniles ("spat") of the scallop Argopecten purpuratus in Japanese-type collectors was evaluated between January 2001 and July 2002 in the La Rinconada Marine Reserve, Antofagasta, Chile. This area of Antofagasta Bay has in the past been noted for the retention of scallop larvae by local gyres, in which their numbers can vary between 89 and 34175 larvae m-3, producing larval sets of 400 to 15340 post-larvae (spat) per collector. The results showed no quantitati...

  8. The role of Argopecten purpuratus shells structuring the soft bottom community in shallow waters of southern Peru

    Lomovasky, Betina J.; Gamero, Patricia A.; Romero, Leonardo; Firstater, Fausto N.; Gamarra Salazar, Alex; Hidalgo, Fernando; Tarazona, Juan; Iribarne, Oscar O.

    2015-12-01

    Accumulation of Argopecten purpuratus shells often occurs after El Niño events in shallow waters of Independencia Bay (14°17‧S-76°10‧W; Pisco, Peru). Here we experimentally investigate the effects of their shell accumulation on macrobenthos assemblages in soft bottom, shallow areas of the bay. A field experiment (from May 2006 to May 2007), including four treatments with different coverage levels of empty shells of A. purpuratus, were randomly arranged in: (1) areas devoid of shells ("Empty" treatment: experimental control), (2) 50% of the plot area covered with shells haphazardly distributed over the bottom ("medium" treatment), (3) 100% of the plot area covered with shells, forming a 10 cm valve layer ("full" treatment) and (4) "natural control". We found a total of 124 taxa throughout the experiment. Polychaetes, crustaceans and mollusks were the most abundant groups in "natural controls", dominated by the gastropod Nassarius gayi and the polychaetes Prionospio peruana, Platynereis bicanaliculata and Mediomastus branchiferus. The abundance of individuals (N) and the species richness (S) were higher in the "medium" treatment, but only in one month under positive sea bottom thermal anomalies. Similarity analysis (Bray-Curtis) showed that "natural control", "empty" and "full" treatments were more similar among them than the "medium" treatment. Multidimensional analysis showed no clear species association among treatments and a higher grouping among the samplings of Jun-06, Aug-06 and Nov-06. Our results also showed that the commercial crab Romaleon polyodon and the polyplacophora Tonicia elegans were positively affected by shell accumulations ("medium" treatment), while the limpet Fissurella crassa was negatively affected. Our study shows that directly by changing habitat structure or indirectly by changing sediment characteristics, the addition of scallop shells to the soft bottom can modify the macrobenthic assemblage; however, the seasonal oceanographic

  9. Elimination of vibrio cholerae El Tor, in scallops (Argopecten purpuratus) by gamma radiation and product organoleptic evaluation

    V. cholerae D10 value in scallops (Argopecten purpuratus) was determined in vivo. D10 was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1o), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13th day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18th day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors)

  10. Temperatura superficial del mar de satélites NOAA y captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile Sea surface temperature of NOAA satellites and seeds' yield of Argopecten purpuratus in Bahía Inglesa, Chile

    Dinko Galeno D.

    1999-01-01

    Full Text Available Se analiza la relación entre la temperatura superficial del mar (TSM y los rendimientos en la captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile (27°07'S-70°54'W. La TSM del área de captación se estima a partir de datos de satélites NOAA. Se deduce un modelo de regresión exponencial que relaciona dichos rendimientos con la TSM de tres meses previos (R²=74%The relationship between the sea surface temperature (SST and seed-collection's yield of Argopecten purpuratus is analized in Bahía Inglesa, Chile (27°07'S-70°54'W. The SST of the collection area is estimated from NOAA's satellites data. An exponential regression model that relate the yield collection with the 3 months previous SST it deduced (R²=74%

  11. Comparación del crecimiento de Argopecten purpuratus entre cohortes obtenidas de captación de larvas en ambiente natural y de hatchery Comparison of growth among cohorts obtained Argopecten purpuratus larval recruitment in natural and hatchery

    Eduardo P Pérez

    2012-11-01

    Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005

  12. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae in laboratory condition

    Lucio Encomendero

    2003-01-01

    Full Text Available Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por períodos de 6, 12 y 18 días con flujo de agua filtrada a 50 mm. A cada sustrato con biofilm de diferentes edades (6, 12 y 18 días o sin él, contenidos en un recipiente con 300 mL de agua de mar filtrada, se le agregaron 200-300 larvas competentes. Después de 72 h en condiciones de laboratorio (15,3-18,6°C, se contó el número de larvas asentadas. Se determinó que el tipo de sustrato influye en la intensidad del asentamiento larval del ostión. Los mayores asentamientos se obtuvieron sobre asbesto-cemento (29,6-62,3%; seguidos por malla mosquitera (17,1-21,2% y concha de ostión (13-30%. Los niveles más bajos se obtuvieron sobre el netlón (4,3-15,2%. También se observó una relación directa entre el porcentaje de asentamiento larval y la edad del biofilm excepto en asbesto-cemento. El tipo de sustrato y la edad del biofilm mostraron un efecto sinérgico sobre la intensidad del asentamiento larvalThe effects of different types of substrate and of primary biofilm formed on them in relation to their capacity to attract settlement of competent larvae of the northern scallop Argopecten purpuratus, was studied. The hypothesis that different substrates permit the formation of different biofilm over time, which affect the intensity of scallop larval settlement on each different substrate, was tested. Substrates including Netlon @, fly screen, scallop shell, and asbestos-cement were incubated in 50 mm-filtered flowing sea water to allow formation

  13. Crecimiento y estructura demográfica de Argopecten purpuratus en la Reserva Marina La Rinconada, Antofagasta, Chile

    2005-01-01

    Full Text Available Se presentan los parámetros de crecimiento L∞ = 120.38 mm y K = 0.9668 para el banco de Argopecten purpuratus de la Reserva Marina La Rinconada (Antofagasta, Chile, obtenidos entre marzo de 2001 y mayo de 2003 usando métodos de marcaje y recaptura de ejemplares. La elevada recaptura de individuos marcados (60–80% indica baja mortalidad natural y una conducta sedentaria del recurso. Las evaluaciones anuales realizadas para estimar el tamaño del banco confirmaron tal conducta, encontrándose la mayoría de los individuos agregados en el centro, con densidades que variaron entre años de 9 a 14.8 ind m–2. La abundancia de ejemplares también mostró variabilidad interanual, con cifras de 10.1 × 106 en 2001, 8.2 × 106 en 2002 y 12.4 × 106 en 2003. Estas evaluaciones mostraron, además, una disminución en la talla media de la estructura demográfica del banco entre un año y otro, reduciéndose de 75.8 mm en 2001 a 62.1 mm en 2002 y a 51.7 mm en 2003. Esta disminución también ocurrió con el número de ejemplares mayores o iguales a la talla mínima legal (90 mm, reduciéndose de 2.6 × 106 ejemplares presentes en 2001 a 3.7 × 105 ejemplares en 2003. La aplicación de los parámetros de crecimiento sobre la estructura poblacional del banco entre 2002 y 2003 señaló la integración de una nueva clase anual de 6.5 × 106 de ejemplares en 2002 y de 11.2 × 106 de individuos en 2003. El descuento de estas cifras, del número total de ejemplares presentes en ambos años, demuestra una pérdida cercana a los 8.4 × 106 de ostiones en 2002 y de cerca de 7.0 × 106 de individuos en 2003. Estas pérdidas correspondieron a ejemplares con tallas superiores a los 60 mm, lo cual es corroborado con el análisis de la curva de captura realizado con el programa Fisat, cuyos resultados señalan una mortalidad Z = 2.15 en 2002 para el segmento de la población entre 67.5 y 115.5 mm, y Z = 3.08 en 2003 para el segmento de 64.3 a 112.5 mm. Los

  14. Molecular characterization of two ferritins of the scallop Argopecten purpuratus and gene expressions in association with early development, immune response and growth rate.

    Coba de la Peña, Teodoro; Cárcamo, Claudia B; Díaz, María I; Brokordt, Katherina B; Winkler, Federico M

    2016-08-01

    Ferritin is involved in several iron homoeostasis processes in molluscs. We characterized two ferritin homologues and their expression patterns in association with early development, growth rate and immune response in the scallop Argopecten purpuratus, a species of economic importance for Chile and Peru. Two ferritin subunits (Apfer1 and Apfer2) were cloned. Apfer1 cDNA is a 792bp clone containing a 516bp open reading frame (ORF) that corresponds to a novel ferritin subunit in A. purpuratus. Apfer2 cDNA is a 681bp clone containing a 522bp ORF that corresponds to a previously sequenced EST. A putative iron responsive element (IRE) was identified in the 5'-untranslated region of both genes. The deduced protein sequences of both cDNAs possessed the motifs and domains characteristic of functional ferritin subunits. Both genes showed differential expression patterns at tissue-specific and early development stage levels. Apfer1 expression level increased 40-fold along larval developmental stages, decreasing markedly after larval settlement. Apfer1 expression in mantle tissue was 2.8-fold higher in fast-growing than in slow-growing scallops. Apfer1 increased 8-fold in haemocytes 24h post-challenge with the bacterium Vibrio splendidus. Apfer2 expression did not differ between fast- and slow-growing scallops or in response to bacterial challenge. These results suggest that Apfer1 and Apfer2 may be involved in iron storage, larval development and shell formation. Apfer1 expression may additionally be involved in immune response against bacterial infections and also in growth; and thus would be a potential marker for immune capacity and for fast growth in A. purpuratus. PMID:27040527

  15. Evaluación en ambiente natural, del uso de biopelículas marinas en el asentamiento larval de Argopecten purpuratus (Lamarck, 1819 Evaluation in natural environment of use of marine biofilms, in the larval settlement of Argopecten purpuratus (Lamarck, 1819

    Marcela Cantillánez

    2010-01-01

    Full Text Available En una granja marina ubicada colindante con el área de reserva marina “La Rinconada” (Antofagasta, Chile, se evaluó el asentamiento larval del pectínido Argopecten purpuratus sobre colectores impregnados con películas multi-específicas, de las diatomeas Navicula sp. y Amphora sp., y de la cepa bacteriana NC1, aisladas desde colectores utilizados en captaciones comerciales de esta especie que presentaron altos índices de fijación, y que bajo condiciones controladas de criadero y laboratorio, han mostrando altos niveles de asentamiento larval. Los resultados obtenidos con el uso de estas biopelículas, sobre colectores instalados en forma paralela a los utilizados por la empresa para la captación de semilla con fines comerciales, no mostraron diferencias significativas entre los diferentes tratamientos probados y el control, respecto a las fijaciones ocurridas en un lapso de 30 días de inmersión. Se discute, debido a los tiempos que demandaron las larvas de la primera cohorte en asentarse sobre los colectores tratados, un posible reemplazo de las biopelículas utilizadas, por otra común en todos ellos y atractiva para el asentamiento de las larvas, como causa de la ausencia de efectos significativos de los tratamientos probados en el medio natural. Se recomienda la necesidad de establecer el tiempo de permanencia, en el ambiente natural, de las biopelículas impregnadas a los colectores en laboratorio.In a commercial farm located near the Marine Reserve “La Rinconada” (Antofagasta, Chile the larval settlement of Argopecten purpuratus on artificial collectors impregnated with multiespecific films of marine diatoms Navicula sp. and Amphora sp. and, bacterial strain NC1 were evaluated, These biofilms were isolates from artificial collector used in commercial activities with highest index of settlement in hatchery and laboratory conditions. The results to use this biofilms in collectors installed in same condition of commercial

  16. Molecular characterization of an inhibitor of NF-κB in the scallop Argopecten purpuratus: First insights into its role on antimicrobial peptide regulation in a mollusk.

    Oyanedel, D; Gonzalez, R; Flores-Herrera, P; Brokordt, K; Rosa, R D; Mercado, L; Schmitt, P

    2016-05-01

    Inhibitors of nuclear factor kappa B (IκBs) are major control components of the Rel/NF-κB signaling pathway, a key regulator in the modulation of the expression of immune-related genes in vertebrates and invertebrates. The activation of the Rel/NF-κB signaling pathway depends largely in the degradation of IκB proteins and thus, IκBs are a main target for the identification of genes whose expression is controlled by Rel/NF-κB pathway. In order to identify such regulation in bivalve mollusks, the cDNA sequence encoding an IκB protein was characterized in the scallop Argopecten purpuratus, ApIκB. The cDNA sequence of ApIκB is comprised of 1480 nucleotides with a 1086 bp open reading frame encoding for 362 amino acids. Bioinformatics analysis showed that ApIκB displays the conserved features of IκB proteins. The deduced amino acid sequence consists of a 39.7 kDa protein, which has an N-terminal degradation motif, six ankyrin repeats and a C-terminal phosphorylation site motif. Phylogenetic analysis revealed a high degree of identity between ApIκB and other IκBs from mollusks, but also to arthropod cactus proteins and vertebrate IκBs. Tissue expression analysis indicated that ApIκB is expressed in all examined tissues and it is upregulated in circulating hemocytes from scallops challenged with the pathogenic Gram-negative bacterium Vibrio splendidus. After inhibiting ApIκB gene expression using the RNA interference technology, the gene expression of the antimicrobial peptide big defensin was upregulated in hemocytes from non-challenged scallops. Results suggest that ApIκB may control the expression of antimicrobial effectors such as big defensin via a putative Rel/NF-κB signaling pathway. This first evidence will help to deepen the knowledge of the Rel/NF-κB conserved pathway in scallops. PMID:26993612

  17. Sobrevivencia y crecimiento de post-larvas de Argopecten purpuratus (Lamarck, 1819 en Bahía Inglesa, Chile: efectos del origen, distribución en la bahía y bacterioflora larval Postlarval survival and growth of Argopecten purpuratus (Lamarck,1819 in Bahia Inglesa, Chile: effects of origin, distribution in the bay and larval bacterioflora

    RUBÉN E. AVENDAÑO

    2001-09-01

    Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that

  18. Asociación entre la tasa de autofecundación y la frecuencia de larvas malformadas en poblaciones cultivadas del ostión del norte Argopecten purpuratus (Lamarck, 1819 Association between self-fertilization rates and the frequency of malformed larvae in farmed populations of the northern scallop Argopecten purpuratus (Lamarck, 1819

    Christopher Concha

    2011-07-01

    Full Text Available El incremento de la frecuencia de malformaciones y la reducción de la viabilidad y fecundidad suelen ser las primeras manifestaciones de la depresión por consanguinidad en animales. El ostión del norte, Argopectenpurpuratus (Lamarck, 1819, es una especie hermnafrodita funcional con autofecundación parcial y durante la reproducción artificial puede presentar altos grados de autofecundación. En este trabajo se analizó la asociación de la tasa de autofecundación con la frecuencia de larvas malformadas y la supervivencia larval. Se desovaron adultos maduros y se recogieron separadamente los gametos femeninos del 5° pulso de liberación en adelante y los masculinos. Los ovocitos fueron fecundados con espermatozoides de otro individuo, formando familias de hermanos completos. La tasa de autofecundación se verificó por la proporción de ovocitos que entra en división en una muestra de ellos sin fecundar. La tasa de autofecundación varió entre familias de 0 a 100%, con distribución de frecuencias normal. La proporción de larvas malformadas se distribuyó al azar entre las familias analizadas, pero se correlacionó negativamente, en forma moderada pero significativa, con la tasa de autofecundación y la temperatura media del cultivo. Los datos sugieren que la autofecundación en las familias de ostiones puede favorecer una mayor homeostasis del desarrollo larval.Increased frequencies of malformations and the reduction of viability and fecundity are some of the first manifestations of inbreeding depression in animals. The northern scallop, Argopecten purpuratus (Lamarck, 1819, is a functional hermaphrodite species with partial self-fertilization. During artificial reproduction, this species may present high degrees of self-fertilization. In this work, the association between the selfing rate and the frequency of larval malformations and survival were analyzed. Mature adults were spawned, and female and male gametes were collected

  19. Simulation model of the scallop (Argopecten purpuratus farming in northern Chile: some applications in the decision making process Modelo de simulación para el cultivo del ostión (Argopecten purpuratus en el norte de Chile: aplicaciones para la toma de decisiones

    Renato Molina

    2012-09-01

    Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din

  20. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819) con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819) and the survival, growth and larval development of their progenies

    Ricardo M García; Federico M Winkler

    2012-01-01

    Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo contro...

  1. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819 con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819 and the survival, growth and larval development of their progenies

    Ricardo M García

    2012-07-01

    Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the

  2. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú en junio del 2000

    Rita Cabello

    2013-06-01

    Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.

  3. Fanning the Optimal Breeze with an Abanico

    Goon, Grace; Marthelot, Joel; Reis, Pedro; MIT EGS Lab Team

    Flexible hand-held fans, or abanicos, are universally employed as cooling devices that are both portable and sustainable. Their to and fro axial motion about one's hand generates an airflow that increases the evaporation rate near the skin and refreshes. We study this problem in the context of fluid-structure interaction, through precision model experiments. We first characterize the elastic properties of a semi-circular thin plates with various thickness and evaluate their aerodynamic performance in a custom built apparatus. The air velocity profile that results from the flapping motion of the fan is characterized for different driving conditions. A systematic variation of the geometric and elastic parameters, along with an exploration of the parameter space of the periodic driving motion (amplitude and frequency), allows us to establish optimal design and operational conditions for maximal output of the generated airflow, while minimizing the input power.

  4. El efecto abanico y la paradoja del experto

    Gómez-Ariza, Carlos J.

    2010-01-01

    La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico). Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para i...

  5. El efecto abanico y la paradoja del experto

    Carlos J. Gómez-Ariza

    2010-09-01

    Full Text Available La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico. Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para integrar la información en estructuras complejas de información.

  6. The complete mitochondrial genome of Saxidomus purpuratus (Veneroida: Veneridae).

    Bao, Xiangbo; He, Chongbo; Gao, Xianggang; Li, Yunfeng; Gao, Lei; Jiang, Bing; Liu, Weidong

    2016-09-01

    In this study, the complete mitochondrial genome of Saxidomus purpuratus is determined, which is the first complete mitochondrial genome in the genus Saxidomus. The genome was of 19 637 bp in length, including 2 rRNAs, 22 tRNAs and 12 protein-coding genes with the order of ND3 and ND5 reversed. Maximum likelihood tree based on nucleotide sequences of 12 mitochondrial PCGs was constructed, in which S. purpuratus was clustered with 3 Meretrix species. The results are expected to provide useful data for species identification and further studies of the genus Saxidomus. PMID:26329595

  7. The genome of the sea urchin Strongylocentrotus purpuratus.

    SEA URCHIN GENOME SEQUENCING CONSORTIUM; SODERGREN E; WEINSTOCK GM; DAVIDSON EH; CAMERON RA; GIBBS RA; ANGERER RC; ANGERER LM; ARNONE MI; BURGESS DR; BURKE RD; COFFMAN JA; Dean, M.; ELPHICK MR; ETTENSOHN CA

    2006-01-01

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or ...

  8. Caracterización y modelo de abanicos aluviales en la cuenca Estefaniense de Rengos (Asturias

    Santos García, J. A.

    1989-08-01

    Full Text Available The Stephanian deposits of the Rengos Basin are studied in this paper from a sedimenlological point of view. Five lithostratigraphic units are stablished. They are organised in four megasequences which have been attributed lo minar tectonic movements on the northern border. Most of the infilling of the basin was relaled lo longitudinal input of alluvial sediments along former fluvial val1eys. Lateral supply of sediment was developed. After analysing lateral and vertical variations of these material in the first megasequence a transition from proximal lo and distal facies was deduced. The existence of a threshold in the Riolorno zone has been deduced. From the previous data we conclude that these materials deposited in alluvial fans. A model of fan and its dynamic evolution is proposed.En este trabajo se estudia la sedimentología de los depósitos estefanienses, de la cuenca de Rengas. Se establecen 5 unidades litoestratigráficas, dispuestas en 4 megasecuencias, atribuidas a pulsos tectónicos menores sobre el borde norte de la cuenca. El relleno de la cuenca, se realizó condicionado fundamentalmente por los aportes longitudinales de ríos de abanicos aluviales, a lo largo de antiguos valles, mientras que los aportes laterales presentan menor importancia. La variación lateral y vertical de los materiales, en la primera megasecuencia, queda representada por una transición de facies proximales a distales de abanicos aluviales. Se determina la presencia de un umbral en la zona de Riotorno. Finalmente, se establece un modelo de abanico aluvial y su evolución dinámica.

  9. The genome of the sea urchin Strongylocentrotus purpuratus.

    Sodergren, Erica; Weinstock, George M; Davidson, Eric H; Cameron, R Andrew; Gibbs, Richard A; Angerer, Robert C; Angerer, Lynne M; Arnone, Maria Ina; Burgess, David R; Burke, Robert D; Coffman, James A; Dean, Michael; Elphick, Maurice R; Ettensohn, Charles A; Foltz, Kathy R; Hamdoun, Amro; Hynes, Richard O; Klein, William H; Marzluff, William; McClay, David R; Morris, Robert L; Mushegian, Arcady; Rast, Jonathan P; Smith, L Courtney; Thorndyke, Michael C; Vacquier, Victor D; Wessel, Gary M; Wray, Greg; Zhang, Lan; Elsik, Christine G; Ermolaeva, Olga; Hlavina, Wratko; Hofmann, Gretchen; Kitts, Paul; Landrum, Melissa J; Mackey, Aaron J; Maglott, Donna; Panopoulou, Georgia; Poustka, Albert J; Pruitt, Kim; Sapojnikov, Victor; Song, Xingzhi; Souvorov, Alexandre; Solovyev, Victor; Wei, Zheng; Whittaker, Charles A; Worley, Kim; Durbin, K James; Shen, Yufeng; Fedrigo, Olivier; Garfield, David; Haygood, Ralph; Primus, Alexander; Satija, Rahul; Severson, Tonya; Gonzalez-Garay, Manuel L; Jackson, Andrew R; Milosavljevic, Aleksandar; Tong, Mark; Killian, Christopher E; Livingston, Brian T; Wilt, Fred H; Adams, Nikki; Bellé, Robert; Carbonneau, Seth; Cheung, Rocky; Cormier, Patrick; Cosson, Bertrand; Croce, Jenifer; Fernandez-Guerra, Antonio; Genevière, Anne-Marie; Goel, Manisha; Kelkar, Hemant; Morales, Julia; Mulner-Lorillon, Odile; Robertson, Anthony J; Goldstone, Jared V; Cole, Bryan; Epel, David; Gold, Bert; Hahn, Mark E; Howard-Ashby, Meredith; Scally, Mark; Stegeman, John J; Allgood, Erin L; Cool, Jonah; Judkins, Kyle M; McCafferty, Shawn S; Musante, Ashlan M; Obar, Robert A; Rawson, Amanda P; Rossetti, Blair J; Gibbons, Ian R; Hoffman, Matthew P; Leone, Andrew; Istrail, Sorin; Materna, Stefan C; Samanta, Manoj P; Stolc, Viktor; Tongprasit, Waraporn; Tu, Qiang; Bergeron, Karl-Frederik; Brandhorst, Bruce P; Whittle, James; Berney, Kevin; Bottjer, David J; Calestani, Cristina; Peterson, Kevin; Chow, Elly; Yuan, Qiu Autumn; Elhaik, Eran; Graur, Dan; Reese, Justin T; Bosdet, Ian; Heesun, Shin; Marra, Marco A; Schein, Jacqueline; Anderson, Michele K; Brockton, Virginia; Buckley, Katherine M; Cohen, Avis H; Fugmann, Sebastian D; Hibino, Taku; Loza-Coll, Mariano; Majeske, Audrey J; Messier, Cynthia; Nair, Sham V; Pancer, Zeev; Terwilliger, David P; Agca, Cavit; Arboleda, Enrique; Chen, Nansheng; Churcher, Allison M; Hallböök, F; Humphrey, Glen W; Idris, Mohammed M; Kiyama, Takae; Liang, Shuguang; Mellott, Dan; Mu, Xiuqian; Murray, Greg; Olinski, Robert P; Raible, Florian; Rowe, Matthew; Taylor, John S; Tessmar-Raible, Kristin; Wang, D; Wilson, Karen H; Yaguchi, Shunsuke; Gaasterland, Terry; Galindo, Blanca E; Gunaratne, Herath J; Juliano, Celina; Kinukawa, Masashi; Moy, Gary W; Neill, Anna T; Nomura, Mamoru; Raisch, Michael; Reade, Anna; Roux, Michelle M; Song, Jia L; Su, Yi-Hsien; Townley, Ian K; Voronina, Ekaterina; Wong, Julian L; Amore, Gabriele; Branno, Margherita; Brown, Euan R; Cavalieri, Vincenzo; Duboc, Véronique; Duloquin, Louise; Flytzanis, Constantin; Gache, Christian; Lapraz, François; Lepage, Thierry; Locascio, Annamaria; Martinez, Pedro; Matassi, Giorgio; Matranga, Valeria; Range, Ryan; Rizzo, Francesca; Röttinger, Eric; Beane, Wendy; Bradham, Cynthia; Byrum, Christine; Glenn, Tom; Hussain, Sofia; Manning, Gerard; Miranda, Esther; Thomason, Rebecca; Walton, Katherine; Wikramanayke, Athula; Wu, Shu-Yu; Xu, Ronghui; Brown, C Titus; Chen, Lili; Gray, Rachel F; Lee, Pei Yun; Nam, Jongmin; Oliveri, Paola; Smith, Joel; Muzny, Donna; Bell, Stephanie; Chacko, Joseph; Cree, Andrew; Curry, Stacey; Davis, Clay; Dinh, Huyen; Dugan-Rocha, Shannon; Fowler, Jerry; Gill, Rachel; Hamilton, Cerrissa; Hernandez, Judith; Hines, Sandra; Hume, Jennifer; Jackson, Laronda; Jolivet, Angela; Kovar, Christie; Lee, Sandra; Lewis, Lora; Miner, George; Morgan, Margaret; Nazareth, Lynne V; Okwuonu, Geoffrey; Parker, David; Pu, Ling-Ling; Thorn, Rachel; Wright, Rita

    2006-11-10

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or known only outside the deuterostomes. This echinoderm genome provides an evolutionary outgroup for the chordates and yields insights into the evolution of deuterostomes. PMID:17095691

  10. A prokaryotic mycoplasma-like organism infection in the scallop Argopecten irradians

    ZHANG Weizhu; WU Xinzhong; SUN Jingfeng; LI Dengfeng

    2007-01-01

    Intracytoplasmic infection with a prokaryotic mycoplasma-like organism (MLO) were characterized in the scallop Argopecten irradians, and the first report of such infection in this scallop was represented. Ultrastructurally these microorganisms are usually pleomorphic and variable in morphology and size, and appear in several cell types such as small spherical body, rod-shaped bodies and longer filament-shaped body. They lack a cell wall. These observations revealed that these types of the prokaryote showed some characteristics of a mycoplasma-like organism (MLO). MLO reproduced in two ways: binary fission and budding. The results of isolation and purification showed that a large number of MLOs existed in the tissues of diseased scallops. The results of experimental infection revealed that the MLO is pathogenic to the scallop Argopecten irradians.

  11. Effect of E. coli coli on Anti-disease Activities of Scallops: Argopecten irradians

    2003-01-01

    The effect of acute E. coli challenge on the anti-disease activity of scallops Argopecten irradians is examined. The treatments of scallop from which hemolymph samples were taken for study included (1) control scallops, (2) sham-injected scallops, (3) PSW-injected scallops and (4) E. coli-injected scallops. From the beginning, the anti-disease activities of scallops are determined at 12 hr and 24 hr. The concentrations of circulating hemocytes, the total serum protein concentrations and the activities of alkaline phosphatase, acid phosphatase and superoxide dismutase in the scallops Argopecten irradians are determined. Injection with E. coli results in a significant elevation in the concentration of circulating hemocytes and in the alkaline phosphatase activity and a significant decline in the total serum protein concentration and in the superoxide dismutase activity at 24 hr postchallenge. It shows that metabolism of bay scallop is expedited to adopt the challenge.

  12. Los sistemas defensivos del castellum de Tamuda. ¿Torres de planta en abanico?

    Bermejo Meléndez, Javier

    2014-12-01

    Full Text Available The tamuda’s castle, situated next to Tetuan (Morocco, is one the best example of roman military architecture in the Mauritanians Provincies as much for his conservation as dates that we have thanks to the different campaigns developed to Spanish protectorate and today for the University of Huelva. One of more original aspects in this sense are the architectonics dates that we have of different areas of this castellum, specially about SE and NW towers traditionally adscript as fan, hypothesis that today must to be modified since exists news dates.El castellum de Tamuda, ubicado en las proximidades de la actual Tetuán (Marruecos, supone uno de los mejores ejemplos de arquitectura militar romana en las provincias mauritanas tanto por el grado de conservación como por los datos que hasta la fecha se tienen gracias a las campañas de excavación desarrolladas durante el periodo del protectorado español y las que actualmente se están llevando a cabo por parte de la Universidad de Huelva. Uno de los aspectos más novedosos a este respecto son los datos arqueoarquitectónicos que se desprenden del análisis paramental realizado en diversas partes de este campamento, de los cuales tendrán especial relevancia las torres SE y NO tradicionalmente adscritas como de abanico, planteamiento que a día de hoy debe ser modificado dado los nuevos datos con los que se cuentan.

  13. The sea urchin (Strongylocentrotus purpuratus test and spine proteomes

    Mann Karlheinz

    2008-08-01

    Full Text Available Abstract Background The organic matrix of biominerals plays an important role in biomineral formation and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin, which is an important model organism for developmental biology and biomineralization, only few matrix components have been identified and characterized at the protein level. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of possible matrix proteins at the gene level, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy, proteomic analysis. Results We identified 110 proteins as components of sea urchin test and spine organic matrix. Fourty of these proteins occurred in both compartments while others were unique to their respective compartment. More than 95% of the proteins were detected in sea urchin skeletal matrices for the first time. The most abundant protein in both matrices was the previously characterized spicule matrix protein SM50, but at least eight other members of this group, many of them only known as conceptual translation products previously, were identified by mass spectrometric sequence analysis of peptides derived from in vitro matrix degradation. The matrices also contained proteins implicated in biomineralization processes previously by inhibition studies using antibodies or specific enzyme inhibitors, such as matrix metalloproteases and members of the mesenchyme-specific MSP130 family. Other components were carbonic anhydrase, collagens, echinonectin, a α2-macroglobulin-like protein and several proteins containing scavenger receptor cysteine-rich domains. A few possible signal transduction pathway components, such as GTP-binding proteins, a semaphorin and a possible tyrosine kinase were also identified. Conclusion This report presents the most comprehensive

  14. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  15. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales UNAPAL - Abanico 75: new butternut squash cultivar, with high dry matter content in fruit for agribusiness purposes.

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.Using three diallel crosses among populations of butternut squash, with different levels of inbreeding (S0 x S0, (S1 x S1 y (S2 x S2, two hybrids and two inbred lines of butternut squash were selected, for its high dry matter content in fruit and plant production. Seven hybrid populations were formed from the selected genotypes. They are genetically stabilized by fraternal crossing and were evaluated in different environments of Valle del Cauca. Population one was selected, which presented a plant production between 29 to 32 kg; average fruit weight between 5 -6 kg; 4-5 fruit per plant; dry matter in fruit among 24-26%; globular form ribbed bright green external color and deep yellow to orange flesh color (12 to 14 Roche Fan. This population was registered in Institute Colombian Agropecuario ICA, under the name UNAPAL-Abanico-75.

  16. Marine Toxin Okadaic Acid Affects the Immune Function of Bay Scallop (Argopecten irradians).

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Yun, Saekil; Kim, Sang Guen; Park, Se Chang

    2016-01-01

    Okadaic acid (OA) is produced by dinoflagellates during harmful algal blooms and is a diarrhetic shellfish poisoning toxin. This toxin is particularly problematic for bivalves that are cultured for human consumption. This study aimed to reveal the effects of exposure to OA on the immune responses of bay scallop, Argopecten irradians. Various immunological parameters were assessed (total hemocyte counts (THC), reactive oxygen species (ROS), malondialdehyde (MDA), glutathione (GSH), lactate dehydrogenase (LDH), and nitric oxide (NO) in the hemolymph of scallops at 3, 6, 12, 24, and 48 h post-exposure (hpe) to different concentrations of OA (50, 100, and 500 nM). Moreover, the expression of immune-system-related genes (CLT-6, FREP, HSP90, MT, and Cu/ZnSOD) was also measured. Results showed that ROS, MDA, and NO levels and LDH activity were enhanced after exposure to different concentrations of OA; however, both THC and GSH decreased between 24-48 hpe. The expression of immune-system-related genes was also assessed at different time points during the exposure period. Overall, our results suggest that exposure to OA had negative effects on immune system function, increased oxygenic stress, and disrupted metabolism of bay scallops. PMID:27563864

  17. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians

    Cheng Chi

    2016-05-01

    Full Text Available Palmitoleic acid (PA, an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP activity, superoxide dismutase (SOD, lysozyme, phagocytic activity, total protein, malondialdehyde (MDA level, and reactive oxygen species (ROS production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe to PA. Lysozyme activity was lower in scallops at 12–48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6–12 hpe to 40–80 mg/L of PA, but decreased at 24–48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6–48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes.

  18. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians.

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Kim, Sang Guen; Yun, Saekil; Park, Se Chang

    2016-01-01

    Palmitoleic acid (PA), an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians) is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L) of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP) activity, superoxide dismutase (SOD), lysozyme, phagocytic activity, total protein, malondialdehyde (MDA) level, and reactive oxygen species (ROS) production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD) were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe) to PA. Lysozyme activity was lower in scallops at 12-48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6-12 hpe to 40-80 mg/L of PA, but decreased at 24-48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6-48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes. PMID:27171074

  19. Growth and survival larvae of Argopecten nucleus fed with different microalgae diets

    Yenia Katerine Carreño Hernández

    2012-06-01

    Full Text Available The influence of the diet on larval growth of the scallops Argopecten nucleus was studied, testing six microalgae diets composed by single-algae and mixed diets of the species Isochrysis galbana, Chaetoceros calcitrans y Tetraselmis suecica, handling a concentration per mL equivalent to 40000 cells of I. galbana and the response through the variables surviving, growth, appearance of the eye spot and state of condition (full, half-full and empty larvae was measured. The diets containing I. galbana showed greater results over all the measured variables, with regard to those where it was not present. In particular, the mixed diet I. galbana + C. calcitrans presented superiority over all variables, although in the most cases was statistically similar to I. galbana + C. calcitrans + T. suecica, I. galbana + T. suecica and I. galbana alone. For the opposite, the diets with the lowest results were C. calcitrans and C. calcitrans +T. suecica. The results obtained are principally attributed to the nutritional composition mainly of high unsaturated fatty acids (HUFA of each microalgae and each mixture supply, which is discussed in detail.

  20. Environmental economics reality check: a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project.

    Isla, Ana; Thompson, Shirley

    2003-01-01

    This paper presents a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project in the Arenal Conservation Area, Costa Rica. Microenterprise is the Sustainable Development and the Women in Development model for gender equity and environment of the World Bank, International Monetary Fund and large non-government organizations, like the World Wildlife Fund-Canada. The authors of this paper argue that debt-for-nature investment in microenterprise and ecological economic models are not distinct from neoclassical economic and development models that created the environmental, social and cultural crises in the first place. This case study shows that the world market accommodates only one model of development: unsustainable export-oriented production based on flexible labour markets, low wages, indebtedness and low cost production. Working standards in those micro-enterprises are eroded due to many factors,including indebtedness. What happened at a national level in non-industrial countries with the international debt crisis is now mirrored in individual indebtedness through microenterprise. Is current development policy creating a new form of indentured servitude? Medicinal plants, prior to commodification, were a source of women's power and upon commodification in international development projects, are the source of their exploitation. PMID:12859005

  1. Histamine is a modulator of metamorphic competence in Strongylocentrotus purpuratus (Echinodermata: Echinoidea

    Sutherby Josh

    2012-04-01

    Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We

  2. Structural characterization and mechanical behavior of a bivalve shell (Saxidomus purpuratus)

    The structure and mechanical behavior of Saxidomus purpuratus bivalve shell were investigated. XRD results show that the only form of calcium carbonate present in the shell is aragonite. The inner and middle layers have a cross-lamellar structure, while the outer layer has porosity and does not have tiles, but instead has 'blocky' regions. The hardness of middle and inner layer are close in both plane view and cross section, but the hardness of outer layer is significantly less, especially in the plane view. The compressive strengths with loading along the three orientations were established and significant differences were found. The Weibull strength at 50% of the probability of failure varies between 59 and 148 MPa and is dependent on the loading orientation and in condition of shell (dry vs. hydrated). These differences are interpreted in terms of the anisotropic structure and coarser structure of the external layer.

  3. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.Volcanic and volcaniclastic rocks grouped into the Farellones and Abanico formations make up most of the western Andean Main Range between 32° and 35°SL New 15 Ma Ar-Ar ages from the top of the latter formations show that the overlying succession, which locally onlaps eroded volcanic edifices, is diachronic. The calcalkaline Farellones volcanic activity started during the earliest

  4. Effects of chronic gamma radiation on the growth and survival of juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians)

    Juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians) from North Carolina were exposed to five intensities of chronic γ radiation for 3 to 14 months during 1973/1974. Exposure rates ranged downward from 37 rads/hr to levels slightly higher than background radiation. Deleterious effects on growth and survival of clams occurred only at the highest exposure rate (37 to 16 rads/hr). Clams exposed to low radiation levels (0.007 to 0.008 rads/hr) increased in weight, but not in length, faster than the controls. One-half of the clams exposed to the highest radiation level survived to 159 days, after a cumulative dose of 132 krads, and only 10 % survived to 14 months after a cumulative dose of 150 to 346 krads. No deleterious effects on growth and survival of scallops were apparent during 84 days of exposure to a cumulative radiation dose of 71.7 krads. (author)

  5. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.

  6. Estudios histológico e histoquímico del sistema digestivo de la almeja catarina Argopecten ventricosus (Sowerby, 1842)

    Cáceres, C.; Alarcón, F.J.

    2002-01-01

    Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...

  7. UNAPAL –Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Estrada Salazar Edgar Iván

    2010-09-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  8. "Spiral asters" and cytoplasmic rotation in sea urchin eggs: induction in Strongylocentrotus purpuratus eggs by elevated temperature

    1985-01-01

    "Spiral asters" composed of swirls of subcortical microtubules were recently described in fertilized eggs of the sea urchin Strongylocentrotus purpuratus. In our study, these structures did not occur at culture temperatures below 16 degrees C. When the culture temperature was elevated, however, "spiral asters" routinely appeared during a susceptible period before mitotic prophase when the sperm aster-diaster normally exists. A massive and protracted rotation of the cytoplasm (excluding an imm...

  9. Effects of produced water on gametogenesis and gamete performance in the purple sea urchin (Stronglyocentrotus purpuratus)

    The author examined the effects of a chronic exposure to produced water (an oil production effluent) discharge on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus) using an in situ caging experiment. Adult purple urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites with distances ranging from 5m to 1,000m. Cage exposures were maintained in the field for eight weeks and each cage held 25 urchins. Gametogenesis was examined for each sex by comparing a size-independent measure of gonad mass as determined by analysis of covariance. The author found that there was a significant negative relationship between gonad mass and cage distance for both sexes, indicating that urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetic bioassay that holds the concentration of eggs constant and varies the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a kinetics model. Significant differences were found in the fertilizability of eggs between cages. This showed a positive relationship with distance away from the outfall. The findings indicate that while adult urchins exposed to a produced water outfall produced larger gonads, they suffered a marked decreases in gamete performance

  10. Identification and developmental expression of the ets gene family in the sea urchin (Strongylocentrotus purpuratus).

    Rizzo, Francesca; Fernandez-Serra, Montserrat; Squarzoni, Paola; Archimandritis, Aristea; Arnone, Maria I

    2006-12-01

    A systematic search in the available scaffolds of the Strongylocentrotus purpuratus genome has revealed that this sea urchin has 11 members of the ets gene family. A phylogenetic analysis of these genes showed that almost all vertebrate ets subfamilies, with the exception of one, so far found only in mammals, are each represented by one orthologous sea urchin gene. The temporal and spatial expression of the identified ETS factors was also analyzed during embryogenesis. Five ets genes (Sp-Ets1/2, Sp-Tel, Sp-Pea, Sp-Ets4, Sp-Erf) are also maternally expressed. Three genes (Sp-Elk, Sp-Elf, Sp-Erf) are ubiquitously expressed during embryogenesis, while two others (Sp-Gabp, Sp-Pu.1) are not transcribed until late larval stages. Remarkably, five of the nine sea urchin ets genes expressed during embryogenesis are exclusively (Sp-Ets1/2, Sp-Erg, Sp-Ese) or additionally (Sp-Tel, Sp-Pea) expressed in mesenchyme cells and/or their progenitors. Functional analysis of Sp-Ets1/2 has previously demonstrated an essential role of this gene in the specification of the skeletogenic mesenchyme lineage. The dynamic, and in some cases overlapping and/or unique, developmental expression pattern of the latter five genes suggests a complex, non-redundant function for ETS factors in sea urchin mesenchyme formation and differentiation. PMID:16997294

  11. Contaminación de alimentos marinos por cadmio en Lima, 2015

    Gloria Marín Vallejos

    2015-12-01

    Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.

  12. Sedimentología y petrología de los abanicos aluviales y facies adyacentes en el Neogeno de Paracuellos de Jarama (Madrid

    Alonso, M.

    1986-06-01

    arcosas gruesas en el Conjunto Superior. Para el Conjunto Inferior se concluye unas relaciones de facies correspondientes a la progradación paulatina de depósitos propios de abanicos aluviales sobre depósitos palustres. Así mismo, el Conjunto Superior representa una progradación brusca de los sistemas de abanicos aluviales, con superposición de facies intermedias de estos abanicos sobre las facies más distales, que caracterizan el Conjunto Inferior. Dentro del contexto estratigráfico general de la Cuenca de Madrid, estas Unidades se incluyen básicamente en la Unidad Intermedia del Mioceno.
    La presencia de nivelesde calcreta, sepiolita y sílex en la parte más meridional de la sección es un hecho destacable en las partes más distales de los sistemas de abanicos aluviales y sU transición a las facies palustres. La gran abundancia de estos niveles en la zona, nos ha llevado a estudiar más específicamente los rasgos petrológicos de estos tipos de materiales, no siempre bien definidos en depósitos de ambiente continental.

  13. Molecular cloning of the first metazoan beta-1,3 glucanase from eggs of the sea urchin Strongylocentrotus purpuratus.

    Bachman, E S; McClay, D R

    1996-01-01

    We report the molecular cloning of the first beta-1,3 glucanase from animal tissue. Three peptide sequences were obtained from beta-1,3 glucanase that had been purified from eggs of the sea urchin Strongylocentrotus purpuratus and the gene was cloned by PCR using oligonucleotides deduced from the peptide sequences. The full-length cDNA shows a predicted enzyme structure of 499 aa with a hydrophobic signal sequence. A 3.2-kb message is present in eggs, during early embryogenesis, and in adult ...

  14. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Orlando Garrido; José Pino

    2014-01-01

    Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo q...

  15. Abanico East Formation: petrology and geochemistry of volcanic rocks behind the Cenozoic arc front in the Andean Cordillera, central Chile (33°50'S

    Marcia Muñoz

    2006-01-01

    Full Text Available The stratigraphy, chemistry and age of rocks assigned to the eastern portion of the Abanico Formation exposed along the El Volcán river valley, Principal Cordillera east of Santiago (30º50'S/70º12'-70º5'W, are reported and discussed. This ca. 3,300 m thick succession is mainly composed of basalts, basaltic andesites and volcaniclastic rocks. 40Ar/39Ar radiometric dates on plagioclase from the lava flows yield Oligocene-lower Miocene ages with a maximum age of 34.3 ±0.4 Ma for the lower part and a plateau age of 21.4±1.0 Ma for the upper part of the succession. The lava flows show calc-alkaline affinities and have chemical characteristics that are typical of arc volcanic rocks erupted in an active continental margin. A temporal chemical evolution in the sequence is indicated by upward increases in concentrations of LILE and LREE elements and LaN/YbN ratios. This pattern can be attributed to increasing contributions of fluids derived from the subducted lithosphere with time. A chemical comparison of these rocks with Oligocene-lower Miocene volcanic rocks from the Cerro Abanico and Chacabuco areas on the western border of the Principal Cordillera, east of Santiago, and at the northern end of the Central Depression reveals west to east compositional variations. From west to east these variations include: (1 increasing LILE and LREE concentrations, LaN/YbN ratios and Sr and Nd initial isotopic ratios, and (2 decreasing LILE/HFSE and LREE/HFSE ratios. These pattern can be attributed to a west to east decrease in the contribution of slab derived fluids and increase in the influence of crustal contamination processesLa formación Abanico Este: petrología y geoquímica de las rocas volcánicas detrás del arco Cenozoico en la Cordillera Andina, Chile central (33º50'S. Se presentan los resultados del estudio de la estratigrafía, química y edades de rocas asignadas a la franja oriental de la Formación Abanico expuestas en la ladera sur del R

  16. Phosphoproteomes of Strongylocentrotus purpuratus shell and tooth matrix: identification of a major acidic sea urchin tooth phosphoprotein, phosphodontin

    Mann Matthias

    2010-02-01

    Full Text Available Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the determination of test (shell and tooth organic matrix phosphoproteomes. Altogether 34 phosphoproteins were identified in the biomineral organic matrices. Most phosphoproteins were specific for one compartment, only two were identified in both matrices. The sea urchin phosphoproteomes contained several obvious orthologs of mammalian proteins, such as a Src family tyrosine kinase, protein kinase C-delta 1, Dickkopf-1 and other signal transduction components, or nucleobindin. In most cases phosphorylation sites were conserved between sea urchin and mammalian proteins. However, the majority of phosphoproteins had no mammalian counterpart. The most interesting of the sea urchin-specific phosphoproteins, from the perspective of biomineralization research, was an abundant highly phosphorylated and very acidic tooth matrix protein composed of 35 very similar short sequence repeats, a predicted N-terminal secretion signal sequence, and an Asp-rich C-terminal motif, contained in [Glean3:18919]. Conclusions The 64 phosphorylation sites determined represent the most comprehensive list of experimentally identified sea urchin protein phosphorylation sites at present and are an important addition to the recently analyzed Strongylocentrotus purpuratus shell and tooth proteomes. The identified phosphoproteins included a major, highly phosphorylated protein, [Glean3:18919], for which we suggest the name phosphodontin. Although not sequence-related to such highly phosphorylated

  17. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Orlando Garrido

    2014-06-01

    Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.

  18. Análisis markoviano de las sucesiones de abanicos aluviales de la cuenca de Madrid y de la depresión intermedia (Madrid y Guadalajara, España central)

    Torres Pérez-Hidalgo, Trinidad José de

    1996-01-01

    En este trabajo se aplica el análisis por cadenas de Markov a sucesiones estratigráficas del Neógeno de la Cuenca de Madrid y de la Depresión Intermedia. Los datos proceden de sondeos mecánicos de reconocimiento que atraviesan depósitos de abanico aluvial y de playa fangosa. El análisis por cadenas de Markov permite determinar la aparición de procesos repetitivos en el espacio y en el tiempo y, en el caso que nos ocupa, detectar aquellos estados (facies>, cuya aparición depe...

  19. Effects of increased pCO2 and geographic origin on purple sea urchin (Strongylocentrotus purpuratus calcite elemental composition

    J. D. Hosfelt

    2012-12-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (such as Mg and Sr into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore the effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low to high magnesium calcites. Mg/Ca and Sr/Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions along the US west coast (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg/Ca and Sr/Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg/Ca or Sr/Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 ppm; pH = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated CO2 (900 ppm; pH = 7.72 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr/Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr incorporation under elevated CO2

  20. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus

    Matthew C. Foster

    2015-01-01

    Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is

  1. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-01-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment. PMID:22822356

  2. Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) in relation to its reproductive cycle and the environmental condition of Sanggou Bay, China

    Bi, Jinhong; Li, Qi; Zhang, Xinjun; Zhang, Zhixin; Tian, Jinling; Xu, Yushan; Liu, Wenguang

    2016-04-01

    Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) was investigated from March 2012 to February 2013 in relation to environmental condition of Sanggou Bay and the reproductive cycle of clam. According to the histological analysis, the reproductive cycle of S. purpuratus includes two distinctive phases: a total spent and inactive stage from November to January, and a gametogenesis stage, including ripeness and spawning, during the rest of the year. Gametes were generated at a low temperature (2.1°C) in February. Spawning took place once a year from June to October. The massive spawning occurred in August when the highest water temperature and chlorophyll a level could be observed. The key biochemical components (glycogen, protein and lipid) in five tissues (gonad, foot, mantle, siphon and adductor muscle) were analyzed. The glycogen content was high before gametogenesis, and decreased significantly during the gonad development in the gonad, mantle and foot of both females and males, suggesting that glycogen was an important energy source for gonad development. The protein and lipid contents increased in the ovary during the gonad development, demonstrating that they are the major organic components of oocytes. The lipid and protein contents decreased in the testis, implying that they can provide energy and material for spermatogenesis. The results also showed that protein stored in the mantle and foot could support the reproduction after the glycogen was depleted.

  3. Análisis sedimentológico de la Cuenca estefaniense de Tineoo (Asturias. Ejemplo de depósitos de carbón en abanicos aluviales

    Santos García, J. A.

    1991-04-01

    septentrional, dando lugar a los depósitos de la U. Conglomerática. El relleno de la cuenca, se asimila con un modelo de abanicos aluviales en una cuenca tectónicamente activa, en la que los depósitos de carbón se relacionan con las facies más distales y las etapas de mayor tranquilidad, caracterizándose la existencia de un abanico principal y otros coalescentes de menor entidad.

  4. Effects of anthracene and UV-B radiation on larvae of Argopecten irradians%蒽和UV-B辐射增强对海湾扇贝早期发育的影响

    谭海丽; 王玉堃; 唐学玺; 周斌; 王其翔; 王悠

    2013-01-01

    The effects of anthracene and UV-B radiation on the early stage embryos development of benthos, and the single and joint a-cute toxicological effects of anthracene and UV-B radiation on the trochophore and D larvae of Argopecten irradians under the controlled laboratory conditions were studied. The results showed that with the increase of time and the anthracenes concentration or the increase of days and radiation does, the liabilities of the trochophore and D larvae declined. With the combination of anthracene and UV-B radiation , the liabilities of trochophore and D larvae were lower than those in the single action. Compared to D larvae, the trochophore was more sensitive to anthracene and UV-B radiation.%为了探讨蒽和UV-B辐射对底栖生物早期发育的影响,在实验生态学的条件下,选择海湾扇贝(Argopecten irradians)担轮幼虫和D型幼虫作为受试生物进行单一和联合急性毒性试验.结果表明:在实验的蒽浓度和UV-B辐射剂量下,随着蒽浓度和作用时间的增加,海湾扇贝担轮幼虫和D型幼虫的存活率逐渐降低;随着UV-B辐射剂量和辐射天数的增加,海湾扇贝担轮幼虫和D型幼虫存活率下降;在蒽和UV-B辐射共同作用对担轮幼虫和D型幼虫处理时,其两个发育阶段的存活率较两者单独作用的存活率均低很多;担轮幼虫较D型幼虫对蒽和UV-B辐射更敏感.

  5. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus calcite and potential effects of pCO2 during early life stages

    M. LaVigne

    2013-06-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr

  6. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus) calcite and potential effects of pCO2 during early life stages

    LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.

    2013-06-01

    Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr

  7. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Rosalba Alonso-Rodriguez

    2012-05-01

    Full Text Available The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2; after hydrolysis, the carbamate toxins (epimers GTX2/3 were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  8. 海湾扇贝组织蛋白酶L基因编码区的克隆和分析%Cloning and sequence analysis of cathepsin L gene from bay scallop Argopecten irradians

    李娟; 李莉; 张国范

    2011-01-01

    通过cDNA末端快速扩增技术(RACE),从海湾扇贝(Argopecten irradians)中克隆得到了组织蛋白酶L基因(AiCL)的编码区全长,为1095 bp,推测编码364个氨基酸.经比对与分析发现蛋白序列中存在4个组织蛋白酶L活性位点保守氨基酸:Q164,C170,H309,N329;6个极为保守的半胱氨酸残基:C167,C201,C210,C243,C302,C351.预测其N端17个氨基酸为信号肽序列,C端ASYPTV可能也是分泌信号.AiCL成熟蛋白分子由219个氨基酸构成,前体肽的切割位点预计在A145和M146之间.序列同源性分析中,AiCL蛋白序列与软体动物同源蛋白最为相似,序列一致性在50%以上,在系统进化树中与其它无脊椎动物组织蛋白酶L聚合到一起.通过SwISS-MODEL构建的AiCL成熟蛋白三维模型表明该蛋白空间结构高度保守.根据其序列特征,推测~CL可能具有水解多种肌蛋白的活性.%The complete open reading frame (ORF) of cathepsin L was obtained from bay scallop (Argopecten irradians) by RACE technique. The ORF was of 1 095 bp, encoding 364 amino acids. Four conserved residues for enzyme activity (Q164, C170, H309, N329) and six preserved cysteines were found in the protein sequence. 17 amino acids of N terminal were predicted to be the signal peptide and the sequence ASYPTV at C terminal was found to be a possible signal sequence. The mature protein of AICL contained 219 amino acids and the potential cleavage site was between A 145 and M 146. Analysis indicated AiCL shared the highest identities (>50%) with molluscan cathepsin Ls.It clustered with other invertebrate cathepsin Ls in the phylogenetic tree. The 3D-model predicted by SWISS-MODEL demonstrated that cathepsin L was conserved in tertiary structure. Collectively, data showed that AiCL was likely to catalyze the hydrolysis of multiple muscle related proteins.

  9. Permanent genetic resources added to molecular ecology resources database 1 august 2011-30 september 2011

    A'Hara, S.W.; Amouroux, P.; Argo, Emily.E.; Avand-Faghih, A.; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M.; Blatrix, R.; Blin, Aurelie; Bouktila, D.; Broome, A.; Burban, Christian; Capdevielle-Dulac, C.; Casse, N.; Chandra, Suresh

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procon...

  10. Nutritional improvement of the commercial production of marine aquaculture species through application of innovative biotechniques

    G Gajardo; Coutteau, P.; Curé, K.; Sorgeloos, P.; Beardmore, J.A.

    1996-01-01

    Marine aquaculture, particularly the salmon farming industry, has expanded very fast in Chile. Currently the country ranks second among the world leading salmon producers. However, there is a growing concern for the diversification of aquaculture activities. Examples are the cultures of flatfishes, either the introduced turbot (Scophthalmus maximus) or the native flounder species Paralichthys microps and P. adspersus, along with the native scallop, Argopecten purpuratus. Although both turbot ...

  11. Rapid species identification of fresh and processed scallops by multiplex PCR

    Marín, Alan; Fujimoto, Takafumi; Arai, Katsutoshi

    2013-01-01

    Food control policies regarding to seafood label authenticity have become a global issue due to increased incidence of species substitution or mislabelling. Proper species-level identification in processed scallop products is hindered by the lack of morphological characters such as their valves. In order to identify four commercially important scallop species (Argopecten purpuratus, A. irradians, Mizuhopecten yessoensis, Pecten albicans) a species-specific multiplex PCR reaction is described ...

  12. Deposición transversal de líquido de las boquillas de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales The transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions

    R.G. Viana

    2009-06-01

    Full Text Available El objetivo de este trabajo fue el de evaluar la deposición transversal de caldo de las boquillas pulverizadoras de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales. Se utilizaron 5 muestras de cada boquilla pulverizadora siendo considerada cada unidad, una repetición. La distribución de caldo fue evaluada por medio de una mesa de evaluación de distribución construida de acuerdo con la norma ISO 56821. Se evaluó el perfil de distribución individual, la distribución volumétrica simulada de la superposición de los chorros por medio del coeficiente de variación (CV% de los volúmenes colectados, el caudal y el ángulo de abertura de los chorros. Las condiciones operacionales fueron: presión de trabajo de 200, 300 y 400 Kpa, altura de 30, 40 y 50 cm en relación al blanco y espaciamiento entre boquillas simulados en Software (Microsoft Excel entre 45 y 100 cm. Las boquillas presentaron perfil individual descontinuo con la mayor deposición de líquido en la región central y reducción del volumen gradual en dirección a las extremidades. El aumento de la presión promovió alargamiento del perfil y de la franja de aplicación. Las boquillas proporcionaron perfil uniforme que dependió del espaciamiento entre las boquillas, con valores menores con reducción en el espaciamiento y en presiones mayores. El caudal y el ángulo del chorro aumentaron con el incremento en la presión.The objective of this work was evaluate the transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions. Was used five samples of each nozzle and considerate a unite one repetition. The spray deposition was evaluate on a table of evaluation distribution constructed in accordance with norm ISO 5682-1. Was evaluate a single spray distribution, volumetric distribution of the overlapping spurts by means of the coefficient of variation (CV%, outflow and angle of opening of the

  13. Abanicos aluviales cuaternarios del Baix Camp (provincia de Tarragona): resultados de dataciones radiométricas

    Villamarín, J. A.; Masana, E; Calderón, T.; Julià, Ramón; Santanach, P.

    1998-01-01

    The Quaternary fans which cover the southernmost part of the El Camp Basin belong to three generations. Noticeable calcrete levels developed on the top of fans from the first and second generation. Radiometric dating by means of U/Th and termolumiscence techniques of the mentioned caliche levels allow us to attribute a minimal age of ca. 300000 years to the top of the first generation fans, and ca. 100000 years to the top of the second generation alluvial fans

  14. Permanent genetic resources added to Molecular Ecology Resources Database 1 August 2011-30 September 2011.

    A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana. PMID:22136175

  15. PRODUCCIÓN DE ENZIMAS EXTRACELLARES POR BACTERIAS AISLADAS DE INVERTEBRADOS MARINOS

    Jorge León

    2014-06-01

    Full Text Available Con el fin de seleccionar las bacterias marinas con la capacidad de producir enzimas extracelulares ( CEE , se analizaron muestras de Argopecten purpuratus y Crassostrea gigas en el cultivo , así como de otros invertebrados interticlal y bentónicos. La selección de cepas de la CEE de productores se llevó a cabo en Agar Marino ( MA con la adición del sustrato relevante ( almidón , caseína , Tween - 80 , lecitina , ADN y gelatina . La CEE evaluación cepas productoras se llevó a cabo en 102 aislamientos . Los resultados muestran que las bacterias asociadas TOA . purpuratusand C. gigashave las mejores actividades multienzimáticos ; Sin embargo , Semimytilus algosus, Tetrapigus niger y Thais chocolata también son fuentes importantes de productores de bacterias de la CEE. La actividad multienzimático cualitativa en MA ( zonas claras u opacas alrededor de las colonias en mm de diámetro varió de 6 a > 16 mm . La frecuencia de la producción multienzimático fue caseinase 62,74 % , entre esterasa 57,84 % , 52,94 % de la amilasa , la gelatinasa 38,23 % , 33,3 % DNAsa , agarasa 5,43 % y 90,0 % lecitinasa . Los resultados sugieren la posibilidad de usar cepas nativas para fines biotecnológicos

  16. Taxonomy Icon Data: purple urchin [Taxonomy Icon

    Full Text Available purple urchin Strongylocentrotus purpuratus Echinodermata Strongylocentrotus_purpuratus_L.png Strongylocentr...otus_purpuratus_NL.png Strongylocentrotus_purpuratus_S.png Strongylocentrotus_purpu...ratus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NS ...

  17. Gene : CBRC-CJAC-01-0861 [SEVENS

    Full Text Available ein [Strongylocentrotus purpuratus] 4e-12 30% MGLSLGPKFLGGAFPRQGLPWAWFSLKGRWGGFPRVGLSLGGAFSGWGFLWVELSLDVAVSG...GFLWVELSLDGALPGWGFSGRGFPWVGLFLGRGFLGGAFPGRGFLWARLFLGEVFLGGAFPEWGFPWVGLFWVGFFPGWGFSWVRLFSGQGFSWVGLFWAGLFLSGSL...SGQGFSWVGLFSGQGFPWARLFLSGSLWVELFWMGYFSLGGAFPEQGFSWVGLFVGGAFLGGLFPWAWLSLSGAFPWVGLSGWSFFGWAFSLGGAFPGLVFFPVWAFLSWDLCIPGPCLVTSF ...

  18. The occurrence of domoic acid linked to a toxic diatom bloom in a new potential vector: the tunicate Pyura chilensis (piure).

    López-Rivera, Américo; Pinto, Maricela; Insinilla, Andrea; Suárez Isla, Benjamín; Uribe, Eduardo; Alvarez, Gonzalo; Lehane, Mary; Furey, Ambrose; James, Kevin J

    2009-11-01

    The tunicate Pyura chilensis (Molina, 1782); Phylum Chordata; Subphylum Urochordata; Class Ascidiacea, common local name "piure" or sea squirt; a filter-feeder (plankton and suspended particles) sessile species; may play an important role in monitoring domoic acid (DA) the principal toxic component of Amnesic Shellfish Poisoning (ASP). Significant DA concentrations have been determined in tunicate samples, collected during a recent ASP outbreak in Bahía Inglesa, an important scallop (Argopecten purpuratus) farming area. Several infaunal species were tested for the presence of DA, in addition to the usual scallop monitoring programme. DA was found at sub-toxic levels in filtering bivalves such as mussels (Mytilus chilensis), large mussels (Aulacomya ater) and clams (Protothaca thaca) (6.4, 5.4 and 4.7 microg DA/g tissue respectively). Of particular interest was the observation of significant accumulations of toxic Pseudo-nitzschia sp. diatoms in the internal siphon and atrium spaces of the tunicate. Toxin distribution within major tunicate organs was heterogeneous with 8.7-15.5 microg DA/g in edible tissues, 14.9-17.9 microg DA/g in the fecal material and 13.6-32.7 microg DA/g in the gut content. DA was determined by HPLC-UV and confirmed by diode-array detection and LC-MS/MS analysis. This is the first report of the presence of DA in a tunicate that is regularly consumed by coastal populations. These results confirm the need to include these organisms in sanitation programs for marine toxins. PMID:19505493

  19. NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS

    Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...

  20. NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS

    Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS

    Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...

  2. Poliploidia en moluscos de importancia comercial (almeja catarina Argopecten ventricosus Sowerby ii, 1842; almeja mano de leon Nodipecten subnodosus Sowerby 1835; y abulón rojo Haliotis rufescens Swainson 1822)

    Maldonado, R.

    2003-01-01

    La poliploidía ha sido una de las biotecnologías más empleadas en la ultima década para el mejoramiento genético de moluscos bivalvos por ser una de las mejores alternativas a corto plazo para incrementar la producción. Los organismos triploides presentan tres juegos completos de cromosomas homólogos que afectan la sinapsis, lo cual da como resultado una esterilidad parcial o total, la cual teóricamente repercute favorablemente en el crecimiento. Sin embargo, la inducción a la triploidía pres...

  3. Estratigrafía secuencial de sistemas deltaicos en cuencas de antepaís: ejemplos de Sant Llorenç del Munt, Montserrat y Roda (Paleógeno: cuenca de antepaís surpirenaica)

    López Blanco, Miguel

    1996-01-01

    [spa] En las sucesiones de Sant Llorenç del Munt y Montserrat se reconocen dos sistemas sedimentarios alternantes en el tiempo (abanicos aluviales y costeros, y plataformas carbonáticas) que muestran una profundización de la cuenca hacia el NW. Las facies terrígenas, mucho más importantes volumétricamente que las de plataforma carbonática, se componen de cuatro asociaciones o cinturones de facies principales: abanico aluvial, llanura de abanico costero, frente de abanico costero y talud de ab...

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS

    Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-1055 [SEVENS

    Full Text Available CBRC-XTRO-01-1055 ref|XP_782654.2| PREDICTED: similar to Cpsf6 protein, partial [St...rongylocentrotus purpuratus] ref|XP_001180349.1| PREDICTED: similar to Cpsf6 protein, partial [Strongylocentrotus purpuratus] XP_782654.2 1e-34 51% ...

  6. NCBI nr-aa BLAST: CBRC-RMAC-09-0027 [SEVENS

    Full Text Available CBRC-RMAC-09-0027 ref|XP_797403.2| PREDICTED: similar to Aminopeptidase N (rAPN) (Alanyl aminope ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] ref|XP_00 ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] XP_797403 ...

  7. NCBI nr-aa BLAST: CBRC-OCUN-01-0528 [SEVENS

    Full Text Available CBRC-OCUN-01-0528 ref|XP_795774.2| PREDICTED: similar to plus agglutinin [Strongylo...centrotus purpuratus] ref|XP_001192339.1| PREDICTED: similar to plus agglutinin [Strongylocentrotus purpuratus] XP_795774.2 0.062 32% ...

  8. NCBI nr-aa BLAST: CBRC-DDIS-04-0105 [SEVENS

    Full Text Available CBRC-DDIS-04-0105 ref|XP_795306.2| PREDICTED: similar to mind bomb [Strongylocentro...tus purpuratus] ref|XP_001195978.1| PREDICTED: similar to mind bomb [Strongylocentrotus purpuratus] XP_795306.2 0.003 64% ...

  9. NCBI nr-aa BLAST: CBRC-OCUN-01-0862 [SEVENS

    Full Text Available CBRC-OCUN-01-0862 ref|NP_999775.1| spicule matrix protein SM50 [Strongylocentrotus ...purpuratus] sp|P11994|SM50_STRPU 50 kDa spicule matrix protein precursor gb|AAA30071.1| spicule matrix protein SM50 precursor [Strongylocentrotus purpuratus] NP_999775.1 2e-15 34% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Full Text Available CBRC-OANA-01-1904 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-81 42% ...

  11. NCBI nr-aa BLAST: CBRC-OANA-01-1491 [SEVENS

    Full Text Available CBRC-OANA-01-1491 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-35 36% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Full Text Available CBRC-OANA-01-1904 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-84 42% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1738 [SEVENS

    Full Text Available CBRC-OANA-01-1738 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 0.007 30% ...

  14. NCBI nr-aa BLAST: CBRC-OANA-01-2167 [SEVENS

    Full Text Available CBRC-OANA-01-2167 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-11 31% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-3457 [SEVENS

    Full Text Available CBRC-XTRO-01-3457 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-17 38% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-0997 [SEVENS

    Full Text Available CBRC-OANA-01-0997 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-49 40% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-1470 [SEVENS

    Full Text Available CBRC-OANA-01-1470 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-44 36% ...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-2284 [SEVENS

    Full Text Available CBRC-OANA-01-2284 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-64 41% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-01-0521 [SEVENS

    Full Text Available CBRC-MDOM-01-0521 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-10 30% ...

  20. NCBI nr-aa BLAST: CBRC-XTRO-01-2405 [SEVENS

    Full Text Available CBRC-XTRO-01-2405 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 9e-45 37% ...

  1. NCBI nr-aa BLAST: CBRC-GACU-23-0138 [SEVENS

    Full Text Available CBRC-GACU-23-0138 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-119 39% ...

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Full Text Available CBRC-XTRO-01-0211 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-05 63% ...

  3. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 4e-65 42% ...

  4. NCBI nr-aa BLAST: CBRC-OANA-01-2105 [SEVENS

    Full Text Available CBRC-OANA-01-2105 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-79 43% ...

  5. NCBI nr-aa BLAST: CBRC-OANA-01-1879 [SEVENS

    Full Text Available CBRC-OANA-01-1879 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-61 42% ...

  6. NCBI nr-aa BLAST: CBRC-GACU-11-0007 [SEVENS

    Full Text Available CBRC-GACU-11-0007 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-120 40% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-2234 [SEVENS

    Full Text Available CBRC-OANA-01-2234 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-59 42% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Full Text Available CBRC-XTRO-01-3296 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 7e-11 32% ...

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Full Text Available CBRC-XTRO-01-0211 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-05 51% ...

  10. NCBI nr-aa BLAST: CBRC-OLAT-26-0032 [SEVENS

    Full Text Available CBRC-OLAT-26-0032 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-63 48% ...

  11. NCBI nr-aa BLAST: CBRC-FRUB-02-0514 [SEVENS

    Full Text Available CBRC-FRUB-02-0514 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-87 40% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-11-0167 [SEVENS

    Full Text Available CBRC-MDOM-11-0167 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 0.48 28% ...

  13. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 2e-64 41% ...

  14. NCBI nr-aa BLAST: CBRC-OANA-01-1048 [SEVENS

    Full Text Available CBRC-OANA-01-1048 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-28 40% ...

  15. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Full Text Available CBRC-OLAT-01-0021 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-65 44% ...

  16. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Full Text Available CBRC-XTRO-01-3296 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 3e-10 41% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-2231 [SEVENS

    Full Text Available CBRC-OANA-01-2231 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 5e-19 43% ...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-1934 [SEVENS

    Full Text Available CBRC-OANA-01-1934 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-29 37% ...

  19. NCBI nr-aa BLAST: CBRC-OANA-01-1148 [SEVENS

    Full Text Available CBRC-OANA-01-1148 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-38 41% ...

  20. Dicty_cDB: Contig-U15067-1 [Dicty_cDB

    Full Text Available apiens chromosome 13q34 schizophrenia regio... 36 1.7 9 ( AC177006 ) Strongylocentrotus purpuratus clone R3-...andidatus Carsonella ruddii PV DNA, complete gen... 34 1.1 10 ( AE014303 ) Homo s

  1. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  2. Dicty_cDB: SHK759 [Dicty_cDB

    Full Text Available hl*lqlvmy qvqlqlq*llqfnqllmnlqvviiimitviqqllqqlqllqq*mieikqprqfkrhgkii vvsnnlkkklklknylkilvncylimkeihlkiikh*ilksmmmkiminhktitim... Shewanella sp. W3-18-1, complet... 38 0.71 AB110082_1( AB110082 |pid:none) Bacillus ehim...1_A04_T7A Strongylocentrotus purpuratus, purple sea urchin , sperm genomic BAC library Strongylocentrotus purpuratus genomi...c 40.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: mitochondri...ATGAAGAAGATCAAATCGAAAATTAAATATATAAAAAATTTTAAATAAAAATAAAAA TAAAGAAATAATAAAAAAAATATTATTTTTTTA sequence update

  3. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    G. González Bonorino; J. I. Boyce; B. B. Koseoglu

    2003-01-01

    Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ...

  4. Técnica manipulativa de descomprensión en esguince de tobillo

    Rodríguez Monteverde, Juan Ignacio

    2015-01-01

    Nos encontramos hoy en día ante un amplio abanico de tratamientos y terapias destinadas a la rehabilitación del esguince de tobillo, con diferentes metodologías, procedimientos, puntos de vista y disensos entre quienes ejecutan estas prácticas. De este abanico de alternativas, a veces deriva ineludiblemente, una confusión en el abordaje de esta patología, que se estima es la más frecuente del ser humano. Ante esto, surge la necesidad imperiosa de identificar herramientas terapé...

  5. Avaliação de um conjunto de bicos para uso em uma barra para aplicação de herbicidas em lavouras de café em formação

    Gilton José Rodrigues; Mauri Teixeira Martins; Lino Roberto Ferreira; Haroldo Carlos Fernandes; Mario Herrera Prat

    2004-01-01

    El objetivo de este trabajo fue evaluar un conjunto de boquillas del tipo abanico para usarla en una barra de pulverización, para la aplicación de herbicidas en labores del café en formación. Para esto, fueron evaluados cinco boquillas hidráulicas de chorro plano, tipo abanico de distribución uniforme (80-EF-015, 80-EF-02 e 80-EF-03), así como la distribución volumétrica del líquido, proporcionada individualmente por cada boquilla, se utilizó una barra de pulverización situada ...

  6. Dicty_cDB: Contig-U11022-1 [Dicty_cDB

    Full Text Available 35 5 ( EH079886 ) PMECF85TO Perkinsus marinus large insert cDNA lib... 42 0.048 2 ( ET095291 ) QM0AAA22BH01FM1 CCL1...gylocentrotus purpuratus clone R3-3085L11, W... 40 0.14 2 ( AC180454 ) Strongylocentrotus purpuratus clone R...022-1Q) /CSM_Contig/Contig-U11022-1Q.Seq.d CAAATACACTCAGACAGGGTTGCAAATGCGTTGAATTGGACGTTTGGGAT GGTAATGATGGTGATCC...DNA sequence from clone CH211-51L17 in ... 52 0.060 1 ( BX324154 ) Zebrafish DNA ... SP_1031_A2_E05_SP6E Strongylocentrotus purpuratus... 42 0.075 2 ( EL354039 ) CCEM10702.b4_L12.ab1 CC

  7. Geología y minería

    Puche Riart, Octavio

    1986-01-01

    Nuevos campos da aplicación y nuevas tecnologías abren ampliamente el abanico de posibilidades formativas de los Ingenieros Técnicos da Minas. Y como no debemos quedar al margen de los avances científicos , hay que desarrollar canales nutritivos de conocimiento.

  8. La biblioteca pública al servicio de la comunidad

    Domínguez Sanjurjo, María Ramona; Merlo Vega, José Antonio

    2001-01-01

    El artículo pone de relieve el papel de las bibliotecas públicas en la sociedad de la información que tiende a integrarlas cada vez más en la comunidad, extendiendo el abanico de información que ofrece a cuestiones relacionadas con la vida cotidiana y el ejercicio de los derechos de los ciudadanos.

  9. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.

  10. Dicty_cDB: Contig-U01942-1 [Dicty_cDB

    Full Text Available W... 46 0.75 1 ( AC179610 ) Strongylocentrotus purpuratus clone R3-1028M04, W... 46 0.75 1 ( FG646102 ) CSRLCD001_05-G10-pAL17d Heal...thy leaf tissue Solan... 46 0.75 1 ( BM579253 ) 17000687237959 A.Gam.ad.cDNA.blood1

  11. NCBI nr-aa BLAST: CBRC-DDIS-04-0127 [SEVENS

    Full Text Available CBRC-DDIS-04-0127 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 1e-22 ...

  12. NCBI nr-aa BLAST: CBRC-DSIM-08-0061 [SEVENS

    Full Text Available CBRC-DSIM-08-0061 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 4e-42 ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-1530 [SEVENS

    Full Text Available CBRC-PHAM-01-1530 ref|NP_999775.1| spicule matrix protein SM50 precursor [Strongylo...centrotus purpuratus] sp|P11994|SM50_STRPU RecName: Full=50 kDa spicule matrix protein; Flags: Precursor gb|AAA30071.1| spic

  14. Dicty_cDB: Contig-U13236-1 [Dicty_cDB

    Full Text Available .3 4 ( AC173720 ) Strongylocentrotus purpuratus clone R3-1008M14, W... 38 2.4 5 ( AY858561 ) Hermeuptychia hermes...6 2.6 2 ( AY858562 ) Hermeuptychia hermes isolate CTBEH144 cytochrome ... 36 2.7 2 ( CU442744 ) Pig DNA sequ...ence *** SEQUENCING IN PROGRESS *** f... 40 2.7 2 ( AY858563 ) Hermeuptychia hermes

  15. Estrategias reproductivas de moluscos bivalvos y equinoideos

    Calvo, J.; Morriconi, E.; Orler, P.

    1998-01-01

    The theoretical aspects of reproductive strategies and life histories are analyzed. The gonadal structures and the main features of gametogenesis of bivalves and echinoids are described. Research on the reproductive characteristics and gametogenic cycles of the bivalve molluscs in the Argentinian littoral and the echinoid Loxechinus albus is reviewed. Special references to Mytilus edulis, Aulacomya ater, Brachidontes purpuratus, Aequipecten tehuelchus, Zygochlamys patagonica, Ostrea puelchana...

  16. Dicty_cDB: Contig-U05840-1 [Dicty_cDB

    Full Text Available lone R3-12G8, WORK... 52 0.017 1 ( AC180970 ) Strongylocentrotus purpuratus clone R3-3059B02, W... 52 0.017 1 ( AC139728 ) Carol...lia perspicillata clone 29G20, complete sequ... 48 0.27 1 ( AC150467 ) Carol

  17. Dicty_cDB: Contig-U05052-1 [Dicty_cDB

    Full Text Available nom... 34 2.7 3 ( AC149914 ) Strongylocentrotus purpuratus clone R3-12I13, WOR... 36 2.8 9 ( AC146769 ) Carol... HindIII BAC Library Solanum lycoper... 36 5.9 3 ( AC146829 ) Carollia perspicillata clone 9I15, WORKING DRA

  18. Dicty_cDB: Contig-U15705-1 [Dicty_cDB

    Full Text Available ... 32 5.8 2 ( AC180698 ) Strongylocentrotus purpuratus clone R3-3087F16, W... 38 5.9 7 ( CB939163 ) IpCGJ...x13_43_E10_23 IpCGJx13 Ictalurus punctatus c... 38 5.9 2 ( EJ010891 ) 1095403698687

  19. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Sadhna Phanse; Cuihong Wan; Blake Borgeson; Fan Tu; Kevin Drew; Greg Clark; Xuejian Xiong; Olga Kagan; Julian Kwan; Alexandr Bezginov; Kyle Chessman; Swati Pal; Graham Cromar; Ophelia Papoulas; Zuyao Ni

    2015-01-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium ...

  20. Geophysical survey in `Albanico El Paso` Cochabamba - Bolivia; Levantamento geofisico no `Albanico El Paso` Cochabamba - Bolivia

    Ellert, N.; Rodas, C.S. [Sao Paulo Univ., SP (Brazil). Inst. de Geociencias; Ricaldi, V.; Jaldin, L.A. [Corporacion para el Desarrollo de Cochabamba (Bolivia)

    1994-12-31

    Vertical electrical soundings were measured in the Cochabamba sedimentary basin at several alluvial fans (locally called `abanicos`). This paper presents data from the Abanico El Paso. This research attempted to correlate geophysical data with the presence of paleo-channels inside the alluvial fans. These fans, mostly concentrated at the foot of the Cordilheira Ocidental, are about 1 km across and up to 4 km long. Data from deep wells were used to establish a correlation between the geophysical and hydrogeological data. The specific yield of the deep wells can be correlated with the grain size of the sediments. Apparent resistivity values of the vertical electrical soundings, for several AB/2 spacing were used to construct resistivity profiles, where the distance between each measured points correspond to the distances between the points where a vertical electrical sounding was measured. Once again, the electro-resistivity method demonstrated its potentiality as an exploration tool. (author). 3 refs., 14 figs.

  1. Personalización de perfiles de notificación de aplicaciones según el contexto del usuario

    LÓPEZ GUERRERO, IGNACIO

    2012-01-01

    En los últimos años los teléfonos móviles inteligentes (smartphones) se han convertido en un objeto indispensable en nuestras vidas cotidianas, esto ha provocado la aparición de todo un gran ecosistema de potentes sistemas operativos móviles, como iOS, Android o Windows Phone 7, y un gran abanico de aplicaciones compatibles con estos sistemas...

  2. Bases para la intervención emocional con hermanos de niños con discapacidad intelectual

    Iriarte Redín, Concha; Ibarrola-García, Sara

    2010-01-01

    Introducción. El presente trabajo pone de relieve la necesidad de prestar atención a la vivencia emocional de la discapacidad intelectual por parte de los hermanos. Lejos de ignorar, minimizar o sobredimensionar sus necesidades psicosociales se apuesta por tener en cuenta el amplio abanico de aspectos emocionales tanto positivos como negativos que puede conllevar el hecho de tener un hermano con discapacidad intelectual. Ello resultará tremendamente útil a la hora intervenir y ...

  3. Inserci??n laboral de docentes noveles del Nivel Medio en la Argentina. Una aproximaci??n a partir de los egresados de la Universidad Nacional de General Sarmiento

    Serra, Juan Carlos; Krichesky, Graciela; Merodo, Alicia

    2011-01-01

    El prop??sito de este art??culo es presentar algunos resultados de la investigaci??n ???De estudiantes a profesores: primeros desempe??os profesionales en secundarios del conurbano bonaerense??? que tuvo entre sus objetivos analizar los problemas y necesidades de los graduados de los profesorados en sus primeros ejercicios profesionales, interpretados en el marco de la heterogeneidad de sus trayectorias personales y profesionales. Las trayectorias analizadas reflejan un abanico...

  4. Potencialidad del desarrollo de hipotecas inversas como complemento pensionario: el caso de Chile

    Javier Alonso; David Tuesta; Maria Lamuedra

    2013-01-01

    Las hipotecas inversas se han venido constituyendo en una alternativa para generar flujos de ingresos liquidos durante la etapa de jubilacion en algunos paises desarrollados. Teniendo en cuenta que los riesgos de menores recursos durante la etapa de vejez suelen ser enfrentados con un abanico amplio de fuentes de financiamiento, el presente trabajo analiza las potencialidades del desarrollo de las hipotecas inversas como alternativa de ingresos para la vejez. El trabajo se centra en el estudi...

  5. Redes y desarrollo profesional del docente: entre el dato Serendipiti y el foro de trabajo colaborativo

    Jesús Salinas

    1998-01-01

    El art??culo versa sobre las posibilidades de la red en el desarrollo profesional del docente. Describe las principales oportunidades que las redes ofrecen para el desarrollo personal y profesional del docente. Abarcan un amplio abanico desde el acceso aleatorio a datos valiosos (el dato serendipiti, que surge a partir del cotejo de otros datos sin que haya sido buscado de manera deliberada), hasta verdaderos programas de trabajo colaborativo en la creaci??n de materiales ...

  6. Análisis multi-proxy paleoambiental y modelización de registros sedimentarios fluviales en los Alpes Suizos

    Ferreira de Carvalho, Rui Filipe

    2014-01-01

    El estudio de sistemas fluviales mediante el análisis de testigos sedimentarios supone una oportunidad singular para comprender los patrones espaciales y temporales que rigen la dinámica de la agradación fluvial bajo la influencia de diferentes fuerzas motrices, como son la variabilidad climática o las actividades humanas. Los abanicos aluviales y deltas de los principales valles alpinos de modelado glaciar son importantes cubetas sedimentarias (Hinderer, 2001), que proporcionan registros sed...

  7. Ser minero. El contexto cultural generado por la minería industrial (siglos XIX-XX en el sur de la Península Ibérica

    CANO SANCHIZ, J.M.

    2014-01-01

    de la hibridación entre globalización y endemismo: el pueblo minero contemporáneo del sur de la Península Ibérica. Para ello, se combinan técnicas de estudio arqueológicas y antropológicas (de campo y de escritorio, que se aplican sobre un amplio abanico de fuentes: cultura material, memoria oral, documentación histórica e informaciones turísticas.

  8. Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia) Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia)

    Romero Ordóñez F. H.; Schultz-Güttler R. A.; Chavez-Gil T.

    1996-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  9. Ocurrencias diamantíferas de la quebrada alba rosa, caño guapayito, guainía, colombia (primera ocurrencia comprobada de diamantes en colombia)

    Romero Ordóñez, F. H.; Schultz-Güttler, R. A.; Chavez-Gil, T.

    2012-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  10. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  11. Karyotypes of three species of the marine Veneroida molluscs

    Sun Zhenxing; Shao Yanqun; Guo Shengchao; Qin Yan; Yang Aiguo

    2003-01-01

    The karyotypes of three species of marine Veneroida molluscs, Solen grandis Dunker,Saxidomus purpuratus Sowerby and Mactra chinensis Philippi were studied by using the adult gill tissues. The chromosomes were prepared through injecting phytohemagglutinin (PHA) and colchicine, hypotonic treatment, chopping air-dry, and squashing technology. The results show that the diploid chromosome numbers of the three Veneroida species are the same as 2 n = 38. The karyotype of Solen grandis is 26m + 6sm + 2st + 4t, NF = 70, the karyotype of Saxidomus purpuratus is 32m + 2sm + 4st/t, NF = 72, and the karyotype of Mactra chinensis is 20m + 16sm + 2st/t, NF = 74. Satellite and sex chromosome were not found among the chromosomes of three species.

  12. Dicty_cDB: Contig-U09442-1 [Dicty_cDB

    Full Text Available uct DNA, clone: pF... 39 0.13 DQ120651_1( DQ120651 |pid:none) Pan troglodytes RBM1 gene, partia...nomi... 37 0.51 AB325927_1( AB325927 |pid:none) Sorogena stoianovitchae stf4 mRNA ... 37 0.51 AP008210_766( ... Entamoeba histolytica small heat shock protein (H... 40 0.23 2 ( AC177962 ) Strongylocentrotus purpuratus c...lone R3-3049H23, W... 48 0.42 1 ( AC177453 ) Strongylocentrotus purpuratus clone R3-1030K24, W... 48 0.42 1 ...m clone CH211-67N10 in ... 46 1.7 1 ( AC149872 ) Xenopus tropical

  13. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut Geomorphological evolution and relative chronology of terrace levels adjacent to the Chubut River mouth to the Atlantic (Chubut Province.

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.An ancient alluvial fan and its subsequent evolution are described. Ancient alluvial fan accumulations have been interpreted as the northern continuation of the rodados patagónicos of the Montemayor Plateau, a proposal

  14. Lectins with Potential for Anti-Cancer Therapy

    Tammy Yau

    2015-02-01

    Full Text Available This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygonatum odoratum lectin, autophagy inducing lectins include annexins and Polygonatum odoratum lectin.

  15. A Genomic View of the Sea Urchin Nervous System

    Burke, RD; Angerer, LM; Elphick, MR; Humphrey, GW; Yaguchi, S; Kiyama, T.; Liang, S.; Mu, X.; Agca, C; Klein, WH; Brandhorst, BP; Rowe, M.; Wilson, K.; Churcher, AM; Taylor, JS

    2006-01-01

    The sequencing of the Strongylocentrotus purpuratus genome provides a unique opportunity to investigate the function and evolution of neural genes. The neurobiology of sea urchins is of particular interest because they have a close phylogenetic relationship with chordates, yet a distinctive pentaradiate body plan and unusual neural organization. Orthologues of transcription factors that regulate neurogenesis in other animals have been identified and several are expressed in neurogenic domains...

  16. Organization of an echinoderm Hox gene cluster

    Martinez, Pedro; Rast, Jonathan P.; Arenas-Mena, César; Davidson, Eric H.

    1999-01-01

    The Strongylocentrotus purpuratus genome contains a single ten-gene Hox complex >0.5 megabase in length. This complex was isolated on overlapping bacterial artificial chromosome and P1 artificial chromosome genomic recombinants by using probes for individual genes and by genomic walking. Echinoderm Hox genes of Paralog Groups (PG) 1 and 2 are reported. The cluster includes genes representing all paralog groups of vertebrate Hox clusters, except that there is a sing...

  17. Rapid accumulation of an interleukin 17 homolog transcript in Crassostrea gigas hemocytes following bacterial exposure

    Roberts, S; Gueguen, Yannick; De Lorgeril, Julien; Goetz, F

    2008-01-01

    Interleukin-17 (IL-17) gene models have been found in the sequenced genomes of Strongylocentrotus purpuratus and Caenorhabditis elegans. However, there have been no published reports on the empirical cloning and characterization of any interleukin cDNAs in invertebrates. From a Pacific oyster (Crossostrea gigas) hemocyte cDNA library, two clones were obtained that encoded a protein similar to vertebrate IL-17s. The putative oyster IL-17 homolog (CgIL-17) was 27% identical to rainbow trout IL-...

  18. Dicty_cDB: SHF413 [Dicty_cDB

    Full Text Available nnesssqgsnnessnnesnnqnsnnesshkeesesnshqss eteskdqvsnsgsmnqssessessslseqssafessssss...kdqvsnsgsmnqssessessslseqssafessssssgnsqsksse Frame B: lyylnnymyifvfk**kiifl*fffnikr...k*iivfirtklcf*ifviiew*fsikik*k Homology vs CSM-cDNA Score E Sequences producing s...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N A... SEQUENCE, 40 unordered pieces. 32 0.010 3 AC180650 |AC180650.1 Strongylocentrotus purpuratus clone R3-3090E

  19. Cis-regulatory control of the nodal gene, initiator of the sea urchin oral ectoderm gene network

    Nam, Jongmin; Su, Yi-Hsien; Lee, Pei Yun; Robertson, Anthony J; Coffman, James A.; Davidson, Eric H.

    2007-01-01

    Expression of the nodal gene initiates the gene regulatory network which establishes the transcriptional specification of the oral ectoderm in the sea urchin embryo. This gene encodes a TGFβ ligand, and in Strongylocentrotus purpuratus its transcription is activated in the presumptive oral ectoderm at about the 30-cell stage. Thereafter Nodal signaling occurs among all cells of the oral ectoderm territory, and nodal expression is required for expression of oral ectoderm regulatory genes. The ...

  20. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Judith eLevine; Lowe, Christopher J.; Maria Ina Arnone; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea) and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely...

  1. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largel...

  2. Dynamic Evolution of Toll-Like Receptor Multigene Families in Echinoderms

    Buckley, Katherine M; Rast, Jonathan P.

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like re...

  3. RNA Deep Sequencing Reveals Differential MicroRNA Expression during Development of Sea Urchin and Sea Star

    Kadri, Sabah; Hinman, Veronica F.; Benos, Panayiotis V.

    2011-01-01

    microRNAs (miRNAs) are small (20–23 nt), non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin) and Patiria miniata (sea star) are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs d...

  4. Lectins with Potential for Anti-Cancer Therapy

    Tammy Yau; Xiuli Dan; Charlene Cheuk Wing Ng; Tzi Bun Ng

    2015-01-01

    This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygo...

  5. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    Dora A. Taboada P.; Haydée Russac; Carolina Ramos de Ormachea

    2014-01-01

    En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos molusco...

  6. Proteome Sci.

    Mann Matthias; Poustka Albert J; Mann Karlheinz

    2010-01-01

    Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the deter...

  7. Dicty_cDB: Contig-U05011-1 [Dicty_cDB

    Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..

  8. Sea Urchin Recruitment: Effect of Substrate Selection on Juvenile Distribution

    Cameron, R. A.; Schroeter, S. C.

    1980-01-01

    Intertidal field observations have shown that juvenile purple sea urchins Strongylocentwtus purpuratus are found in higher densities near adults . The same is true for subtidal populations of juvenile red sea urchins 5. franciscanus. These distribution patterns could be influenced by any of three elements: substrate selection, early juvenile mortality or juvenile migration. Using laboratory-reared larvae, we conducted experiments designed to gauge the effect of substrate selection on ju...

  9. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    L Courtney Smith

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence...

  10. Sea urchin vault structure, composition, and differential localization during development

    Dickey-Sims Carrie; Lang Jennifer; Makabi Miriam; Stewart Phoebe L; Robertson Anthony J; Coffman James A; Suprenant Kathy A

    2005-01-01

    Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Resul...

  11. Las herramientas terminológicas en los sistemas de información jurídica

    Alvite Díez, María Luisa

    2004-01-01

    P. 77-90 Se analizan los instrumentos terminológicos integrados en las interfaces de las bases de datos jurídicas Aranzadi, Iberlex y La Ley, seleccionadas por su alta implantación en unidades de información. Se observa un abanico de soluciones que abarca desde las simples listas de palabras clave hasta los tesauros de estructura navegacional. Se aprecian diferencias sustanciales entre las bases de datos legislativas y las jurisprudenciales. Aunque constituyen instrumentos potentes para la...

  12. Matemática aplicada a ciertos problemas de la edificación

    Mena Requena, María Rosa

    2015-01-01

    Los problemas de álgebra lineal como, por ejemplo, sistemas de ecuaciones lineales o problemas de mínimos cuadrados, aparecen en un amplio abanico de aplicaciones de casi todas las áreas científicas y tecnológicas. En particular, problemas de este tipo surgen en el análisis de la resistencia de estructuras de hormigón, cálculo de estructuras, la estimación de la órbita de los electrones, la evaluación del campo gravitatorio terrestre, la simulación de circuitos VLSI, el control...

  13. Modelos para la gestión óptima de aprovisionamiento y de personal en una empresa de restauración: aplicación a caso real

    Mendia Mingo, Amaia

    2014-01-01

    En el ámbito de la restauración, la imagen y las sensaciones que cada cliente se lleve tras una visita al establecimiento son claves para la prosperidad del negocio, puesto que la gran oferta de restaurantes da al cliente un gran abanico de opciones entre las que destacar o descartar. La disponibilidad de recursos materiales y humanos, es esencial para poder ofrecer un servicio satisfactorio, puesto que son los factores más importantes de la experiencia culinaria. Es por ello que el presente ...

  14. Descubrimiento y geolocalización mediante redes Wi-Fi

    Pérez Blanco, Carlos

    2010-01-01

    En la actualidad la gran mayoría de dispositivos móviles disponen de diversos sistemas de localización, siendo el GPS el más habitual. Gracias a ello nuestro dispositivo conoce en cualquier momento la posición en la que nos encontramos, dando pie a un extenso abanico de posibilidades. Posiblemente la más popular sea la navegación, pero conocer nuestra localización tiene muchas otras aplicaciones. Por ejemplo, podemos crear una aplicación de chat en la que las personas con las que podemos chat...

  15. Régimen fiscal de la minería. Propuestas para una actividad sostenible

    Fernández Gómez Del Castillo, Ana María

    2015-01-01

    Por todos es bien conocida la histórica riqueza minera de España, cuyo subsuelo contiene importantes yacimientos conocidos y aprovechados, constituyendo la variedad e importancia de éstos un amplio abanico para las iniciativas privadas que desarrollan actividades de exploración, investigación y explotación, y dando motivo suficiente al Estado para legislar sobre el tema, todo ello unido a la importancia estratégica del suministro de materias primas en la producción industrial como pilar básic...

  16. Cómo aplicar árboles de decisión en SPSS

    Vanesa Berlanga-Silvente; María-José Rubio-Hurtado; Ruth Vilà-Baños

    2013-01-01

    Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos) que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con ...

  17. Metodología para seleccionar tecnologías Web 2.0 para la docencia

    Grangel, R.; Campos, C.; Rebollo, C.; Remolar, I.; Palomero, S.

    2012-01-01

    Actualmente existe un gran auge en el uso y difusión de las herramientas Web 2.0 tanto en el contexto profesional como en el personal. Su aplicación al ámbito de la docencia, tal y como sugieren algunos estudios, puede tener numerosas ventajas. Sin embargo, el abanico de herramientas Web 2.0 es muy amplio y por tanto sería de utilidad disponer de una metodología que pudiera guiar al docente a la hora de elegir la tecnología más adecuada a su proceso de enseñanza-...

  18. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico Interstitial cystitis: A challenge for the clinician

    Pablo Young; Bárbara C. Finn; Martín González; Laura P. Comercio; Mariano Quezel; Julio E. Bruetman

    2010-01-01

    La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades ter...

  19. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    2010-01-01

    La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades ter...

  20. Hipergranulación en heridas crónicas: un problema ocasional pero no infrecuente Hypergranulation of chronic wounds: an occasional but not infrequent problem

    Daniel Chaverri Fierro

    2007-01-01

    La hipergranulación es un problema ocasional, pero a la vez no infrecuente, con el que se enfrentan muchos clínicos responsables del tratamiento de heridas en su práctica diaria. Este fenómeno ocurre en un amplio abanico de heridas que incluyen las incisiones y heridas posquirúrgicas, los estomas (gastrostomías, traqueostomías, etc.) y las heridas crónicas. El objetivo del presente artículo es cuantificar y analizar la evidencia generada en torno al tema de la hipergranulación en las heridas ...

  1. La integración de conocimientos en ciencias mediante una propuesta de uso de materiales multimedia

    Carreri, Ricardo A.; Alzugaray, Gloria E.; Marino, Luis A.

    2008-01-01

    Las propuestas didácticas para la enseñanza y el aprendizaje de las ciencias requieren en la actualidad del diseño y aplicación de recursos educativos que incorporen el uso de las TIC. El abanico de temas que pueden abordar los alumnos en relación a su formación profesional y ciudadana; es amplio y diverso. Así por ejemplo además de cuestiones sobre género, arte, trabajo, recreación y deporte, salud, alimentación y drogas, se incluyen temáticas vinculadas al medio ambiente, la comunicac...

  2. Hepatitis B-cuadro clínico

    Jorge Patiño-Masís

    2008-01-01

    Las manifestaciones clínicas de la hepatitis viral tipo B tienen un amplio abanico de presentaciones, dependiendo de muchos factores, algunos desconocidos y otros, perfectamente identificables: subtipo del virus, características genéticas del huésped, estado inmunológico en el momento de la inoculación, carga viral y vía de entrada de dicha inoculación, entre los más importantes. La clínica de la hepatitis viral por virus B tanto aguda como crónica puede ser desde síntomas inespecíficos sin i...

  3. Beacons BLE (Bluetooth Low Energy) en el sector turístico, control de afluencia y servicios de valor añadido

    Arregui Caballero de Tineo, Arkaitz

    2016-01-01

    Con la aparición del Bluetooth Smart y su bajo consumo, se ha abierto un nuevo abanico de posibilidades para las experiencias de proximidad. El uso de beacons Bluetooth Smart hace posible crear nuevas relaciones Proveedor-Usuario mediante la detección de usuarios que se acercan a una localización concreta. El bajo coste de los dispositivos BLE unido a la posibilidad de estar activo por largos periodos de tiempo con una pila de botón, permite marcar un lugar mediante un beacon con independenci...

  4. Estratigrafía de la Formación del Crestón, sierra de Famatina, Argentina: Sedimentación paleógena en el antepaís andino?

    F. M. Dávila

    2002-12-01

    Full Text Available Se redescriben y analizan los espesos depósitos de la Formación del Crestón (>1700m en el antepaís andino en la región del Famatina (Provincia de La Rioja, que en el pasado han sido relegados. Se definen sus paleoambientes y se discute su posición estratigráfica, edad y significado en el contexto de los depósitos sinorogénicos de la región del antepaís fragmentado. La unidad, dominantemente areno-conglomerádica y de color rojo-morada registra una evolución en dos megaciclos granoestratocrecientes que representan una progresión desde etapas con escaso relieve a depósitos gruesos que caracterizan sectores proximales de abanicos aluviales. En el megaciclo inferior se suceden barreales (fangosos y salinos, abanicos terminales y abanicos aluviales de baja eficiencia mientras que en el ciclo superior se suceden depósitos de barreales, depósitos de sistemas entrelazados mixtos y abanicos aluviales de alta eficiencia. La diferencia composicional entre los conglomerados cuspidales de cada ciclo permite asociar el primero a devastación de cúpulas y coladas volcánicas andesíticas mientras que el segundo se vincula con exhumación de cuerpos granitos que conforman parte del marco de antepaís fragmentado. En este trabajo, y a partir de relaciones de campo, los depósitos de la Formación del Crestón se consideran como antecesores de los clásicos depósitos sinorogénicos neógenos (Grupo Angulos y se relacionan con evidencias aportadas por trazas de fisión y actividad orogénica en otras regiones de los Andes centrales para sostener que la unidad puede representar el registro más antiguo de la sedimentación de antepaís preservado en esta región. Asimismo, se infiere que el inicio de la fragmentación del antepaís andino y la evolución geológica de la región de Famatina es bastante más compleja de lo establecido con anterioridad.

  5. Mediamorphosis and misinformation in the infosphere : media, digital and information literacy face of changes in information consumption habits

    Juan Ignacio AGUADED; Romero-Rodríguez, Luis M.

    2015-01-01

    Desde la reflexión teórica, este trabajo evidencia que el ecosistema comunicacional y digital actual es endógeno y sistémicamente desinformativo, pues se ha convertido paulatinamente en un escenario sobresaturador e infoxicador, atravesado por una dinámica de mediamorfosis, en la que los medios tradicionales buscan competir por la preferencia de la audiencia frente al abanico de propuestas digitales en razón de su subsistencia económica, generalmente intentand...

  6. Estudio de tensioactivos aniónicos y catiónicos derivados de lisina: interacción con membranas celulares, desarrollo de sistemas nanoestructurados para la liberación intracelular y evaluación toxicológica in vitro

    Rubert Nogueira, Daniele

    2013-01-01

    [spa] Los tensioactivos son compuestos altamente versátiles con amplia utilización en la industria farmacéutica y cosmética. Aquellos derivados de aminoácidos presentan una baja toxicidad y elevada biodegradabilidad y, por lo tanto, tienen un abanico más amplio de aplicaciones y constituyen una alternativa a los tensioactivos sintéticos convencionales. En los últimos años, existe un interés creciente en la utilización de excipientes bioactivos con actividad lítica pHsensible en sistemas nanoe...

  7. Niños con necesidades educativas especiales y terapias asistidas con animales

    García Novillo, Blanca

    2013-01-01

    Este es un Trabajo Final del Grado, centrado en los alumnos de “necesidades educativas especiales” y en lo importante de elegir una buena metodología para dar respuesta a sus necesidades integrando animales de compañía en su día a día, construyendo de esta forma una escuela inclusiva. En cada escuela y en cada clase hay un ciclo de evaluación, planificación, enseñanza y revisión de las necesidades de todos los niños. Esos estudios generales tienen en cuenta el amplio abanico de habilidades, a...

  8. La atención a los padres con hijos con necesidades educativas especiales (NEE)

    Claudia María Pernas Pico

    2011-01-01

    Los padres que tienen hijos con necesidades educativas especiales (NEE) necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, et...

  9. Historia del crecimiento económico: una propuesta de recursos didácticos

    Bringas Gutiérrez, Miguel Ángel; Catalán Martínez, Elena

    2013-01-01

    RESUMEN. Con esta comunicación queremos dar a conocer la renovada sección de docencia que la Asociación Española de Historia Económica ha publicado en su página web recientemente. Esta página pretende estimular y promover la enseñanza de la economía del crecimiento y de la Historia Económica a través de un amplio abanico de herramientas y recursos didácticos que contribuyan a la renovación de los métodos docentes en las aulas universitarias.

  10. Soft-computing based visual control for unmanned vehicles

    Olivares Méndez, Miguel Ángel

    2013-01-01

    El objetivo principal de esta Tesis es extender la utilización del “Soft- Computing” para el control de vehículos sin piloto utilizando visión. Este trabajo va más allá de los típicos sistemas de control utilizados en entornos altamente controlados, demonstrando la fuerza y versatilidad de la lógica difusa (Fuzzy Logic) para controlar vehículos aéreos y terrestres en un abanico de applicaciones diferentes. Para esta Tesis se ha realizado un gran número de pruebas reales en las cuales los cont...

  11. Un Simulador empresarial como herramienta práctica para la asignatura de Aprendizaje Automático

    Fuentetaja, Raquel; Castro, Silvia; García, Javier; Fernando FERNÁNDEZ; Borrajo, Daniel; Borrajo, Fernando

    2010-01-01

    En este artículo se plantea el uso de un simulador empresarial (SIMBA) como dominio de aplicación de las prácticas de la asignatura de Aprendizaje Automático (AA). El objetivo principal es que los alumnos se enfrenten a un entorno realista en el que tengan que plantear y ofrecer soluciones basadas en AA. El contexto de la toma de decisiones empresarial ofrece un amplio abanico de aplicaciones, desde el análisis de datos (predicción de resultados empresariales, análisis de perfiles de decis...

  12. El conflicto en el software: una aproximación al fenómeno del fork en los proyectos de software libre

    Taravilla Herrera, Javier

    2013-01-01

    La presente investigación pretende ampliar el marco de trabajo de los estudios actuales en filosofía o sociología de la tecnología, mediante un acercamiento a una práctica surgida en las comunidades y movimiento de Software Libre de los últimos años conocida como “fork”. Un ejercicio que consiste inicialmente en hacer una copia del código fuente de un programa para desarrollarlo en una dirección distinta de la original, pero que analizada en detalle sugiere un amplio abanico de cuestiones rel...

  13. La complejidad de vivir la ciudadanía en el aula: Análisis en cuatro centros de secundaria

    Parareda-Pallarès, Alba; Simó-Gil, Núria; Domingo-Peñafiel, Laura; Soler-Mata, Joan

    2016-01-01

    Este artículo describe y analiza un abanico de prácticas democráticas en cuatro centros de secundaria que se basan en principios relacionados con la vivencia de la ciudadanía y pone de relieve las posibilidades y límites que estas plantean. Se enmarcan dentro de un proyecto de investigación que analiza procesos participativos y democráticos en centros educativos, con la intención de promover y mejorar su cultura democrática, participativa e inclusiva y sus prácticas diarias a partir del conce...

  14. Structuration and Integration of Magnetic Molecules and Nanoparticles on Surfaces and Devices by Directwrite AFM Lithography

    Bellido Vera, Elena

    2011-01-01

    La progresiva miniaturización de los materiales a la escala nanométrica ha abierto en la última década nuevas expectativas en el campo de la Ciencia de Materiales. Dichos materiales nanométricos presentan propiedades únicas, difiriendo a menudo de las propiedades del propio material a la macroescala, las cuales abren un amplio abanico de nuevas fenomenologías, y en consecuencia, de aplicaciones tecnológicas. De especial interés han sido los nanomateriales magnéticos, incluyendo las nanopartíc...

  15. Aplicación móvil multiplataforma para el aprendizaje de lenguajes de programación. Caso práctico con Swift

    Román Bengoechea, Álvaro

    2015-01-01

    En este proyecto se ha estudiado el abanico de posibilidades que las plataformas web y móviles ofrecen para aprender lenguajes de programación compilados. A continuación, se ha realizado el diseño y la implementación de una plataforma para el aprendizaje de lenguajes de programación desde dispositivos móviles, con posibilidad de compilación remota desde la aplicación desarrollada, analizando el proceso y las elecciones de desarrollo tomadas. Así, se ha desarrollado una app mediante la p...

  16. Manipulación genética: el nuevo monstruo de Frankenstein en el cine

    Prada Pérez, Francisco Javier de

    2007-01-01

    [ES] El cine se ha ocupado en multitud de ocasiones de lanzar los interrogantes que abren los avances científicos y su repercusión en la vida del ser humano. No en vano la ciencia ficción es un género consagrado a esa tarea, la de intentar predecir hacia dónde camina la humanidad gracias a la aplicación de nuevos descubrimientos. La manipulación genética, por su extraordinario abanico de posibilidades, no podía escapar a guiones que intentaran vislumbrar las aplicaciones que la sociedad pudie...

  17. Cooking Stardust

    Marciel Martín, Sara

    2015-01-01

    Cooking Stardust es una aplicación Android de recetas de cocina. Con sólo introducir algunos de los ingredientes que haya en la nevera, se abrirá todo un abanico de posibilidades culinarias, teniendo en cuenta el estado de salud o simplemente los gustos a la hora de sentarse a la mesa. Una forma cómoda y sencilla de intentar facilitar una de las tareas diarias más difíciles y que tantos quebraderos de cabeza puede causar. Además de mostrársele las diferentes recetas de comida que cumplan c...

  18. Estudio de la corrosión electroquímica en los bronces de aluminio con níquel (NAB)

    Rey Ruiz, Alberto

    2014-01-01

    RESUMEN: Los bronces al aluminio con níquel, más conocidos como NAB, Nickel Aluminiun Bronzes, por sus siglas en inglés, cubren con solvencia un amplio abanico de aplicaciones y soluciones constructivas en el medio marino. En ambientes de agua dulce la familia de materiales predominante son los aceros inoxidables. En situaciones y ambientes específicos, como pueden ser centrales hidroeléctricas especificas, se debe recurrir a aceros inoxidables especiales u otras familias...

  19. Procesos de documentación arqueológica y generación de modelos virtuales

    Josep Blasco Senabre; Sebastián Varea; Fernando Cotino Vila; Albert Ribera Lacomba; Oreto García Puchol

    2011-01-01

    En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L) en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de ob...

  20. Design and evaluation of admission control policies in mobile cellular networks

    BERNAL MOR, ELENA

    2013-01-01

    Durante los últimos años las redes móviles celulares han experimentado un considerable crecimiento y desarrollo debido al nuevo modo en que la sociedad crea, comparte y consume información. El enorme impacto y penetración de los servicios móviles telefónicos en la sociedad actual, así como la introducción de un amplio abanico de nuevos servicios de datos y servicios multimedia, han llevado a un crecimiento espectacular del volumen de tráfico transportado por este tipo de redes....

  1. Maternidad subrogada: revisión bibliográfica

    Ruiz Martínez, Rocío

    2013-01-01

    Los avances y descubrimientos científicos han desarrollado técnicas de reproducción asistida como alternativa a la esterilidad. El nuevo abanico de posibilidades que ofrecen la genética y la técnica a la humanidad, plantea problemas que tendremos que ir resolviendo. Estas posibilidades no solo permiten separar la procreación de la unión sexual entre el hombre y la mujer, sino también que ésta pueda realizarse sin la participación biológico-genética y /o sin el conocimiento del otro miembro de...

  2. Entorno de control y gestión de instrumentación médica

    Hernández Orejón, Xavier

    2007-01-01

    Este proyecto final de carrera describe el diseño y la implementación de un proyecto de innovación de un dispositivo estético de la empresa Rös’s estética y electromedicina s.a. El objetivo principal es actualizar la electrónica del dispositivo, con el fin de poder integrarlo a las nuevas tecnologías de la información y la comunicación, permitiendo abrir un abanico de posibilidades para controlarlo y gestionarlo. El proyecto pretende mostrar a la empresa cliente la posibi...

  3. Luces en la Sombra: Educación artística, teatro, mujer y centros penitenciarios.

    Martín Fernández, Sara

    2015-01-01

    Este proyecto refleja la importancia de la creación de nuevos modelos educativos, en el ámbito social, basados en el Arte y la Educación Artística. Se indica como punto de referencia las herramientas artísticas, como elementos de transformación social, las cuales ofrecen un amplio abanico de posibilidades para facilitar el desarrollo integral de las personas participantes y la población en general. Para trabajar de forma específica se ha utilizado la herramienta del teatro. Esta herramienta f...

  4. Geology and micromammals of the Serra-1 site (Tabernas Basin, Betic Cordillera

    Ruiz Bustos, A.

    1993-12-01

    Full Text Available A chronology is given for the alluvial fan deposits in the Tabernas Basin (Internal Zone, Betic Cordillera. Palaeontological and sedimentological data are used to establish a palaeoclimatic model for the Quaternary in southeastern Spain.La Cuenca de Tabernas está situada en la zona interna de la Cordillera Bética, se da una cronología para los depósitos formados por abanicos aluviales y se plantea a través de datos paleontológicos y sedimentológicos un modelo paleochmátlco para el Cuaternano en el sureste de España.

  5. Representaciones sociales de la agricultura ecol??gica en Andaluc??a

    Lozano Cabedo, Carmen

    2013-01-01

    En los ??ltimos a??os se ha generalizado un amplio abanico de representaciones e im??genes en torno a la producci??n ecol??gica, por parte de m??ltiples y diferentes actores sociales, tanto en lo que refiere a su definici??n y ??mbito de actuaci??n, como a las repercusiones de esta actividad sobre el ??mbito econ??mico, social, ambiental, econ??mico e institucional. Este trabajo constituye un an??lisis de los discursos y las percepciones sobre la agricultura y la ganader??a ecol??gica que pos...

  6. Jóvenes que cometen delitos severos

    Wiese, Renata

    2008-01-01

    Dentro de los múltiples tipos de violencia, la delincuencia juvenil -que afecta a personas comprendidas entre los 10 y 29 años- es definida como un abanico de actos agresivos que van desde la intimidación y las peleas hasta formas más graves como la agresión y el homicidio. Con respecto a este último tipo de violencia (el homicidio) la hipótesis a verificar en este trabajo, plantea que sobre la población integrada por delincuentes juveniles homicidas han interactuado factores de riesgo partic...

  7. Sistema de gestión domótica de una vivienda

    Ruiz Lorca, Iván

    2011-01-01

    El proyecto que a continuación se presenta se basa en la elaboración de un sistema para gestionar y optimizar varios elementos de una vivienda, convirtiéndola en una casa domótica. A lo largo de ésta memoria veremos cómo hemos controlado y creado sistemas de control de temperatura, luz, puertas y ventanas, sistemas de prevención inteligentes, antirrobo, etc. En éste proyecto hemos querido demostrar el gran abanico de posibilidades que nos da un elemento, a priori sencillo, como es un PIC d...

  8. La generación distribuida. Comparación de cogeneración con gas natural y biomasa en aplicaciones de district heating

    Sroka Chalot, Daniel Jakub

    2012-01-01

    En la actualidad, la generación distribuida responde a un amplio abanico de tecnologías de producción eléctrica descentralizada que, correctamente aplicadas, pueden presentar ventajas respecto a la generación centralizada. Estas ventajas están fundamentalmente relacionadas con un ahorro de energía primaria, el aprovechamiento de energías renovables, la electrificación de zonas remotas o la seguridad de suministro. Dentro de las tecnologías disponibles, una de las más aplicadas ...

  9. Gestión de infraestructuras virtuales configuradas dinámicamente

    Caballer Fernández, Miguel

    2014-01-01

    En los últimos años y con el auge las tecnologías de virtualización y de las infraestructuras cloud, se abre un nuevo abanico de posibilidades para acceso de recursos de cómputo para el ámbito científico. Estas tecnologías permiten "acceso ubicuo, adaptado y bajo demanda en red a un conjunto compartido de recursos de computación". Estas tecnologías permiten que el acceso a grandes cantidades de recursos virtualizados sea mucho más sencillo para el científico. Si bien la adaptación de aplicaci...

  10. Geolog??a e historia del oro de Granada

    Mart??n, Jos?? M.

    2000-01-01

    El oro aluvial de Granada aparece como peque??as laminillas mm-cm y se encuentra en los r??os Genil y Darro, donde se ha batea-do desde la ??poca romana hasta la actualidad, y en los conglomerados de la "Formaci??n Alhambra", explotados en mina a cielo abierto. La "Formaci??n Alhambra" (~200 m de potencia) est?? constituida por sedimentos detr??ticos gruesos ligados a abanicos aluviales del Plioceno basal (~5 Ma); en la zona de la mina, son conglomerados de cantos heterom??tricos, aunque rela...

  11. El móvil en la educación: un nuevo paradigma. Ventajas y desventajas de su uso

    Martín-Herrera, Borja

    2012-01-01

    Hoy en día el abanico de posibilidades que nos ofrecen las TIC en todos los aspectos de la sociedad son prácticamente infinitos. Todos estos avances están encaminados a mejorar nuestra calidad de vida, tareas rutinarias, facilitar procesos complejos, etc…En el ámbito de la educación desde la creación y expansión de internet son numerosas las tecnologías que se han ido incorporando al aula con la finalidad de mejorar el proceso de enseñanza – aprendizaje las cuales han ido ag...

  12. El perfil del referencista en el siglo XXI y su impacto ante las redes sociales

    Rodríguez Vidal, Patricia Lucía; Contreras Hernández, Brenda

    2015-01-01

    En los albores del Siglo XXI las Tecnologías de Información y Comunicación han impactado grandemente los servicios de información en las bibliotecas universitarias, lo que ha ocasionado que en éstas se sumen otras opciones que abran un abanico de posibilidades dirigidos especialmente en el servicio de referencia virtual. El objetivo de la presente ponencia aborda fundamentalmente el perfil con el que debe contar el actual referencista del Siglo XXI, así como, los retos, oportunidades y desafí...

  13. La formación profesional en Derecho mediante el Aprendizaje Basado en Problemas (ABP)

    Rué, Joan; Font Ribas, Antoni; Cebrián, Gisela

    2011-01-01

    La formación en Derecho ha sido tradicionalmente una formación que puede orientarse y resolverse en un abanico de posibilidades profesionales muy elevado. Sin embargo esta amplitud y diversidad de referentes profesionales no ha sido históricamente asumido por el modelo de formación general seguido por las universidades españolas, centralizado y orientado a un aprendizaje fundamentalmente memorístico de los contenidos a los que se somete a un tratamiento muy dogmático. No obstante existen enfo...

  14. Evolución urbana e inundaciones en Castelló

    Segura Beltrán, Francisca S.

    2001-01-01

    La ciudad de Castellón está sometida a un elevado riesgo de inundación, derivado de su localización en el abanico aluvial del Riu Sec de Borriol. La interpretación en clave geomorfológica de las noticias históricas y actuales ha permitido reconstruir los procesos de desbordamiento de los cauces funcionales (Riu Sec, Barranc del Sol y de Penya-Roja) y de los paleocauces (Barranc de Fraga, la Sequiota, paleocauces del Riu Sec), así como las dimensiones y ubicación de las zonas inundables. Así p...

  15. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  16. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia Morphotectonic modeling of the Ibagué strike-slip fault, Colombia

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  17. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Ingrid Viviana Serrano Ramírez

    2012-01-01

    Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violen...

  18. Microarreglos de ADN y sus aplicaciones en investigaciones biomédicas

    Carlos Vallin Plous

    2007-01-01

    miles de genes. Sus aplicaciones clínicas están en fase de desarrollo. Sin embargo, cabe especular con algunas posibles aplicaciones futuras. Por ejemplo, Cáncer, Alergia, Inmunodeficiencias primarias, Enfermedades autoinmunes y Enfermedades infecciosas. La posibilidad de poder medir simultáneamente la expresión de todos los genes de un genoma, o al menos de una parte considerable de este, abre un abanico de nuevas posibilidades muchas de las cuales aún están por explorar.

  19. Natación con escaleras

    Crespo, Adrián Esteban

    2011-01-01

    La natación, como actividad humana, está logrando fortalecerse en el espectro de actividades humanas y no exclusivamente desde lo deportivo-competitivo. En los pueblos y localidades del interior, durante un largo período se asoció a la misma con la competencia de niños y adolescentes en el marco de estructuras de clubes o instituciones que brindaban tal servicio a las familias de la comunidad que la incluían. Hoy en día, dicha acepción a cambiado y se ve favorecida por el enorme abanico de...

  20. Herramienta de auditoría automática de los procesos de organización

    Meana de la Llave, Ricardo

    2010-01-01

    En los tiempos actuales, el abanico de lenguajes de programación se hace cada vez más variado y las funcionalidades que nos ofrecen son más amplias. Consecuencia de esto es que a veces encontrar una solución a un problema simple puede llevarnos varias horas delante del ordenador buscando por Internet hasta que damos con lo que buscábamos. Ante este problema encontramos la solución en una plataforma de conocimiento sobre interconectividad de aplicaciones de Microsoft. Esta ...

  1. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    Felipe Soto-Pérez

    2012-01-01

    Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra....

  2. Diseño e implementación de un cliente de una red social basado en iOS

    Miranda González, Roberto

    2011-01-01

    A lo largo de los últimos años el uso de los dispositivos móviles con pantalla táctil se ha extendido enormemente. Al mismo tiempo, el uso de redes sociales se ha disparado hasta unos límites inimaginables. La combinación de dispositivos móviles con servicios de datos móviles con tecnologías como Edge o 3G permite que se abra un amplio abanico de posibilidades de acceso a redes sociales a partir de dispositivos móviles. De manera concreta, de todos los smartphones utilizados, los dispositivos...

  3. metalTIC – Hogar Digital

    Flórez-Revuelta, Francisco; Ferrández Pastor, Francisco Javier; Cabo Díez, Miguel; Romacho Agud, Vicente

    2011-01-01

    metalTIC – Hogar Digital es un proyecto empresa-universidad para la recreación de una vivienda con los últimos avances en las tecnologías y servicios del hogar digital. Incorpora un amplio abanico de tecnologías de control, tanto estándares como propietarias, cableadas e inalámbricas. El middleware de gestión permite la interoperabilidad entre todos ellos. Asimismo, toda su funcionalidad puede ser accedida mediante servicios web, abstrayendo de toda la tecnología subyacente y haciendo sencill...

  4. El reto de la prevención del blanqueo de capitales en un mundo globalizado = The challenge of money laundering prevention in a global world

    Mateos Martín, José Antonio

    2013-01-01

    El blanqueo de capitales es uno de los fenómenos de mayor impacto social del mundo contemporáneo. Esta repercusión social es debida, en parte, al ruido mediático del que se hacen eco diariamente los medios de comunicación mundial y a la repercusión económica que tiene este fenómeno en las economías mundiales, minando el amplio abanico que va desde las cuentas de un Estado, hasta la moral individual de las personas, o lo que es lo mismo, afectando tanto a aspectos macroeco...

  5. Diseño e implementacion de un sistema de reconstrucción tridimensional de imágenes de ultrasonido

    Forero Martínez, David Eugenio

    2003-01-01

    El sistema de reconstrucción tridimensional para generación de volúmenes cardiacos es un dispositivo, basado en los conceptos de visión por computador, diseñado para resolver un problema especifico que es la visualización de estructuras cardiacas, a partir de la utilización de imágenes provenientes de equipos de ecocardiografía bidimensional. Utilizando el método conocido como abanico manual transtoráxico. La adquisición y digitalización de la información proveniente de dichos equipos, está s...

  6. Educación para la salud en el mundo laboral, los servicios de prevención como motor de cambio para alcanzar un modelo óptimo de salud en el trabajo

    Mejías Martínez, Juan Carlos

    2016-01-01

    Falta palabras clave Los enfoques sociopedagógicos contemporáneos relacionados con la educación para la salud, abarcan un amplio abanico de posibilidades desde donde enfocar nuestra investigación. Actualmente, desde los postulados de la educación para la salud y como consecuencia del auge que ha adquirido el mundo laboral y la prevención de riesgos, debido al aumento de la siniestralidad en el mundo del trabajo, se avanza con intensidad en los procesos de formación y capacitación de esta m...

  7. Cuestionario de evaluación de la personalidad eficaz en segundo y tercer ciclo de educación primaria

    Eva Fueyo Gutiérrez; María Eugenia Martín Palacio; Bianca Dapelo Pellerano

    2010-01-01

    Se presenta un cuestionario de evaluación del constructoPersonalidad eficaz en contextos educativos de segundo y tercer ciclo de la educación primaria, con resultados de fiabilidad 0.797, validez de constructo, validez concurrente con factores de personalidad de segundo orden de CPQ de Porter y Cattell, y normalización en función de la variable género. Cubrimos así el abanico de cuestionarios elaborados en torno al constructo en contextos de educación secundaria, bachillerato, formación profe...

  8. Pleistocene lacustrine basin of the east domain of Guadix-Baza basin (Granada, Spain): sedimentology, chronostratigraphy and palaeoenvironment

    Torres Pérez-Hidalgo, Trinidad José de

    2003-01-01

    Se presenta el estudio de los depósitos lacustres de la parte este de la Cuenca de Guadíx Baza (GBE), una cuenca intramontañosa que permaneció preservada de la erosión hasta la parte superior del Pleistoceno medio. La distribución de facies muestra una clara distribución centrípeta con sistemas de abanicos aluviales que alcanzaron la GBE a través de cañones todavía hoy visibles, aunque también se produjeron aportes de exutorios kársticos con sulfatos disueltos de las evaporitas...

  9. Variabilidad espacial de los atributos de la capa arable de un inceptisol del piedemonte de la cordillera oriental (casanare, colombia)

    Peña, Ricardo; Rubiano, Yolanda; Peña, Andrés; Chaves, Bernardo

    2009-01-01

    El objetivo de este trabajo fue estudiar la variabilidad espacial de los atributos del suelo, enfocado a optimizar futuros muestreos en suelos similares. El estudio se realizó en una superficie de 58 ha, ubicada en Tauramena, departamento de Casanare, Orinoquia colombiana. El suelo del estudio corresponde a un Oxic Dystrudept de textura franco arenosa a franco arcillosa, localizado sobre un abanico de terraza del piedemonte de la cordillera Oriental. A través del análisis del semivariograma y...

  10. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    Jesús Vera; Berta Sánchez; Juana Rodríguez

    2012-01-01

    Producción Científica Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL) son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contr...

  11. Catherine Jean Julien (1950-2011)

    Combès, Isabelle

    2014-01-01

    Catherine Julien falleció el 27 de mayo de 2011 en Turlock (California). Lo que nos queda de ella es más que el recuerdo o la tristeza: una obra extensa, llamativa, impertinente a menudo y, sobre todo, extremadamente bien documentada; una obra que abarcó un abanico de disciplinas (arqueología, historia, paleografía, antropología) y lugares tan distintos como el Cusco, el lago Titicaca, Tarija, Santa Cruz de la Sierra o Paraguay – con una constante: el marco temporal de sus investigaciones, to...

  12. Estudio de enanas ultra-compactas y cúmulos globulares en el cúmulo de Antlia

    Caso, Juan Pablo

    2015-01-01

    En la presente Tesis se intenta aportar evidencias que ayuden a dilucidar el origen de las enanas ultra-compactas (UCDs). Las mismas fueron descubiertas hace poco más de una década, y presentan propiedades que podrían relacionarlas tanto con los cúmulos globulares (CGs), como con galaxias de baja masa. Esto ha resultado en un abanico de hipótesis sobre su origen, que incluyen ser los miembros más brillantes de los sistemas de CGs, los resultantes de la fusión de varios cúmulos estelares masiv...

  13. Proyecto Youtuber

    Herranz Cano, Pablo

    2014-01-01

    Las nuevas tecnologías nos han ofrecido un abanico de posibilidades en cuanto a la emisión y recepción de información, por ende, han abierto un nuevo mundo que nos permite llevar a cabo una nueva forma de publicidad más efectiva que la que hemos conocido hasta ahora. Y ello, ha contribuido a la generación de una nueva oportunidad de negocio que solo algunos han sido capaces de interpretar a tiempo: los youtubers

  14. Estudio de viabilidad de una empresa de prestación de servicios elaborando una estrategia para la mejora en la realización administrativa con los diferentes entes públicos

    ALCAIDE QUEREDA, NAYIMA

    2013-01-01

    El objetivo de este TFC es crear una empresa especializada en servicios integrados, una empresa destinada a proporcionar un gran abanico de servicios a las empresas (asesoría, consultoría empresarial, asesoría jurídica, informática y un servicio de ingeniería industrial). La idea elegida surge después de realizar prácticas en la Consellería de Gobernación de Alicante, y constatar la falta de información de la que disponen muchos empresarios a la hora de tramitar la documentación en la adminis...

  15. La utilización de nuevos recursos digitales en el proceso de enseñanza-aprendizaje de las matemáticas

    Jubany, Jordi

    2010-01-01

    El presente artículo pretende presentar un abanico cualitativo de nuevos recursos con una visión que permite la interdisciplinariedad y posibilita el trabajo competencial para que sea una satisfacción aprender. No se trata de hacer un compendio exhaustivo de todos los recursos existentes, sino de dar herramientas que nos ayuden a pensar y hacer pensar a partir de la experiencia, no sólo en la utilización de la parte mecánica. Debemos abrir nuevas vías en todas las etapas educativas que puedan...

  16. Viaducto sobre el río Guarga en la autovia Mudéjar A-23. Sabiñánigo (Huesca)

    Cerezo San Frutos, Diego

    2014-01-01

    El presente documento desarrolla el Proyecto de construcción del Viaducto sobre el Rio Guarga en la autovía Mudéjar A-23 en Sabiñánigo (Huesca).Se describe el problema actual a resolver y de qué manera la implantación de la estructura supone una solución al mismo. Enmarcado el proyecto en su contexto, el siguiente nivel de detalle lo conforma el abanico de condicionantes que el entorno impone a la actuación. Estos condicionantes han sido objeto de análisis particularizados para ser determinad...

  17. Repercusiones del deseo y la búsqueda activa de información sobre la toma de decisiones en pacientes asmáticos.

    Ayllón Negrillo, Esther

    2004-01-01

    RESUMEN El asma es una enfermedad crónica que afecta a una parte significativa de la población y cuya prevalencia y morbilidad están aumentando, a pesar del cada vez mejor y mayor conocimiento que de la misma se posee y del amplio abanico de tratamientos de que se dispone para su manejo. En este contexto, la implicación del paciente en el manejo y control de su enfermedad, incluyendo el tratamiento farmacológico, se ha venido reclamando como un objetivo terapéutico de indudable valor. Un p...

  18. Caracterización clínica, molecular e inmunofenotípica del cáncer colorrectal en menores de 45 años

    Perea García, José

    2009-01-01

    [ES] El Cáncer Colorrectal (CCR) de aparición precoz es relativamente infrecuente, con una incidencia del 2-8%. Este grupo de edad presenta un abanico heterogéneo de casos, desde aquellos con una agregación familiar importante para el CCR, hasta otros que son esporádicos. Parecen presentar características distintivas con respecto a aquellos que aparecen a edad más avanzadas, con una mayor frecuencia de localización en el colon derecho, bajo grado de diferenciación, mucinosos, presencia de ...

  19. Emulación de RFID activo mediante la plataforma MICAz

    García Sotelo, Tomás

    2006-01-01

    Este trabajo de final de carrera está basado en la tecnología inalámbrica RFID. Ésta tecnología, pretende desbancar a la añeja tecnología basada en códigos de barras. En el siguiente informe, se estudia las ventajas y desventajas de esta innovadora tecnología, y se pretende informar al lector del amplio abanico de utilidades que establece esta tecnología en el mundo real. Aparte de realizar un estudio de los dispositivos RFID, se han creado dos aplicaciones como prueba de...

  20. Leche de altramuz

    Dell'Oca, Nicolás

    2015-01-01

    RESUMEN La leche de Lupinus albus posee 280 mg de calcio y 2.66 gr de proteínas, comparándola con la leche de vaca presenta más del doble en calcio y casi la misma cantidad de proteínas. La siguiente investigación pretende estudiar el grado de aceptabilidad del flan elaborado con leche de Lupinus albus y de este modo poder ampliar el abanico de alimentos para las personas que presentan intolerancia a la lactosa. Objetivos: Determinar el perfil del consumo de leche y el gr...

  1. Particularidades y proyecciones de futuro de la industria de la música en el siglo XXI: el caso de la industria discográfica mexicana

    Torres Osunal, Cristian Daniel

    2012-01-01

    La industrialización de la cultura ofrece un variado abanico de posibilidades para la investigación empírica, en un complejo panorama de actividades económicas y sociales interconectadas. Cada subsector de las IC (industria del disco, libro, videojuego, televisión, cine, radio, etc.) constituye un objeto de estudio con particularidades diferenciadas de los demás (procesos productivos, actores, división del trabajo, flujo económico, social, etc.), susceptibles a ser abordadas desde diferentes ...

  2. La fuerza laboral de la comunicación comercial: radiografía del sector publicitario con enfoque de género

    Martín Llaguno, Marta

    2007-01-01

    Con una fuerza laboral joven y altamente cualificada, el ámbito laboral de la publicidad presenta una estructura polarizada y ciertos sesgos de género en detrimento del sexo femenino. Aunque considerado como gratificante en líneas generales, el alto grado de implicación y de dedicación que exige el trabajo creativo de estos profesionales provoca a menudo conflictos entre la vida laboral y la familiar. Asimismo, la existencia en el sector de un amplio abanico de políticas de conciliación no...

  3. Aplicación del análisis markoviano en sucesiones aluviales, a la predicción de facies hidrogeoquímicas: un ejemplo de la cuenca de Madrid (España central).

    Torres Pérez-Hidalgo, Trinidad José de

    1997-01-01

    En este trabajo se aplica el análisis por cadenas de Markov a sucesiones estratigráficas del Neógeno de la Cuenca de Madrid. Los datos proceden de sondeos mecánicos de reconocimiento que atraviesan depósitos de abanico aluvial y de playa fangosa. Permite determinar la aparición de procesos repetitivos en el espacio y en el tiempo y, en el caso que nos ocupa, detectar aquellos estados (facies), cuya aparición dependa sólo del estado, (facies) anterior. El método comprende el cálculo de matrice...

  4. Cadena de restaurantes de comida cosmopolita y saludable a precio asequible

    Álvarez García-Luján, Carlos

    2012-01-01

    El objeto de este trabajo es la presentación del proyecto de una “Cadena de restaurantes de comida cosmopolita y saludable a precio asequible” en la ciudad de Barcelona Se ofrecerán desayunos, comidas, meriendas, cenas e incluso “copas”, tanto en el propio local como en “take away”, abarcando así todo el abanico de demanda en alimentación fuera del hogar. Dicho proyecto basa su éxito en: • Las economías de escala y el poder negociador en las compras, basadas en un alto volumen ...

  5. Productos naturales vegetales

    Ringuelet, Jorge Abel; Viña, Sonia Zulma

    2013-01-01

    El mundo vegetal es, quizás, el que muestra un abanico de moléculas más diverso y del cual el hombre ha hecho y hace una provechosa utilización. La maquinaria química de un vegetal es tan ingeniosa que asombra al estudiar en su profundidad la estructura, función, metabolismo y regulación de cada molécula identificada y de los innumerables procesos en que participan a nivel celular. Por otra parte, al no contar con el mecanismo de evasión y encontrarse ancladas al suelo o algún otro sustrato, ...

  6. Biorremediación acelerada de suelos contaminados con hidrocarburos tipo diésel

    Moliterni Merlo, Elena

    2016-01-01

    La biorremediación es una tecnología biológica para la descontaminación de suelos basada en la conversión o metabolización de los contaminantes por microorganismos; es decir, requiere una cepa o consorcio microbiano eficiente que degrade la mayor cantidad de contaminante hasta un nivel mínimo. Los procesos de biorremediación de suelos contaminados con hidrocarburos (HC) pueden desarrollarse mediante un gran abanico de estrategias. Este hecho permite acoplarse a distintos episodios de contamin...

  7. Perspectivas del negocio de la distribuci??n para un futuro incierto en el sector de la prensa = Distribution business prospects for an uncertain future in the newspapers sector.

    Rubio ??lvarez, Juan Vicente

    2014-01-01

    El negocio de la distribuci??n en el sector de la prensa viene representado por un amplio abanico de empresas, desde los editores como creadores del contenido, pasando por los impresores como creadores del soporte f??sico, las empresas de transporte y distribuci??n como prestadores del servicio de la distribuci??n, los vendedores de prensa como clientes directos o primarios y por ??ltimo los compradores y suscriptores como clientes finales. En este trabajo se realiza un an??lisis de cada u...

  8. Automatización del modelado y gestión de procesos de fabricación dirigida por semántica

    Ferrándiz Colmeiro, Antonio; Maciá Pérez, Francisco; Gilart Iglesias, Virgilio; Berná Martínez, José Vicente; Gea Martínez, Jorge

    2009-01-01

    La madurez alcanzada por las IT junto con algunas de las teorías modernas de gestión de procesos de negocio (BPM) ha propiciado un escenario adecuado para afrontar los requerimientos de los nuevos modelos de negocio cada vez más orientados a la personalización masiva. Las soluciones de integración aportadas en el entorno de las organizaciones manufactureras han abierto todo un abanico de posibilidades en la gestión de los procesos que, paradójicamente, está provocando que el tradicional cuell...

  9. Aproximación a la planificación de rutas en el transporte público

    Montagnini, Gabriele

    2015-01-01

    RESUMEN: El transporte supone el traslado de personas o bienes de un lugar a otro. Los lugares de en los que se produce suelen estar alejados de aquellos en los que se consume; las personas que residen en una localidad, trabajan, estudian o disfrutan de su tiempo libre en otros emplazamientos. En un mundo cada vez más globalizado, el transporte es uno de los sectores que más aporta a la generación de riqueza de una región pues abre un gran abanico de posibilidades en todos los sectores produc...

  10. Creatividad y tecnología en la orientación de nuestros futuros músicos

    Lago Castro, Pilar; Ponce De León Barranco, Luis

    2012-01-01

    La gestión y planificación de la carrera profesional son ámbitos en los que el estudiante de música debe poner en práctica su creatividad. Ayudar al alumno para desarrollar su creatividad a la hora de explorar el amplio abanico de posibilidades que comprende el mundo profesional de la música es una tarea en la que las tecnologías de la información y la comunicación pueden jugar un importante papel. En este artículo se describe un proyecto de orientación profesional llevado a cabo en un conser...