WorldWideScience

Sample records for aaps

  1. Tectonics wins AAP Award

    AGU's newest journal, Tectonics, won the 1983 award for excellence in journal design and production given by the Association of American Publishers, Inc. (AAP), in the eighth annual professional and scholarly publishing awards competition. Edited by John F. Dewey, the bimonthly journal is a joint publication of AGU and the European Geophysical Society. Paul E. Tapponnier is the European editor and B.C. Burchfiel is the North American editor. The journal is now in its third year of publication.

  2. AAP Updates Recommendations on Car Seats

    ... Size Email Print Share AAP Updates Recommendations on Car Seats Page Content Article Body Children should ride ... of approved car safety seats. Healthy Children Radio: Car Seat Safety Dennis Durbin, MD, FAAP, lead author ...

  3. Aminoalkylpyridines (AAPs), triazoline metabolite analogues, as anticonvulsants highly effective in the MES test.

    Kadaba, Pankaja K; Dixit, Trupti

    2003-10-01

    Elucidation of the metabolism and pharmacology of 1,2,3-triazolines (TRs) led to the identification of the triazoline pharmacophore and the evolution of the aminoalkylpyridines (AAPs). The AAPs have no activity in the scMet test but are highly effective in the MES seizure test by the oral route. The AAPs bind to the sigma(1) receptor with low affinity, but high selectivity. They impair Glu release to the same extent as the triazolines and afforded a high degree of protection in the kindled rat. They show no affinity for the NMDA/PCP receptor sites; thus the toxic side effects of NMDA antagonists are absent in the sigma selective AAPs. Variations of the heterocyclic unit, the alkyl chain and the amino group in the AAP leads, indicated that the 4-pyridyl substituent along with a methyl (alkyl) group, and a 4-C1, 3-C1 or 3,4-C1(2) substitution on the N-phenyl group, afforded the most active compounds. Amino group modification by acylation did not improve activity. The hydrazone compounds were the most active. Although the AAPs are very effective in the MES and the kindling models of epilepsy, they showed only low to moderate activity in protecting neuronal cells in stroke-induced cerebral ischemia. In the case of the TR compounds, even the least effective TR afforded 47% protection from neuronal injury. It is not known at this point, whether activity in both the MES and scMet tests, which would imply a role for both Glu and GABA, is a prerequisite for antiischemic activity. PMID:12871088

  4. Inadequacies with the ACOG and AAP statements on managing ethical conflict during the intrapartum period.

    Chervenak, Frank A; McCullough, Laurence B

    1991-01-01

    [The American College of Obstetricians and Gynecologists] takes the view that respect for the autonomy of the pregnant woman should be almost absolute and [the American Academy of Pediatrics] takes the view that respect for the autonomy of the pregnant woman should be limited or prima facie in character. ACOG's reading of this central bioethical principle admits of virtually no exceptions, while AAP's reading does allow exceptions....A complete account of obstetric ethics that would apply in clinical practice during the intrapartum period must take into account both negative and positive autonomy-based rights of the pregnant woman and beneficence-based obligations to the at-term fetus -- and to the pregnant woman, as well. Such an account will be, we believe, more clinically applicable than the accounts offered by ACOG and AAP. PMID:11642910

  5. Connecting Source with Sink: The Role of Arabidopsis AAP8 in Phloem Loading of Amino Acids.

    Santiago, James P; Tegeder, Mechthild

    2016-05-01

    Allocation of large amounts of nitrogen to developing organs occurs in the phloem and is essential for plant growth and seed development. In Arabidopsis (Arabidopsis thaliana) and many other plant species, amino acids represent the dominant nitrogen transport forms in the phloem, and they are mainly synthesized in photosynthetically active source leaves. Following their synthesis, a broad spectrum of the amino nitrogen is actively loaded into the phloem of leaf minor veins and transported within the phloem sap to sinks such as developing leaves, fruits, or seeds. Controlled regulation of the source-to-sink transport of amino acids has long been postulated; however, the molecular mechanism of amino acid phloem loading was still unknown. In this study, Arabidopsis AMINO ACID PERMEASE8 (AAP8) was shown to be expressed in the source leaf phloem and localized to the plasma membrane, suggesting its function in phloem loading. This was further supported by transport studies with aap8 mutants fed with radiolabeled amino acids and by leaf exudate analyses. In addition, biochemical and molecular analyses revealed alterations in leaf nitrogen pools and metabolism dependent on the developmental stage of the mutants. Decreased amino acid phloem loading and partitioning to sinks led to decreased silique and seed numbers, but seed protein levels were unchanged, demonstrating the importance of AAP8 function for sink development rather than seed quality. Overall, these results show that AAP8 plays an important role in source-to-sink partitioning of nitrogen and that its function affects source leaf physiology and seed yield. PMID:27016446

  6. SELECTIVE EVALUATION OF TWO URINARY ENZYMES (NAG AND AAP BEFORE AND AFTER UNILATERAL SHOCK WAVE LITHOTRIPSY

    M. R. Nikoobakht

    2006-09-01

    Full Text Available Biological effects extracorporeal shock wave lithotripsy (ESWL is not precisely known. We have evaluated two urinary enzymes activity N-acetyl-B-D-glucosamine (NAG and alanine amino peptidase (AAP before and after unilateral ESWL as markers for renal parenchymal damage. Forty eight patients with kidney stones (mean age 39 who had presented for the first time or at least one year after their previous lithotripsy underwent ESWL. Urinary specimens were collected before and after first, third and seventh days of lithotripsy and NAG, AAP were evaluated. These enzymes displayed the greatest activity 24 hours after ESWL with significant difference compared to the control group, (P < 0.05 versus 0.02. Elevation of urinary enzymes activity correlated with stone size particularly stones larger than 2 cm. These data suggest that there is some tubular and parenchymal damage induced by ESWL that needs time to get improved. The higher urinary enzyme activity in patients with larger stones ( > 2 cm is probably related to injury resulting from passage of smaller stones, produced after lithotripsy of a large stone, and it is suggested that these patients are treated with a safer procedure.

  7. Synergistic Radiation Protective Effect of Purified Auricularia auricular-judae Polysaccharide (AAP IV with Grape Seed Procyanidins

    Haina Bai

    2014-12-01

    Full Text Available The aim of this study was to investigate the synergistic antioxidant potential and protective effect of grape seed procyanidins (GSP in combination with Auricularia auricular-judae polysaccharides (AAP IV on radiation injury in splenocytes. Rat splenocyte irradiation resulted in significantly higher apoptosis rate, malondialdehyde (MDA (p < 0.005, reactive oxygen species (ROS (p < 0.01; cell viability, total superoxide dismutase (T-SOD (p < 0.01, catalase (CAT (p < 0.01, glutathione peroxidase (GSH-PX (p < 0.05, activity and glutathione (GSH (p < 0.01 levels were significantly reduced, compared with the control group. “GSP + AAP IV” treatment of rat splenocytes at doses of “GSP (0.3 μg/mL + AAP IV (50 μg/mL” displayed higher radioprotective and antioxidative effects than the administration of either GSP or AAP IV, as evident by lower levels of MDA (p < 0.001 concentration, as well as higher cell viability and T-SOD (p < 0.05, CAT (p < 0.005, GSH-PX (p < 0.01 and GSH content compared to the radiation group. In addition, in vivo studies have shown that “GSP + AAP IV” significantly ameliorated the decrease of spleen index (p < 0.005 and spleen GSH (p < 0.005 levels and significantly inhibited the increase of MDA (p < 0.005 levels of spleen with radiation-induced damage, compared with the non-treated group. The in vivo and in vitro results suggested that GSP and AAP IV have a synergistic protective effect against radiation-induced injury by improving the antioxidant and immunomodulation activities.

  8. Construction and analysis of an intergeneric fusion from Pigmentiphaga sp. strain AAP-1 and Pseudomonas sp. CTN-4 for degrading acetamiprid and chlorothalonil.

    Wang, Guangli; Zhu, Danfeng; Xiong, Minghua; Zhang, Hui; Liu, Yuan

    2016-07-01

    Pseudomonas sp. CTN-4 degrades chlorothalonil (CTN) but not acetamiprid (AAP), and Pigmentiphaga sp. strain AAP-1 degrades AAP but not CTN. A functional strain, AC, was constructed through protoplast fusion of two parental strains (Pseudomonas sp. CTN-4 and Pigmentiphaga sp. strain AAP-1) in order to simultaneously improve the degradation efficiency of AAP and CTN. Fusant-AC with eight transfers on plates containing two antibiotics and CTN was obtained. For the purpose of identifying and confirming the genetic relationship between fusant-AC and its parents, randomly amplified polymorphic DNA (RAPD), scanning electron microscopy (SEM), and 16S ribosomal DNA (rDNA) analysis were performed. In toto, RAPD fingerprint analysis produced 194 clear bands with 9 primers, which not only had bands in common with strains CTN-4 and AAP-1, but also had its own novel fusant-specific bands. The genetic similarity indices between fusant-AC and parental strains CTN-4 and AAP-1 were 0.40 and 0.69, respectively. The result of SEM indicated that the cell morphology of fusant-AC differed from both its parents. The fusant strain AC possesses a strong capability for AAP and CTN degradation. At AAP concentration (50-300 mg L(-1)), the degradation was achieved within 5 h. At the initial dose of 50 and 100 mg L(-1) CTN, the percentages reached 96 and 91 % over a 36-h incubation period. The present study indicates that the protoplast-fusion technique may have possible applications in environmental pollution control. PMID:27023810

  9. Newborn Male Circumcision with Parental Consent, as Stated in the AAP Circumcision Policy Statement, Is Both Legal and Ethical.

    Brady, Michael T

    2016-06-01

    Newborn male circumcision is a minor surgical procedure that has generated significant controversy. Accumulating evidence supports significant health benefits, most notably reductions in urinary tract infections, acquisition of HIV and a number of other sexually transmitted infections, penile cancer, phimosis, paraphimosis, balanitis and lichen sclerosis. While circumcision, like any surgical procedure, has risks for complications, they occur in less than 1 in 500 infants circumcised and most are minor and require minimal intervention. The CDC and the American Academy of Pediatrics (AAP) believe that health benefits of circumcision outweigh the risks. For this reason, the AAP believes that parents should be allowed to make the decision concerning circumcision of their male infants after receiving non-biased information on health risks and health benefits. PMID:27338601

  10. The possibility of building nuclear power plant free from severe accident risk: PWR NPP with advanced all passive safety cooling systems (AAP SCS)

    A complete set of advanced all passive safety cooling systems (AAP SCS) for PWR NPP, actuated by natural force has been put forward in the article. Here the natural force mainly means the fore, which created by change of pressure distribution in the first loop of PWR as a result of operational regime conversion from one to another, including occurrence of accident situation. Correspondent safety cooling system will be actuated naturally and then put it into passive operation after occurring some kind of accident, so accidental situation will be mitigated right after it's occurrence and core residual heat will be naturally moved from the active core to the ultimate heat sink. There is no need to rely on automatic control system, any active equipment and human actions in all working process of the AAP SCS, which can reduce the probability of severe accident to zero, so as to exclude the need of evacuation plan around AAP nuclear power plant and eliminate the public's concern and doubt about nuclear power safety. Implementation of the AAP SCS concept is only based on use of evolutionary measures and state-of-the-art technology. So at present time it can be used for design of new-type third generation PWR nuclear power plant without severe accident risk, and for modernization of existing second generation nuclear power plant. (authors)

  11. AMC12和AAP1卫星更名加入新天星座

    华宇星

    2007-01-01

    2007年3月5日,SES新天卫星公司宣布,两颗SES系列通信卫星AMC 12(该卫星的33个转发器原提供给SES Astra公司使用,故也命名为Astra 4A)司AAP1已转交该公司运营,这两颗卫星分别重新命名为NSS10和NSS11,其所有用户及相关的容量管理业务现由SES新天卫星公司负责。基于此,现在新天卫星星座由7颗通信卫星组成,完善了全球不同地区间的连通性,以及除欧洲和北美地区之外世界上其它地区的容量分配服务及区域互联。

  12. RESPONSE SURFACE METHODOLOGY APPLIED TO LACCASES ACTIVITIES EXHIBITED BY STENOTROPHOMONAS MALTOPHILIA AAP56 IN DIFFERENT GROWTH CONDITIONS

    Said Galai,

    2011-12-01

    Full Text Available Stenotrophomonas maltophilia AAP56, laccase-producing bacteria, growing under different conditions, exhibit laccase activity that is highly affected by some environmental factors. Response surface methodology (RSM was applied for the determination of laccase factor dependence using two substrates: ABTS (2,2’-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid and DMP (2,6 Dimethoxy-phenol. RSM was carried out with a 24 factorial design using four variables, namely, dye (0 to 0.1 mg mL-1, Cu in Med (0 to 400 µM, shaking (0 to 150 rpm, and CuSO4 in assay (0 to 0.2 mM. Significant correlation between the effects of these variables on R1 (ABTS oxidase activity and R2 (DMP oxidase activity responses was detected. Astonishing results showed differences between these two activities with respect to copper activity dependence. Anoxic conditions exhibited a significant ability to induce the enzyme. This bacterial laccase activity (produced under optimal conditions according to RSM was used to decolorize an azoic dye, Reactive Black 5 (RB5. It was efficient only in the presence of a redox mediator to degrade RB5 after 20 min of incubation time.

  13. Cloning and preliminary functional analysis of an amino acid permease gene GmAAP2-like 1 in soybean%大豆氨基酸透性酶基因GmAAP2-like 1的克隆及功能初探

    李美美; 夏铜梅; 王丹; 梅圆圆; 王宁宁

    2016-01-01

    Amino acid permeases play important roles in transferring amino acids between different parts of the plants; however, so far their functions have rarely been studied in soybean. In this research, an amino acid per-mease gene,GmAAP2-like 1, was seen to be up-regulated in primary leaves of hydroponically grown soybean (Glycine max) cultivar ‘Williams 82’ under nitrogen-deficiency treatment compared with nitrogen-sufficient control. The RT-PCR analysis further showed thatGmAAP2-like 1 was much more abundantly in flowers, leaves and stems of soybean while it showed very low expression in roots and seeds. During the cloning pro-cess, it was found that the vector carrying35S:GmAAP2-like 1 could be transformed intoEscherichia colistrain DH5αsuccessfully but was lethal toAgrobacterium tumerfaciens strain GV3101. As an alternative strategy, this gene was then cloned by fusion PCR with an intron inserted after the ifrst extron and the following transforma-tions turned out to be successful in bothE. coli andAgrobacterium strains mentioned above. Subsequently, the obtainedArabidopsis thalianatransgenic lines of35S:GmAAP2-like 1 with intron were veriifed by genomic PCR and semi-quantitative RT-PCR analysis, and the results showed that the intron was cut off correctly and the gene of interest was overexpressed in almost all the lines examined. Furthermore, it was shown that even though the growth of wild-type and transgenic seedlings were both inhibited after toxic glutamate analogues treatment in comparison to that of the mock control, the growth inhibition of transgenic lines was much more signiifcant, implying that GmAAP2-like 1 could possibly transport such acidic amino acid.%氨基酸透性酶(amino acid permeases)在植物不同器官的氨基酸转运过程中发挥着重要作用,但迄今为止,大豆中氨基酸透性酶相关的研究甚少。本文利用大豆初生叶水培系统对大豆(Glycine max)品种‘Williams 82’进行缺氮处理后,发现与

  14. Perfil Nutricional Associado ao Índice de Obesidade de Idosos do Centro de Saúde Sebastião Pinheiro Bastos, AAP-VR, Volta Redonda – RJ

    Jair Antonio de Carvalho

    2009-03-01

    Full Text Available Trabalho autorizado pelo do Comitê de Ética do (UBM - 13/04/2006, tem como objetivo avaliar o estado nutricional e índice de obesidade de idosos voluntários do Centro de Saúde Sebastião Pinheiro Bastos, AAP-VR, Volta Redonda – RJ - 2006, através do levantamento do índice de massa corporal (IMC, (OMS-1995 e da circunferência de abdome (CA, (Han e cols-1995. Foram entrevistados 1952 idosos, de ambos os sexos, maiores de 60 anos. Obteve-se os seguintes resultados para a variável (CA, risco para as doenças cardiovasculares: nas mulheres, 526 (52,97% apresentaram CA > 88 cm e 467 (47,02% CA < 88 cm (sem risco para as doenças cardiovasculares; nos homens, 460 (76,79% CA < 102cm (sem risco e 139 (23,21% > 102cm (com risco. Quanto ao IMC, foram identificados 949 idosos (59,62% com IMC > 24,99Kg/m2 (sobrepeso, 611 (38,37% com peso normal e 32 (2,01% com baixo peso. Comparando os dados obtidos com os do PNSN, (Tavares e Anjos - 1989: o baixo peso 2,01% é inferior ao do PNSN 6,75%; o peso normal 38,37% é menor do que o nacional que é de 53,95%; o sobrepeso 59,61% é superior ao do PNSN que é de 40,30%. O sobrepeso é muito alto, contrastando com o baixo peso e peso normal, sinalizando possível vulnerabilidade para as doenças degenerativas e suas comorbidades.

  15. The spectral library of the AAPS

    Davie, Matthew; Tinney, Chris; Wittenmyer, Robert

    2015-08-01

    The Anglo-Australian Planet Search program has been operating since 1997 and is still collecting high-resolution spectra of more than two hundred solar-like stars. Over forty thousand stellar spectra have been collected through an Iodine cell, and the radial velocity of the target of each spectrum determined.This project aims to reduce and calibrate the spectra and remove the interposed Iodine spectrum in order to recover the original stellar spectrum. The resultant library of spectra, in addition to being made available to the wider astronomical community, will be used to examine stellar activity, and to create high signal-to-noise composite spectra.We present initial results of the reduction process and indicate the quality of composite spectra that may be expected.

  16. What Made Them Successful: An Introspective Survey of AAPS Members

    Pamela A. Rudnicki, BS

    2015-03-01

    Conclusion: The authors believe that recognizing the relative importance of such factors, and their associated biases, is essential for the process of selecting and developing future successful plastic surgeons.

  17. Emerging regenerative approaches for periodontal reconstruction: a systematic review from the AAP Regeneration Workshop.

    Lin, Zhao; Rios, Hector F; Cochran, David L

    2015-02-01

    More than 30 years have passed since the first successful application of regenerative therapy for treatment of periodontal diseases. Despite being feasible, periodontal regeneration still faces numerous challenges, and complete restoration of structure and function of the diseased periodontium is often considered an unpredictable task. This review highlights developing basic science and technologies for potential application to achieve reconstruction of the periodontium. A comprehensive search of the electronic bibliographic database PubMed was conducted to identify different emerging therapeutic approaches reported to influence either biologic pathways and/or tissues involved in periodontal regeneration. Each citation was assessed based on its abstract, and the full text of potentially eligible reports was retrieved. Based on the review of the full papers, their suitability for inclusion in this report was determined. In principle, only reports from scientifically well-designed studies that presented preclinical in vivo (animal studies) or clinical (human studies) evidence for successful periodontal regeneration were included. Hence, in vitro studies, namely those conducted in laboratories without any live animals, were excluded. In case of especially recent and relevant reviews with a narrow focus on specific regenerative approaches, they were identified as such, and thereby the option of referring to them to summarize the status of a specific approach, in addition to or instead of listing each separately, was preserved. Admittedly, the presence of subjectivity in the selection of studies to include in this overview cannot be excluded. However, it is believed that the contemporary approaches described in this review collectively represent the current efforts that have reported preclinical or clinical methods to successfully enhance regeneration of the periodontium. Today's challenges facing periodontal regenerative therapy continue to stimulate important research and clinical development, which, in turn, shapes the current concept of periodontal tissue engineering. Emerging technologies--such as stem cell therapy, bone anabolic agents, genetic approaches, and nanomaterials--also offer unique opportunities to enhance the predictability of current regenerative surgical approaches and inspire development of novel treatment strategies. PMID:25644297

  18. AAPS-FDA workshop white paper : Microdialysis principles, application and regulatory perspectives

    Chaurasia, Chandra S.; Mueller, Markus; Bashaw, Edward D.; Benfeldt, Eva; Bolinder, Jan; Bullock, Ross; Bungay, Peter M.; DeLange, Elizabeth C. M.; Derendorf, Hartmut; Elmquist, William F.; Hammarlund-Udenaes, Margareta; Joukhadar, Christian; Kellogg, Dean L.; Lunte, Craig E.; Nordstrom, Carl Henrik; Rollema, Hans; Sawchuk, Ronald J.; Cheung, Belinda W. Y.; Shah, Vinod P.; Stahle, Lars; Ungerstedt, Urban; Welty, Devin F.; Yeo, Helen

    2007-01-01

    Many decisions in drug development and medical practice are based on measuring blood concentrations of endogenous and exogenous molecules. Yet most biochemical and pharmacological events take place in the tissues. Also, most drugs with few notable exceptions exert their effects not within the bloods

  19. AAPS and US FDA Crystal City VI workshop on bioanalytical method validation for biomarkers.

    Lowes, Steve; Ackermann, Bradley L

    2016-02-01

    Crystal City VI Workshop on Bioanalytical Method Validation of Biomarkers, Renaissance Baltimore Harborplace Hotel, Baltimore, MD, USA, 28-29 September 2015 The Crystal City VI workshop was organized by the American Association of Pharmaceutical Scientists in association with the US FDA to continue discussion on the bioanalysis of biomarkers. An outcome of the Crystal City V workshop, convened following release of the draft FDA Guidance for Industry on Bioanalytical Methods Validation in 2013 was the need to have further discussion on biomarker methods. Biomarkers ultimately became the sole focal point for Crystal City VI, a meeting attended by approximately 200 people and composed of industry scientists and regulators from around the world. The meeting format included several panel discussions to maximize the opportunity for dialogue among participants. Following an initial session on the general topic of biomarker assays and intended use, more focused sessions were held on chromatographic (LC-MS) and ligand-binding assays. In addition to participation by the drug development community, significant representation was present from clinical testing laboratories. The experience of this latter group, collectively identified as practitioners of CLIA (Clinical Laboratory Improvement Amendments), helped shape the discussion and takeaways from the meeting. While the need to operate within the framework of the current BMV guidance was clearly acknowledged, a general understanding that biomarker methods validation cannot be adequately depicted by current PK-centric guidelines emerged as a consensus from the meeting. This report is not intended to constitute the official proceedings from Crystal City VI, which is expected to be published in early 2016. PMID:26795584

  20. USA välispoliitiliste hoiakute muutumine XXI sajandi alguses / Aap Neljas

    Neljas, Aap, 1967-

    2003-01-01

    USA poliitikas on olnud ilmne tendents jagada "rahulikes piirkondades" korrahoidmise koormat teiste suurriikidega ja säilitada vabad käed suuremate kriiside lahendamiseks, kus kaalul on otseselt USA rahvuslikud huvid (nt ligipääs naftale või juhtroll maailmas)

  1. Aap, Noot, Mustafa...: Het effect van taalafstand en koloniaal verleden op leesprestaties

    Kooistra, J.P.; Ultee, W.C.; Pelzer, B.J.

    2008-01-01

    This study examines the effect of the distance between origin language and destination language on the reading skills of immigrant students, by building upon insights on the development of world languages, obtained from human population genetics. Lower-level research units are 1759 first-generation immigrants from PISA 2003, all aged fifteen or sixteen, and living in a country which has a Germanic national language. Higher-level research units are 13 destination countries and 46 origin countr...

  2. Aap, Noot, Mustafa…: Het effect van taalafstand en koloniaal verleden op leesprestaties

    Kooistra, Jan-Paul; Ultee, Wout; Pelzer, Ben

    2008-01-01

    Summary A is for apple, B is for Bushra: The influence of language distance and colonial experience on reading This study examines the effect of the distance between origin language and destination language on the reading skills of immigrant students, by building upon insights on the development of world languages, obtained from human population genetics. Lower-level research units are 1759 first-generation immigrants from PISA 2003, all aged fifteen or sixteen, and living in a country which ...

  3. Introduction: A welcome to the first special animal health issue of AAPS PharmSci

    Martinez, Marilyn; Soback, Stefan

    2002-01-01

    The goal of this special volume is to provide veterinary scientists with state-of-the art reviews in animal health and to inform human health scientists of the various challenges and collaborative opportunities associated with their animal health counterparts. The contributors are highly respected experts, providing invaluable insights into current issues and state-of-the-art advances within veterinary medicine.

  4. Cultural bias in the AAP's 2012 Technical Report and Policy Statement on male circumcision

    Frisch, Morten; Aigrain, Yves; Barauskas, Vidmantas;

    2013-01-01

    The American Academy of Pediatrics recently released its new Technical Report and Policy Statement on male circumcision, concluding that current evidence indicates that the health benefits of newborn male circumcision outweigh the risks. The technical report is based on the scrutiny of a large nu...

  5. De grijze aap: ouderen, communicatie en consumentengedrag vanuit het perspectief van de evolutie

    Sikkel, D.

    2010-01-01

    Lang geleden, voordat er mensen bestonden, bleven alle dieren vruchtbaar tot hun dood. De afgelopen vijf miljoen jaar hebben wij ons ontwikkeld tot de enige diersoort met een menopauze. Kennelijk was dit ergens goed voor; de natuur geeft deze onvruchtbare extra tijd van leven niet cadeau. Het nut van de vijftigplusser, en daarmee zijn natuurlijke gedrag, moet er dus zijn, maar het staat niet scherp op ons netvlies. Marketeers en communicatieprofessionals, die ook de oudere doelgroep in het ha...

  6. Particle size analysis: AAPS workshop report, cosponsored by the Food and Drug Administration and the United States Pharmacopeia

    Burgess, Diane J.; Duffy, Eric; Etzler, Frank; Hickey, Anthony J.

    2004-01-01

    The concepts of particle engineering and dosage form design have become dominant themes in pharmaceutical manufacturing. This trend is not simply a reflection of the development of new, more sophisticated manufacturing methods of particles or dispersed systems but also recognition of the importance of quality control even in more traditional manufacturing processes. However, the diversity of particle treatments, methods of particle size analysis, expression and interpretation of data, and pro...

  7. Sports Injury Prevention Tip Sheet

    ... Apply Advertise with AAP Advertising on AAP.org Advertising on AAP Journals & Publications AAP Mailing and eMail List Corporate Relationships Conflict of Interest and Industry Relations Sponsorships Corporate Friends of Children Fund Corporate Relationship ...

  8. Whole-genome sequence of a freshwater aerobic anoxygenic phototroph, Porphyrobacter sp. strain AAP82, isolated from the Huguangyan Maar Lake in Southern China

    Li, X.; Koblížek, Michal; Feng, F.; Li, Y.; Jian, J.; Zeng, Yonghui

    2013-01-01

    Roč. 1, č. 2 (2013). ISSN 2169-8287 R&D Projects: GA ČR GAP501/10/0221; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Porphyrobacter * Huguangyan Maar Lake Subject RIV: EE - Microbiology, Virology http://genomea.asm.org/content/1/2/e00072-13.full

  9. Draamateatris müüakse pähkleid, aga ükski ei taha osta / Priit Pedajas ; interv. Aap Egorov

    Pedajas, Priit, 1954-

    1999-01-01

    Eesti Draamateatris Madis Kõivu näidend "Kui me Moondsundi Vasseliga kreeka pähkleid kauplesime, siis ükski ei tahtnud osta", lavastaja Priit Pedajas, kunstnik Pille Jänes, osades Ita Ever, Andrus Vaarik, Ain Lutsepp, Rein Oja, Laine Mägi, Kersti Kreismann jt. Esietendus 9. juunil

  10. Talking to Kids and Teens About Social Media and Sexting

    ... Current Openings How to Apply Advertise with AAP Advertising on AAP.org Advertising on AAP Journals & Publications AAP Mailing and eMail ... on Facebook today?” “Any new chats recently?” “Anyone text you today?” Share a bit about your daily ...

  11. Interaction mechanism between 4-aminoantipyrine and the enzyme lysozyme

    4-Aminoantipyrine (AAP) is scarcely administered as a kind of analgesic drug because of the side effect. The residue of AAP in the environment poses a potential threat to human health. To evaluate the toxicity of AAP at the protein level, the effects of AAP on lysozyme were investigated using spectroscopic and molecular docking methods. Addition of AAP effectively quenched the intrinsic fluorescence of lysozyme. Static quenching of lysozyme by AAP revealed the formation of complex. After the inner filter effect was eliminated, the number of binding sites, the binding constant and the thermodynamic parameters were measured, and indicated that AAP can spontaneously bind with lysozyme through hydrophobic interactions with one binding site. Molecular docking results revealed that AAP bound into the enzyme active site and interacted with the Trp 62 and Trp 63 residues of lysozyme, which illustrated that the lysozyme activity was inhibited by AAP, in accordance with the results of the lysozyme activity experiment. Furthermore, the binding of AAP can result in demonstrable change of the conformation of lysozyme. This work is helpful for clarifying the molecular toxic mechanism of AAP in vivo. - Highlights: → This work established the binding mode of AAP with lysozyme in molecular level. → Mechanism was explored by multiple spectroscopic and molecular docking methods. → AAP can inhibit lysozyme activity and induce conformational changes in lysozyme.

  12. To Keep Teens Slim, Focus on Health Not Weight

    ... rather than worry about the number on the bathroom scale, the American Academy of Pediatrics (AAP) says. ... and take a look at their own lifestyle habits. The AAP recommended having family meals as often ...

  13. The interaction between 4-aminoantipyrine and bovine serum albumin: Multiple spectroscopic and molecular docking investigations

    4-Aminoantipyrine (AAP) is widely used in the pharmaceutical industry, in biochemical experiments and in environmental monitoring. AAP as an aromatic pollutant in the environment poses a great threat to human health. To evaluate the toxicity of AAP at the protein level, the effects of AAP on bovine serum albumin (BSA) were investigated by multiple spectroscopic techniques and molecular modeling. After the inner filter effect was eliminated, the experimental results showed that AAP effectively quenched the intrinsic fluorescence of BSA via static quenching. The number of binding sites, the binding constant, the thermodynamic parameters and binding subdomain were measured, and indicated that AAP could spontaneously bind with BSA on subdomain IIIA through electrostatic forces. Molecular docking results revealed that AAP interacted with the Glu 488 and Glu 502 residues of BSA. Furthermore, the conformation of BSA was demonstrably changed in the presence of AAP. The skeletal structure of BSA loosened, exposing internal hydrophobic aromatic ring amino acids and peptide strands to the solution.

  14. NCBI nr-aa BLAST: CBRC-CBRE-01-1547 [SEVENS

    Full Text Available CBRC-CBRE-01-1547 gb|AAP05763.1| notch-like transmembrane receptor LIN-12 [Caenorhabdit...is briggsae] gb|AAP05765.1| notch-like transmembrane receptor LIN-12 [Caenorhabditis briggsae] AAP05763.1 4e-83 60% ...

  15. NCBI nr-aa BLAST: CBRC-OANA-01-1968 [SEVENS

    Full Text Available CBRC-OANA-01-1968 gb|AAP13045.1| NADH dehydrogenase subunit 2 [Pseudochaenichthys georg...ianus] gb|AAP13046.1| NADH dehydrogenase subunit 2 [Pseudochaenichthys georgianus] AAP13045.1 0.17 23% ...

  16. NCBI nr-aa BLAST: CBRC-ATHA-05-0006 [SEVENS

    Full Text Available CBRC-ATHA-05-0006 gb|AAP45159.1| Plant viral-response family protein [Solanum bulboca...stanum] gb|AAP45189.1| Plant viral-response family protein [Solanum bulbocastanum] AAP45159.1 4e-13 23% ...

  17. 2013年美国儿科学会《儿童和青少年2型糖尿病诊治指南》解读%Interpretation of AAP Management of Tpye 2 Diabetes Mellitus in Children and Adolescents

    夏萍; 刘超

    2013-01-01

    For recent years,obesity and diabetes mellitus prevalence rates have been increasing year by year in children and adolescents.Treatment education and medication are not adequately available for the young patients.The first treatment guideline for children and adolescents has been published online in 2013 which provides the direction for practice.This article is comprehensive analysis of the part of guildeline,aiming to share with the issue-interested people.%近年来,儿童和青少年的肥胖与糖尿病发病率逐年增加,而多数对于T1DM及T2DM的教育与治疗药物并不适用于儿童和青少年患者.2013年,首个针对儿童与青少年新诊断T2DM管理指南在线发表,为临床诊疗提供了指导.本文对指南进行部分理解与说明,与同道共勉.

  18. Book Trade Research and Statistics. Prices of U.S. and Foreign Published Materials; Book Title Output and Average Prices: 2000 Final and 2001 Preliminary Figures; Book Sales Statistics, 2001: AAP Preliminary Estimates; U.S. Book Exports and Imports: 2001; Number of Book Outlets in the United States and Canada; Review Media Statistics.

    Sullivan, Sharon G.; Barr, Catherine; Grabois, Andrew

    2002-01-01

    Includes six articles that report on prices of U.S. and foreign published materials; book title output and average prices; book sales statistics; book exports and imports; book outlets in the U.S. and Canada; and review media statistics. (LRW)

  19. Arylazopyrazoles as Light-Responsive Molecular Switches in Cyclodextrin-Based Supramolecular Systems.

    Stricker, Lucas; Fritz, Eva-Corinna; Peterlechner, Martin; Doltsinis, Nikos L; Ravoo, Bart Jan

    2016-04-01

    A simple and high yield synthesis of water-soluble arylazopyrazoles (AAPs) featuring superior photophysical properties is reported. The introduction of a carboxylic acid allows the diverse functionalization of AAPs. Based on structural modifications of the switching unit the photophysical properties of the AAPs could be tuned to obtain molecular switches with favorable photostationary states. Furthermore, AAPs form stable and light-responsive host-guest complexes with β-cyclodextrin (β-CD). Our most efficient AAP shows binding affinities comparable to azobenzenes, but more effective switching and higher thermal stability of the Z-isomer. As a proof-of-principle, we investigated two CD-based supramolecular systems, containing either cyclodextrin vesicles (CDVs) or cyclodextrin-functionalized gold nanoparticles (CDAuNPs), which revealed excellent reversible, light-responsive aggregation and dispersion behavior. To conclude, AAPs have great potential to be incorporated as molecular switches in highly demanding and multivalent photoresponsive systems. PMID:26972671

  20. Ambient air pollution associated with suppressed serologic responses to Pneumocystis jirovecii in a prospective cohort of HIV-infected patients with Pneumocystis pneumonia.

    Blount, R. J.; Djawe, K.; Daly, K. R.; Jarlsberg, L.G.; Fong, S.; Balmes, J; Miller, R F; Walzer, P. D.; Huang, L; International HIV-associated Opportunistic Pneumonias Study

    2013-01-01

    BACKGROUND: Ambient air pollution (AAP) may be associated with increased risk for Pneumocystis pneumonia (PCP). The mechanisms underlying this association remain uncertain. OBJECTIVES: To determine if real-life exposures to AAP are associated with suppressed IgM antibody responses to P. jirovecii in HIV-infected (HIV+) patients with active PCP, and to determine if AAP, mediated by suppressed serologic responses to Pneumocystis, is associated with adverse clinical outcomes. METHODS: We conduct...

  1. National trends in off-label use of atypical antipsychotics in children and adolescents in the United States.

    Sohn, Minji; Moga, Daniela C; Blumenschein, Karen; Talbert, Jeffery

    2016-06-01

    The objectives of the study were as follows: to examine the national trend of pediatric atypical antipsychotic (AAP) use in the United States; to identify primary mental disorders associated with AAPs; to estimate the strength of independent associations between patient/provider characteristics and AAP use. Data are from the National Ambulatory Medical Care Survey and the National Hospital Ambulatory Medical Care Survey. First, average AAP prescription rates among 4 and 18-year-old patients between 1993 and 2010 were estimated. Second, data from 2007 to 2010 were combined and analyzed to identify primary mental disorders related to AAP prescription. Third, a multivariate logistic regression model was developed having the presence of AAP prescription as the dependent variable and patient/provider characteristics as explanatory variables. Adjusted odds ratios (AORs) with associated 95% confidence intervals (CIs) were estimated. Outpatient visits including an AAP prescription among 4 to 18-year-old patients significantly increased between 1993 and 2010 in the United States, and over 65% of those visits did not have diagnoses for US Food and Drug Administration-approved AAP indications. During 2007 to 2010, the most common mental disorder was attention-deficit hyperactivity disorder, accounting for 24% of total pediatric AAP visits. Among visits with attention-deficit hyperactivity disorder diagnosis, those with Medicaid as payer (AOR 1.66, 95% CI 1.01-2.75), comorbid mental disorders (e.g., psychoses AOR 3.34, 95% CI 1.35-8.26), and multiple prescriptions (4 or more prescriptions AOR 4.48, 95% CI 2.08-9.64) were more likely to have an AAP prescription. The off-label use of AAPs in children and adolescents is prevalent in the United States. Our study raises questions about the potential misuse of AAPs in the population. PMID:27281081

  2. Secondhand smoke in combination with ambient air pollution exposure is associated with increased CpG methylation and decreased expression of IFN-gamma in T effector cells and Foxp3 in T regulatory cells in children

    Kohli, Arunima; Garcia, Marco A; Miller, Rachel L.; Maher, Christina; Humblet, Olivier; Hammond, S; Nadeau, Kari

    2012-01-01

    Abstract Background Secondhand smoke (SHS) and ambient air pollution (AAP) exposures have been associated with increased prevalence and severity of asthma and DNA modifications of immune cells. In the current study, we examined the association between SHS and AAP with DNA methylation and expression of interferon-gamma (IFN-γ) and forkhead box protein 3 (Foxp3) in T cell populations. Methods Subjects 7–18 years old were recruited from Fresno (high AAP; n ...

  3. Temporal Changes and Altitudinal Distribution of Aerobic Anoxygenic Phototrophs in Mountain Lakes

    Čuperová, Zuzana; Holzer, Evelyn; Salka, Ivette; SOMMARUGA, RUBEN; Koblížek, Michal

    2013-01-01

    Aerobic anoxygenic phototrophs (AAPs) are bacteriochlorophyll a-containing microorganisms that use organic substrates for growth but can supplement their energy requirements with light. They have been reported from various marine and limnic environments; however, their ecology remains largely unknown. Here infrared epifluorescence microscopy was used to monitor temporal changes in AAPs in the alpine lake Gossenköllesee, located in the Tyrolean Alps, Austria. AAP abundance was low (103 cells m...

  4. Preparation and pharmaceutical evaluation of acetaminophen nano-fiber tablets: Application of a solvent-based electrospinning method for tableting.

    Hamori, Mami; Nagano, Kana; Kakimoto, Sayaka; Naruhashi, Kazumasa; Kiriyama, Akiko; Nishimura, Asako; Shibata, Nobuhito

    2016-03-01

    In this study, we developed nano-fiber-based tablets with acetaminophen (AAP; LogPow=0.51) for controlled-release delivery systems and evaluated in vitro drug dissolution and in vivo pharmacokinetics in rats. Nano-fibers made from methacrylic acid copolymer S (MAC; EUDRAGIT(®) S100) and containing AAP were prepared using a solvent-based electrospinning (ES) method. In vitro dissolution rate profiles of AAP showed tableting pressure-dependent decreases and pH-dependent increases. The results of tablet tracking by X-ray irradiation showed tablets based on MAC nano-fibers did not disintegrate in the upper intestinal lumen and had the properties of a long-term-acting tablet. In addition, the in vitro release profiles of AAP from nano-fiber tablets prepared by dissolving MAC with AAP (NFT), nano-fiber tablets prepared by adsorbing AAP to drug-free MAC nano-fibers (NFTadso), and tablets prepared by adsorbing half the amount of AAP to MAC nano-fibers containing the remaining amount of AAP (NFThalf) showed independent controlled-release aspects of AAP compared with physical mixture tablets (PMT). In vivo pharmacokinetic studies in rats after intraduodenal administration of 14mg/rat AAP in NFT, NFTadso, and NFThalf demonstrated that all these tablets based on MAC nano-fibers showed sustained-release profiles compared with PMT, and showed ultra-sustained release properties for AAP. These new tablets based on MAC nano-fibers did not disintegrate in the intestine in the lower pH region, and the tablets could regulate the release of AAP in a pH-dependent manner. The ES method is a useful technique to prepare nano-fibers and showed promising results as an oral delivery system for sustained-release regulation. PMID:26898420

  5. Chat, E-Mail, Web, and Chat Room Slang and Acronyms

    ... Shop AAP Find a Pediatrician Family Life Medical Home Health Insurance Pediatric Specialists Family Dynamics Adoption & Foster Care Communication & Discipline Types of Families Media Work & Play ...

  6. Cyberbullying

    ... Shop AAP Find a Pediatrician Family Life Medical Home Health Insurance Pediatric Specialists Family Dynamics Adoption & Foster Care Communication & Discipline Types of Families Media Work & Play ...

  7. Benefits of Limiting TV

    ... Shop AAP Find a Pediatrician Family Life Medical Home Health Insurance Pediatric Specialists Family Dynamics Adoption & Foster Care Communication & Discipline Types of Families Media Work & Play ...

  8. Characterization of a novel acylaminoacyl peptidase with hexameric structure and endopeptidase activity.

    Szeltner, Zoltán; Kiss, András L; Domokos, Klarissza; Harmat, Veronika; Náray-Szabó, Gábor; Polgár, László

    2009-08-01

    We have overexpressed in E. coli, purified and investigated the kinetic, thermodynamic and biophysical properties of an acylaminoacyl peptidase (AAP), from the thermophile Pyrococcus horikoshii (PhAAP). It was shown that the electrostatic environment of the catalytic site of PhAAP substantially influenced the pH dependence of the specificity rate constant (k(cat)/K(m)). However, 0.3 M NaCl, which depressed the electrostatic effects, simplified the complex pH-rate profile. The rate of formation of the enzyme-substrate complex (k(1)) was obtained from a non-linear Arrhenius plot. The lack of substrate leaving group effects indicated that k(1) is the rate determining step in the catalysis. DSC and CD measurements demonstrated that PhAAP displayed a stable structure in the catalytically competent pH range. It was shown that PhAAP is not just an acylaminoacyl peptidase, but it also has an endopeptidase activity and so differs from the mammalian AAPs. Size exclusion chromatography with PhAAP revealed a hexameric structure, which is unique among the known members of the prolyl oligopeptidase family that includes AAPs and suggests that its cellular function may be different from that of the dimeric AAP also found in the same organism. PMID:19303951

  9. Secondhand smoke in combination with ambient air pollution exposure is associated with increasedx CpG methylation and decreased expression of IFN-γ in T effector cells and Foxp3 in T regulatory cells in children

    Kohli Arunima; Garcia Marco A; Miller Rachel L; Maher Christina; Humblet Olivier; Hammond S; Nadeau Kari

    2012-01-01

    Abstract Background Secondhand smoke (SHS) and ambient air pollution (AAP) exposures have been associated with increased prevalence and severity of asthma and DNA modifications of immune cells. In the current study, we examined the association between SHS and AAP with DNA methylation and expression of interferon-gamma (IFN-γ) and forkhead box protein 3 (Foxp3) in T cell populations. Methods Subjects 7–18 years old were recruited from Fresno (high AAP; n = 62) and Stanford, CA (low AAP; n = 40...

  10. Chemoprotective effect of insulin-like growth factor I against acetaminophen-induced cell death in Chang liver cells via ERK1/2 activation

    The insulin-like growth factor (IGF) system and type-I IGF receptor (IGF-IR) signaling are involved in protecting against chemotherapeutic drug-induced cell death in human hepatoma cells. Acetaminophen (AAP) hepatotoxicity is the leading cause of liver failure, and the prevention of AAP-induced cell death has been the focus of many studies. We determined whether IGF-I could protect against AAP-induced cell death in Chang liver cells and investigated the protective mechanism. Based on the results of MTS assays, LDH release assays, Hoechst 33342 cell staining, and DNA fragmentation experiments, AAP induced cell death in a dose-dependent manner. According to Western blot analysis, treatment with AAP increased the level of poly(ADP-ribose) polymerase (PARP) fragments in cells compared with that in control cells; however, caspase-3, a critical signaling molecule in apoptosis, was not activated after AAP overdose. Moreover, combined treatment with AAP and IGF-I inhibited PARP cleavage, which was consistent with the ability of IGF-I to restore the level of glutathione (GSH) and cell viability in GSH and MTS assays, respectively. We investigated whether the protective effect of IGF-I against AAP cytotoxicity is related to the extracellular signal-related kinase ERK1/2, which is generally activated by mitogenic and proliferative stimuli such as growth factors. Compared with AAP treatment alone, IGF-I and AAP co-treatment increased ERK1/2 phosphorylation but inhibited PARP cleavage. Thus ERK1/2 activation is instrumental in the protective effect of IGF-I against AAP-induced cell death in Chang liver cells

  11. Enzymuria in neonates receiving continuous intravenous infusion of gentamicin

    Colding, H; Brygge, K; Brendstrup, L;

    1992-01-01

    with non-treatment periods in the same newborn infant (33 infants). The same tendency applied to AAP. Newborn infants receiving continuous intravenous infusion of gentamicin were not found to be at greater risk of nephrotoxicity than those receiving intermittent gentamicin treatment, using NAG and AAP...

  12. Increasing Availability to and Ascertaining Value of Asthma Action Plans in Schools through Use of Technology and Community Collaboration

    Hanson, Tabitha K.; Aleman, Martha; Hart, Lacey; Yawn, Barbara

    2013-01-01

    Background: Approximately 9% of school-aged children in the United States have asthma. Since 1997, the Asthma Action Plan (AAP) has been recommended as an asthma self-management tool for individuals with asthma. In the school setting, the use of the AAP has been primarily dependent on communication between the family and the school through a paper…

  13. Kinetic, Spectroscopic, and X-ray Crystallographic Characterization of the Functional E151H Aminopeptidase from Aeromonas proteolytica.

    Bzymek,K.; Moulin, A.; Swierczek, S.; Ringe, D.; Petsko, G.; Holz, R.

    2005-01-01

    Glutamate151 (E151) has been shown to be catalytically essential for the aminopeptidase from Vibrio proteolyticus (AAP). E151 acts as the general acid/base during the catalytic mechanism of peptide hydrolysis. However, a glutamate residue is not the only residue capable of functioning as a general acid/base during catalysis for dinuclear metallohydrolases. Recent crystallographic characterization of the D-aminopeptidase from Bacillus subtilis (DppA) revealed a histidine residue that resides in an identical position to E151 in AAP. Because the active-site ligands for DppA and AAP are identical, AAP has been used as a model enzyme to understand the mechanistic role of H115 in DppA. Substitution of E151 with histidine resulted in an active AAP enzyme exhibiting a k{sub cat} value of 2.0 min{sup -1}, which is over 2000 times slower than r AAP (4380 min{sup -1}). ITC experiments revealed that Zn{sup II} binds 330 and 3 times more weakly to E151H-AAP compared to r-AAP. UV-vis and EPR spectra of Co{sup II}-loaded E151H-AAP indicated that the first metal ion resides in a hexacoordinate/pentacoordinate equilibrium environment, whereas the second metal ion is six-coordinate. pH dependence of the kinetic parameters k{sub cat} and K{sub m} for the hydrolysis of L-leucine p-nitroanilide (L-pNA) revealed a change in an ionization constant in the enzyme-substrate complex from 5.3 in r-AAP to 6.4 in E151H-AAP, consistent with E151 in AAP being the active-site general acid/base. Proton inventory studies at pH 8.50 indicate the transfer of one proton in the rate-limiting step of the reaction. Moreover, the X-ray crystal structure of [ZnZn(E151H-AAP)] has been solved to 1.9 {angstrom} resolution, and alteration of E151 to histidine does not introduce any major conformational changes to the overall protein structure or the dinuclear Zn{sup II} active site. Therefore, a histidine residue can function as the general acid/base in hydrolysis reactions of peptides and, through analogy of

  14. Three-dimensional transesophageal echocardiography for descending aortic atheroma: a preliminary study.

    Hammoudi, Nadjib; Ihaddaden, Malek; Lang, Sylvie; Laveau, Florent; Ederhy, Stephane; Michel, Pierre-Louis; Alamowitch, Sonia; Cohen, Ariel

    2014-12-01

    Transesophageal echocardiography (TEE) is an efficient method for characterization of aortic atherosclerotic plaques (AAP). The aim of our study was to evaluate the feasibility and the additional contribution of three-dimensional (3D) TEE in the evaluation of AAPs in descending thoracic aorta. We studied 82 patients referred for TEE regardless of the indication. All patients underwent two-dimensional (2D) conventional acquisitions. A 3D TEE study was performed for all AAPs localized in the descending thoracic aorta. Thickness, degree of calcification, the presence of ulceration or mobile debris were compared for 2D and 3D modes. From 3D data, three types of AAPs were defined according to their morphological characteristics (surface and contours). Among 192 AAPs found on 2D acquisition, 189 (98.4 %) were also identified by 3D TEE. For AAP characterization, agreement was good between 2D TEE and 2D extracted from 3D with the multiplanar reconstruction mode: 83.6 % (k = 0.69) for thickness and 82.5 % (k = 0.72) for degree of calcification. All AAPs ulcerations (n = 13) and mobile debris (n = 3) seen in 2D were identified in 3D. 2D characteristics of the 3D AAPs' morphological types were different: type I plaques were thin and rarely calcified; type III plaques were thicker and often calcified; and type II presented intermediate characteristics. There was overlap among groups and the 3D morphology could not be predicted from 2D data. 3D TEE is a feasible method for the analysis of AAPs. In addition to conventional characterization, 3D TEE provides a new morphological approach to AAPs. PMID:25056253

  15. Monoclonal antibodies against accumulation-associated protein affect EPS biosynthesis and enhance bacterial accumulation of Staphylococcus epidermidis.

    Jian Hu

    Full Text Available Because there is no effective antibiotic to eradicate Staphylococcus epidermidis biofilm infections that lead to the failure of medical device implantations, the development of anti-biofilm vaccines is necessary. Biofilm formation by S. epidermidis requires accumulation-associated protein (Aap that contains sequence repeats known as G5 domains, which are responsible for the Zn(2+-dependent dimerization of Aap to mediate intercellular adhesion. Antibodies against Aap have been reported to inhibit biofilm accumulation. In the present study, three monoclonal antibodies (MAbs against the Aap C-terminal single B-repeat construct followed by the 79-aa half repeat (AapBrpt1.5 were generated. MAb(18B6 inhibited biofilm formation by S. epidermidis RP62A to 60% of the maximum, while MAb(25C11 and MAb(20B9 enhanced biofilm accumulation. All three MAbs aggregated the planktonic bacteria to form visible cell clusters. Epitope mapping revealed that the epitope of MAb(18B6, which recognizes an identical area within AapBrpt constructs from S. epidermidis RP62A, was not shared by MAb(25C11 and MAb(20B9. Furthermore, all three MAbs were found to affect both Aap expression and extracellular polymeric substance (EPS, including extracellular DNA and PIA biosynthesis in S. epidermidis and enhance the cell accumulation. These findings contribute to a better understanding of staphylococcal biofilm formation and will help to develop epitope-peptide vaccines against staphylococcal infections.

  16. Asparaginase-associated pancreatitis in children with acute lymphoblastic leukaemia in the NOPHO ALL2008 protocol.

    Raja, Raheel A; Schmiegelow, Kjeld; Albertsen, Birgitte K; Prunsild, Kaie; Zeller, Bernward; Vaitkeviciene, Goda; Abrahamsson, Jonas; Heyman, Mats; Taskinen, Mervi; Harila-Saari, Arja; Kanerva, Jukka; Frandsen, Thomas L

    2014-04-01

    L-asparaginase is an important drug in the treatment of childhood acute lymphoblastic leukaemia (ALL). Treatment is associated with several toxicities, including acute pancreatitis. Clinical course, presentation, re-exposure to L-asparginase after pancreatitis and risk of recurrent pancreatitis within an asparaginase-intensive protocol has been poorly reported. Children (1-17 years) on the ongoing Nordic Society of Paediatric Haematology and Oncology (NOPHO) ALL2008 protocol with asparaginase-associated pancreatitis (AAP) diagnosed between 2008 and 2012 were identified through the online NOPHO ALL toxicity registry. NOPHO ALL2008 includes eight or 15 doses of intramuscular pegylated L-asparginase (PEG-asparaginase) 1000 iu/m(2) /dose at 2-6 weeks intervals, with a total of 30 weeks of exposure to PEG-asparaginase (clinicaltrials.gov no: NCT00819351). Of 786 children, 45 were diagnosed with AAP with a cumulative risk of AAP of 5·9%. AAP occurred after a median of five doses (range 1-13), and 11 d (median) from the latest administration of PEG-Asparaginase. Thirteen patients developed pseudocysts (30%) and 11 patients developed necrosis (25%). One patient died from pancreatitis. Twelve AAP patients were re-exposed to L-asparginase, two of whom developed mild AAP once more, after four and six doses respectively. In conclusion, re-exposure to PEG-asparaginase in ALL patients with mild AAP seems safe. PMID:24428625

  17. Patterns in Abundance, Cell Size and Pigment Content of Aerobic Anoxygenic Phototrophic Bacteria along Environmental Gradients in Northern Lakes.

    Lisa Fauteux

    Full Text Available There is now evidence that aerobic anoxygenic phototrophic (AAP bacteria are widespread across aquatic systems, yet the factors that determine their abundance and activity are still not well understood, particularly in freshwaters. Here we describe the patterns in AAP abundance, cell size and pigment content across wide environmental gradients in 43 temperate and boreal lakes of Québec. AAP bacterial abundance varied from 1.51 to 5.49 x 105 cells mL-1, representing <1 to 37% of total bacterial abundance. AAP bacteria were present year-round, including the ice-cover period, but their abundance relative to total bacterial abundance was significantly lower in winter than in summer (2.6% and 7.7%, respectively. AAP bacterial cells were on average two-fold larger than the average bacterial cell size, thus AAP cells made a greater relative contribution to biomass than to abundance. Bacteriochlorophyll a (BChla concentration varied widely across lakes, and was not related to AAP bacterial abundance, suggesting a large intrinsic variability in the cellular pigment content. Absolute and relative AAP bacterial abundance increased with dissolved organic carbon (DOC, whereas cell-specific BChla content was negatively related to chlorophyll a (Chla. As a result, both the contribution of AAP bacteria to total prokaryotic abundance, and the cell-specific BChla pigment content were positively correlated with the DOC:Chla ratio, both peaking in highly colored, low-chlorophyll lakes. Our results suggest that photoheterotrophy might represent a significant ecological advantage in highly colored, low-chlorophyll lakes, where DOC pool is chemically and structurally more complex.

  18. Alarm Reduction Processing of Advanced Nuclear Power Plant Using Data Mining and Active Database Technologies

    The purpose of the Advanced Alarm Processing (AAP) is to extract only the most important and the most relevant data out of large amount of available information. It should be noted that the integrity of the knowledge base is the most critical in developing a reliable AAP. This paper proposes a new approach to an AAP by using Event-Condition-Action(ECA) rules that can be automatically triggered by an active database. Also this paper proposed a knowledge acquisition method using data mining techniques to obtain the integrity of the alarm knowledge

  19. Tonsillitis

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Print Share Tonsillitis Page Content Article Body My child has tonsillitis. Will he need to have his ...

  20. Competition and Cheating

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... value in these older peer relationships. If Your Child Cheats If you are confronted with a situation ...

  1. Movement and Coordination

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Movement and Coordination Page Content Article Body At this age, your child will seem to be continually on the go— ...

  2. Drinks to Prevent Dehydration in a Vomiting Child

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Share Drinks to Prevent Dehydration in a Vomiting Child Page Content Article Body For vomiting children, the ...

  3. Safety for Your Child: 6 Years

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... > Safety for Your Child: 6 Years Ages & Stages Listen Español Text Size ...

  4. Croup and Your Young Child

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Size Email Print Share Croup and Your Young Child Page Content Article Body Croup is a co​ ...

  5. Chronic Nosebleeds: What to Do

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... What To Do Page Content Article Body My child gets a lot of nosebleeds. What should we ...

  6. Wings and Stings

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... See “Stinging Insects and Asthma” below.) Is Your Child at Risk? How do you know if you ...

  7. Friend or Foe?

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Friend or Foe? Page Content Article Body Help your child navigate his social world by equipping him with ...

  8. Asthma Triggers and What to Do about Them

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... for exposure to these same things. Help Your Child Avoid Triggers While it is impossible to make ...

  9. Immunizations: Active vs. Passive

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP ... Active vs. Passive Page Content Article Body Pediatricians can protect your child by administering not only active immunizations , but sometimes ...

  10. Car Sickness

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Share Car Sickness Page Content Article Body My child gets sick in the car quite often. How ...

  11. Preventing the Spread of Illness in Child Care or School

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Print Share Preventing the Spread of Illness in Child Care or School Page Content Article Body In ...

  12. Treating Vomiting

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... vomits these fluids, notify your pediatrician. Modify Your Child's Diet For the first twenty-four hours or ...

  13. Child Care Provider's Guide to Safe Sleep

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Children > Family Life > Work & Play > A Child Care Provider's Guide to Safe Sleep Family Life ...

  14. Eczema

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Email Print Share Eczema: How to Help Your Child Avoid the Itch Page Content Article Body Eczema ...

  15. American Academy of Pediatrics

    ... of death. Study Urges Child Development Screening for Refugee Families Refugee children’s development is at risk due to the ... one-hour webinar. Health Topics Healthy Foster Care America AAP and its partners strive to improve the ...

  16. Positive recurrence of processes associated to crystal growth models.

    Andjel, A.; Menshikov, M. V.; Sisko, V.

    2006-01-01

    Comment: Published at http://dx.doi.org/10.1214/105051606000000079 in the Annals of Applied Probability (http://www.imstat.org/aap/) by the Institute of Mathematical Statistics (http://www.imstat.org)

  17. Normal Functioning Family

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Español Text Size Email Print Share Normal Functioning Family Page Content Article Body Is there any way ...

  18. Family Disruptions

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Life Listen Español Text Size Email Print Share Family Disruptions Page Content Article Body No matter how ...

  19. Roles within the Family

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Text Size Email Print Share Roles Within the Family Page Content Article Body Families are not democracies. ...

  20. Family Arguments

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Life Listen Español Text Size Email Print Share Family Arguments Page Content Article Body We seem to ...

  1. Hib Photos

    ... St. Paul, Minnesota Cerebrospinal fluid culture positive for Haemophilus influenzae , type b (Gram stain) www.vaccineinformation.org/photos/hib_aap001.jpg Copyright American Academy of Pediatrics Haemophilus influenzae type b. Cellulitis of the arm proven by blood culture ...

  2. Swimming Pool Safety

    ... Spread the Word Shop AAP Find a Pediatrician Safety & Prevention Immunizations All Around At Home At Play ... Español Text Size Email Print Share Swimming Pool Safety Page Content ​What is the best way to ...

  3. Feeding Vegetarian and Vegan Infants and Toddlers

    ... Men For Women For Seniors Feeding Vegetarian and Vegan Infants and Toddlers By Dayle Hayes, MS, RD ... of Pediatrics (AAP) agree: Well-planned vegetarian and vegan eating patterns are healthy for infants and toddlers. ...

  4. Cow's milk - infants

    ... page: //medlineplus.gov/ency/article/002448.htm Cow's milk - infants To use the sharing features on this ... old, you should not feed your baby cow's milk, according to the American Academy of Pediatrics (AAP). ...

  5. Blonanserin Augmentation of Atypical Antipsychotics in Patients with Schizophrenia-Who Benefits from Blonanserin Augmentation?: An Open-Label, Prospective, Multicenter Study

    Woo, Young Sup; Park, Joo Eon; Kim, Do-Hoon; Sohn, Inki; Hwang, Tae-Yeon; Park, Young-Min; Jon, Duk-In; Jeong, Jong-Hyun

    2016-01-01

    Objective The purpose of this study was to investigate the efficacy and tolerability of atypical antipsychotics (AAPs) with augmentation by blonanserin in schizophrenic patients. Methods aA total of 100 patients with schizophrenia who were partially or completely unresponsive to treatment with an AAP were recruited in this 12-week, open-label, non-comparative, multicenter study. Blonanserin was added to their existing AAP regimen, which was maintained during the study period. Efficacy was primarily evaluated using the Positive and Negative Syndrome Scale (PANSS) at baseline and at weeks 2, 4, 8, and 12. Predictors for PANSS response (≥20% reduction) were investigated. Results The PANSS total score was significantly decreased at 12 weeks of blonanserin augmentation (-21.0±18.1, F=105.849, pschizophrenia who were partially or completely unresponsive to treatment with an AAP.

  6. Swearing

    ... Find a Pediatrician Newsletters Symptom Checker Apps E-Magazine Our Mission Our Mission Our Mission AAP in ... swearing may be just another symptom of a psychological or social disturbance. In this situation, talk to ...

  7. Signs of Overload

    ... Find a Pediatrician Newsletters Symptom Checker Apps E-Magazine Our Mission Our Mission Our Mission AAP in ... that it is undermining your child's physical or psychological well-being. Here are some clues that stress ...

  8. Masturbation

    ... Find a Pediatrician Newsletters Symptom Checker Apps E-Magazine Our Mission Our Mission Our Mission AAP in ... or public masturbation may indicate a more serious psychological or personal problem. It could be a sign ...

  9. Mental Health Care: Who's Who

    ... Find a Pediatrician Newsletters Symptom Checker Apps E-Magazine Our Mission Our Mission Our Mission AAP in ... used to measure a young person’s intellect and psychological health. All of the mental health counselors listed ...

  10. Rapid determination of total phenols in seawater by 4-aminoantipyrine colorimetry

    Kadam, A.N.; Bhangale, V.P.

    A rapid and efficient 4-aminoantipyrine (4-AAP) colorimetric method without any cleanup step to determine total phenols in seawater is described. Efficiency of the method for seawater using external addition of phenol concentrations with working...

  11. Spontaneous Ejaculations in an Adolescent With Olanzapine Use: Case Report.

    Yektaş, Çiğdem; Tufan, Ali Evren

    2016-01-01

    Olanzapine (OLZ) is a second-generation atypical antipsychotic (AAP) frequently used in acute and maintenance treatment of children and adolescents with psychotic disorders. Most commonly reported sexual problems caused by AAPs are decreases in libido or arousal, erectile dysfunctions, reduced/abnormal ejaculations, and problems in achieving or maintaining orgasm. Olanzapine is less commonly implicated for those adverse effects, which may reflect its more selective affinity to dopaminergic receptors or more transient effects on prolactin levels. Sexual dysfunction with AAPs, including OLZ, is reported predominantly in adult patients and adverse sexual effects in prepubertal/peripubertal patients with psychosis received scant attention. Studies and reports of sexual adverse effects of AAPs in this special population may benefit clinicians. Therefore, in this study, we report an adolescent male patient with psychosis who developed spontaneous ejaculations with OLZ and whose complaints remitted with change in treatment. PMID:26882319

  12. Circumcision

    Circumcision is a surgical procedure to remove the foreskin, the skin that covers the tip of the ... AAP), there are medical benefits and risks to circumcision. Possible benefits include a lower risk of urinary ...

  13. Baltimore Eesti Selts - 75 / Vilve Ladon ; fotod: Fred Ise

    Ladon, Vilve

    2010-01-01

    Baltimore Eesti Majas tähistati 2. okt. 2010 Baltimore Eesti Seltsi aastapäeva. Eesti suursaatkonna esimene sekretär poliitilistes küsimustes Aap Neljas edastas president Toomas Hendrik Ilvese tervituse

  14. Social Development:: 2 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Ages & Stages > Toddler > Social Development: 2 Year Olds Ages & Stages Listen Español Text ...

  15. Concerns Girls Have about Puberty

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Content Article Body Girls have pubertal concerns and worries, too, including: Breast Development Some girls also have anxieties about breast development. ...

  16. Emotional Development: 2 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Emotional Development: 2 Year Olds Ages & Stages Listen Español Text ...

  17. Cognitive Development: Two-Year-Old

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Cognitive Development: Two-Year-Old Ages & Stages Listen Español Text ...

  18. Cognitive Development: One-Year-Old

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Cognitive Development: One-Year-Old Ages & Stages Listen Español Text ...

  19. Normal Child Behavior

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... is "normal" depends upon the child's level of development, which can vary greatly among children of the ...

  20. Eyelid Problems

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... irregular shape (astigmatism), it will threaten normal vision development and must be corrected as early as possible. ...

  1. Emotional Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Emotional Development: 1 Year Olds Ages & Stages Listen Español Text ...

  2. Social Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Ages & Stages > Toddler > Social Development: 1 Year Olds Ages & Stages Listen Español Text ...

  3. Physical Development: What's Normal? What's Not?

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... > Puberty > Physical Development: What’s Normal? What’s Not? Ages & Stages Listen Español ...

  4. Iron Supplements Reduce Behavior Problems in Low Birth Weight Infants

    ... Content Social Media Toolkit Donate Now Corporate Relationships Advertise with AAP Help/Feedback Recent a a a print email share Facebook Twitter Iron Supplements Reduce Behavior Problems in Low ...

  5. Gene : CBRC-OCUN-01-0570 [SEVENS

    Full Text Available asal 1 receptor 2 [Homo sapiens] sp|Q8NFZ6|VN1R2_HUMAN Vomeronasal type-1 receptor 2 (V1r-like receptor 2) (...hGPCR25) dbj|BAB89320.1| putative G-protein coupled receptor [Homo sapiens] gb|AAP85616.1| pheromone receptor [Homo sapie...ns] gb|AAP85617.1| pheromone receptor [Homo sapiens] 1e-11 34% gnl|U...VISISTTCLLSVFQAITISPMNSRWAESKPKLQRLLAFPVTKTDTAIGILSTCHDVLWFLLMLWASGSTVFILHCTGRGSNTFIRATSCQDAARDHSSPKNPIEHLGLSLLLAFQLPVPLFLSHKCCVCTGRKRQFSQFRRI ...

  6. Management of acute gastroenteritis in healthy children in Lebanon - A national survey

    Nahida Rifai; Sawsan Mourad; Aouni Alameddine

    2010-01-01

    Background: Acute gastroenteritis remains a common condition among infants and children throughout the world. In 1996, The American Academy of Pediatrics (AAP) revised its recommendations for the treatment of infants and children with acute gastroenteritis. Aim: The purpose of this survey was to determine how closely current treatment among Lebanese pediatricians compares with the AAP recommendations and to determine the impact of such management on the healthcare system. Patients and Methods...

  7. AcEST: DK953689 [AcEST

    Full Text Available TST39A01NGRL0018_H03 613 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_H03. 5' end seq ... e-32 tr|Q2AAC8|Q2AAC8_9ASTR Cysteine proteinase OS=Platycodon ... grandif... 142 1e-32 tr|A3AAP5|A3AAP5_ORYSJ Putati ...

  8. Diet quality, nutrient intake, weight status, and feeding environments of girls meeting or exceeding the American Academy of Pediatrics recommendations for total dietary fat

    Lee, Y.; Birch, L. L.

    2002-01-01

    The American Academy of Pediatrics (AAP) recommends that children consume no more than 30% but no less than 20% of energy as dietary fat intake, and tills recommendation, is accompanied by suggestions that fat calories should be replaced by eating more grain products, fruits, vegetables, low fat datiy products, beans, lean meat, poultry, fish, and other protein rich foods. In comparing diets of girls meeting this AAP recommendation with girls who consumed diets higher in fat, we noted that gi...

  9. Involvement of mitochondria in acetaminophen-induced apoptosis and hepatic injury Roles of cytochrome c, Bax, Bid, and caspases

    The role of apoptosis in acetaminophen (AAP)-induced hepatic injury was investigated. Six hours after AAP administration to BALB/c mice, a significant loss of hepatic mitochondrial cytochrome c was observed that was similar in extent to the loss observed after in vivo activation of CD95 by antibody treatment. AAP-induced loss of mitochondrial cytochrome c coincided with the appearance in the cytosol of a fragment corresponding to truncated Bid (tBid). At the same time, tBid became detectable in the mitochondrial fraction, and concomitantly, Bax was found translocated to mitochondria. However, AAP failed to activate the execution caspases 3 and 7 as evidenced by a lack of procaspase processing and the absence of an increase in caspase-3-like activity. In contrast, the administration of the pan-inhibitor of caspases, benzyloxycarbonyl-Val-Ala-DL-Asp-fluoromethylketone (but not its analogue benzyloxycarbonyl-Phe-Ala-fluoromethylketone) prevented the development of liver injury by AAP and the appearance of apoptotic parenchymal cells. This correlated with the inhibition of the processing of Bid to tBid. The caspase inhibitor failed to prevent both the redistribution of Bax to the mitochondria and the loss of cytochrome c. In conclusion, apoptosis is an important causal event in the initiation of the hepatic injury inflicted by AAP. However, as suggested by the lack of activation of the main execution caspases, apoptosis is not properly executed and degenerates into necrosis

  10. Catalytically distinct states captured in a crystal lattice: the substrate-bound and scavenger states of acylaminoacyl peptidase and their implications for functionality.

    Menyhárd, Dóra Karancsiné; Orgován, Zoltán; Szeltner, Zoltán; Szamosi, Ilona; Harmat, Veronika

    2015-03-01

    Acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments. In the case of AAP from Aeropyrum pernix (ApAAP), previous studies have led to a model in which the clamshell-like opening and closing of the enzyme provides the means of substrate-size selection. The closed form of the enzyme is catalytically active, while opening deactivates the catalytic triad. The crystallographic results presented here show that the open form of ApAAP is indeed functionally disabled. The obtained crystal structures also reveal that the closed form is penetrable to small ligands: inhibitor added to the pre-formed crystal was able to reach the active site of the rigidified protein, which is only possible through the narrow channel of the propeller domain. Molecular-dynamics simulations investigating the structure of the complexes formed with longer peptide substrates showed that their binding within the large crevice of the closed form of ApAAP leaves the enzyme structure unperturbed; however, their accessing the binding site seems more probable when assisted by opening of the enzyme. Thus, the open form of ApAAP corresponds to a scavenger of possible substrates, the actual cleavage of which only takes place if the enzyme is able to re-close. PMID:25760596

  11. Ascorbic acid prevents acetaminophen-induced hepatotoxicity in mice by ameliorating glutathione recovery and autophagy.

    Kurahashi, Toshihiro; Lee, Jaeyong; Nabeshima, Atsunori; Homma, Takujiro; Kang, Eun Sil; Saito, Yuka; Yamada, Sohsuke; Nakayama, Toshiyuki; Yamada, Ken-Ichi; Miyata, Satoshi; Fujii, Junichi

    2016-08-15

    Aldehyde reductase (AKR1A) plays a role in the biosynthesis of ascorbic acid (AsA), and AKR1A-deficient mice produce about 10-15% of the AsA that is produced by wild-type mice. We found that acetaminophen (AAP) hepatotoxicity was aggravated in AKR1A-deficient mice. The pre-administration of AsA in the drinking water markedly ameliorated the AAP hepatotoxicity in the AKR1A-deficient mice. Treatment of the mice with AAP decreased both glutathione and AsA levels in the liver in the early phase after AAP administration, and an AsA deficiency delayed the recovery of the glutathione content in the healing phase. While in cysteine supply systems; a neutral amino acid transporter ASCT1, a cystine transporter xCT, enzymes for the transsulfuration pathway, and autophagy markers, were all elevated in the liver as the result of the AAP treatment, the AsA deficiency suppressed their induction. Thus, AsA appeared to exert a protective effect against AAP hepatotoxicity by ameliorating the supply of cysteine that is available for glutathione synthesis as a whole. Because some drugs produce reactive oxygen species, resulting in the consumption of glutathione during the metabolic process, the intake of sufficient amounts of AsA would be beneficial for protecting against the hepatic damage caused by such drugs. PMID:27288086

  12. CT and MR imaging in patients with localized acute abdominal pain

    Full text: Acute abdominal pain (AAP) is one of the most common causes for admissions to emergency departments. Clinical presentation, physical and laboratory examinations are often inconclusive and, therefore, imaging evaluation is required. Ultrasonography is efficient in the evaluation of gallbladder and gynecologic conditions and it is considered the first-line examination in many centres. Plain radiography and barium studies are often falsely normal or non-specific, especially in the most common conditions related with rightsided AAP and their use has significantly decreased. CT is a rapid and accurate imaging modality in the diagnosis of common (appendicitis, acute cholecystitis, biliary obstruction, duodenal ulcer perforation) or uncommon (mesenteric adenitis, liver abscess, cholangitis etc) conditions associated with right-sided AAP. CT may demonstrate a number of either specific or sensitive imaging findings for the confident diagnosis of diseases manifested with AAP. Moreover, CT has the advantage to suggest alternative diagnoses, if the suspected clinical diagnosis is unconfirmed. Different examination protocols and different strategies for the application of oral-rectal-intravenous contrast agents have been proposed to balance diagnostic accuracy to time effectiveness and radiation dose. MRI is suggested for AAP related to biliary abnormalities or to gynecologic diseases and it may be used as a complementary examination in pregnant patients. Imaging evaluation is an indispensable part in the diagnostic work up of most patients with AAP. CT has gained widespread acceptance, as offering more accurate and confident diagnosis and its use has changed management of the patients in 28-60% of the cases

  13. Korean Medication Algorithm Project for Bipolar Disorder: third revision

    Woo YS

    2015-02-01

    Full Text Available Young Sup Woo,1 Jung Goo Lee,2,3 Jong-Hyun Jeong,1 Moon-Doo Kim,4 Inki Sohn,5 Se-Hoon Shim,6 Duk-In Jon,7 Jeong Seok Seo,8 Young-Chul Shin,9 Kyung Joon Min,10 Bo-Hyun Yoon,11 Won-Myong Bahk1 1Department of Psychiatry, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 2Department of Psychiatry, Inje University Haeundae Paik Hospital, Busan, South Korea;3Paik Institute for Clinical Research, Inje Univeristy, Busan, South Korea; 4Department of Psychiatry, Jeju National University Hospital, Jeju, South Korea; 5Department of Psychiatry, Keyo Hospital, Keyo Medical Foundation, Uiwang, South Korea; 6Department of Psychiatry, Soonchunhyang University Cheonan Hospital, Soonchunhyang University, Cheonan, South Korea; 7Department of Psychiatry, Sacred Heart Hospital, Hallym University, Anyang, South Korea; 8Department of Psychiatry, School of Medicine, Konkuk University, Chungju, South Korea; 9Department of Psychiatry, Kangbuk Samsung Hospital, School of Medicine, Sungkyunkwan University, Seoul, South Korea; 10Department of Psychiatry, College of Medicine, Chung-Ang University, Seoul, South Korea; 11Department of Psychiatry, Naju National Hospital, Naju, South Korea Objective: To constitute the third revision of the guidelines for the treatment of bipolar disorder issued by the Korean Medication Algorithm Project for Bipolar Disorder (KMAP-BP 2014. Methods: A 56-item questionnaire was used to obtain the consensus of experts regarding pharmacological treatment strategies for the various phases of bipolar disorder and for special populations. The review committee included 110 Korean psychiatrists and 38 experts for child and adolescent psychiatry. Of the committee members, 64 general psychiatrists and 23 child and adolescent psychiatrists responded to the survey. Results: The treatment of choice (TOC for euphoric, mixed, and psychotic mania was the combination of a mood stabilizer (MS and an atypical antipsychotic (AAP; the TOC for

  14. Ultrasonic degradation of acetaminophen and naproxen in the presence of single-walled carbon nanotubes

    Im, Jong-Kwon; Heo, Jiyong; Boateng, Linkel K. [Department of Civil and Environmental Engineering, University of South Carolina, Columbia, SC 29208 (United States); Her, Namguk [Department of Chemistry and Environmental Sciences, Korea Army Academy at Young-Cheon, 135-1, Changhari, Kokyungmeon, Young-cheon, Gyeongbuk 770-849 (Korea, Republic of); Flora, Joseph R.V. [Department of Civil and Environmental Engineering, University of South Carolina, Columbia, SC 29208 (United States); Yoon, Jaekyung [Korea Institute of Energy Research, New and Renewable Energy Research Division, 71-2 Jang-Dong, Yuseong-Gu, Daejeon 305-343 (Korea, Republic of); Zoh, Kyung-Duk [Department of Environmental Health, School of Public Health, Seoul National University, Seoul 151-742 (Korea, Republic of); Yoon, Yeomin, E-mail: yoony@cec.sc.edu [Department of Civil and Environmental Engineering, University of South Carolina, Columbia, SC 29208 (United States)

    2013-06-15

    Highlights: • Sonodegradation of acetaminophen and naproxen was performed. • Degradation was enhanced with the dispersion of SWNTs under US irradiation. • Synergistic effect on the degradation PhACs was observed in US/SWNT process. • Significant removal of dissolved organic carbon was achieved. -- Abstract: Ultrasonic (US) and single-walled carbon nanotube (SWNT)-catalyzed ultrasonic (US/SWNT) degradation of a pharmaceutical (PhAC) mixture of acetaminophen (AAP) and naproxen (NPX) used as analgesics was carried out in water. In the absence of SWNTs, maximum degradations of AAP and NPX occurred at a high frequency (1000 kHz) and under acidic conditions (pH 3) and different solution temperatures (25 °C at 28 kHz and 35 °C at 1000 kHz) during US reactions. Rapid degradation of PhACs occurred within 10 min at 28 kHz (44.5% for AAP; 90.3% for NPX) and 1000 kHz (39.2% for AAP; 74.8% for NPX) at a SWNT concentration of 45 mg L{sup −1} under US/SWNT process, compared with 28 kHz (5.2% for AAP; 10.6% for NPX) and 1000 kHz (29.1% for AAP; 46.2% for NPX) under US process. Degradation was associated with the dispersion of SWNTs; small particles acted as nuclei during US reactions, enhancing the H{sub 2}O{sub 2} production yield. NPX removal was greater than AAP removal under all US-induced reaction and SWNT adsorption conditions, which is governed by the chemical properties of PhACs. Based on the results, the optimal treatment performance was observed at 28 kHz with 45 mg L{sup −1} SWNTs (US/SWNT) within 10 min.

  15. Ultrasonic degradation of acetaminophen and naproxen in the presence of single-walled carbon nanotubes

    Highlights: • Sonodegradation of acetaminophen and naproxen was performed. • Degradation was enhanced with the dispersion of SWNTs under US irradiation. • Synergistic effect on the degradation PhACs was observed in US/SWNT process. • Significant removal of dissolved organic carbon was achieved. -- Abstract: Ultrasonic (US) and single-walled carbon nanotube (SWNT)-catalyzed ultrasonic (US/SWNT) degradation of a pharmaceutical (PhAC) mixture of acetaminophen (AAP) and naproxen (NPX) used as analgesics was carried out in water. In the absence of SWNTs, maximum degradations of AAP and NPX occurred at a high frequency (1000 kHz) and under acidic conditions (pH 3) and different solution temperatures (25 °C at 28 kHz and 35 °C at 1000 kHz) during US reactions. Rapid degradation of PhACs occurred within 10 min at 28 kHz (44.5% for AAP; 90.3% for NPX) and 1000 kHz (39.2% for AAP; 74.8% for NPX) at a SWNT concentration of 45 mg L−1 under US/SWNT process, compared with 28 kHz (5.2% for AAP; 10.6% for NPX) and 1000 kHz (29.1% for AAP; 46.2% for NPX) under US process. Degradation was associated with the dispersion of SWNTs; small particles acted as nuclei during US reactions, enhancing the H2O2 production yield. NPX removal was greater than AAP removal under all US-induced reaction and SWNT adsorption conditions, which is governed by the chemical properties of PhACs. Based on the results, the optimal treatment performance was observed at 28 kHz with 45 mg L−1 SWNTs (US/SWNT) within 10 min

  16. Transformation of acetaminophen during water chlorination treatment: kinetics and transformation products identification.

    Cao, Fei; Zhang, Mengtao; Yuan, Shoujun; Feng, Jingwei; Wang, Qiquan; Wang, Wei; Hu, Zhenhu

    2016-06-01

    As a high-consumption drug in the world, acetaminophen (AAP) has been widely detected in natural waters and wastewaters. Its reactivity and the transformation products formed during chlorination may greatly threaten the safety of drinking water. The reaction kinetics of AAP during chlorination was investigated in this study. The results showed that the reaction kinetics could be well described with a kinetics model of -d[AAP]/dt = k app[AAP]t (0.63)[Cl2]t (1.37). The values of apparent rate constant (k app) were dependent on reaction temperature, ammonium, and pH. With the increase in reaction temperature from 5.0 ± 1.0 to 40.0 ± 1.0 °C, the removal efficiency of AAP increased from 60 to 100 %. When ammonium was present in the solution at 2.0 mg/L, the transformation of AAP was inhibited due to the rapid formation of chloramines. The maximum of k app was 0.58 × 10(2) M(-1) · min(-1) at pH 9.0, and the minimum was 0.27 M(-1) · min(-1) at pH 11.0. A low mineralization of AAP (about 7.2 %) with chlorination was observed through TOC analysis, implying the formation of plenty of transformation products during chlorination. The main transformation products, hydroquinone and two kinds of chlorinated compounds, monochlorinated acetaminophen and dichlorinated acetaminophen, were detected in gas chromatography-mass spectrometry analysis. PMID:26983813

  17. Advanced Avionics and Processor Systems for a Flexible Space Exploration Architecture

    Keys, Andrew S.; Adams, James H.; Smith, Leigh M.; Johnson, Michael A.; Cressler, John D.

    2010-01-01

    The Advanced Avionics and Processor Systems (AAPS) project, formerly known as the Radiation Hardened Electronics for Space Environments (RHESE) project, endeavors to develop advanced avionic and processor technologies anticipated to be used by NASA s currently evolving space exploration architectures. The AAPS project is a part of the Exploration Technology Development Program, which funds an entire suite of technologies that are aimed at enabling NASA s ability to explore beyond low earth orbit. NASA s Marshall Space Flight Center (MSFC) manages the AAPS project. AAPS uses a broad-scoped approach to developing avionic and processor systems. Investment areas include advanced electronic designs and technologies capable of providing environmental hardness, reconfigurable computing techniques, software tools for radiation effects assessment, and radiation environment modeling tools. Near-term emphasis within the multiple AAPS tasks focuses on developing prototype components using semiconductor processes and materials (such as Silicon-Germanium (SiGe)) to enhance a device s tolerance to radiation events and low temperature environments. As the SiGe technology will culminate in a delivered prototype this fiscal year, the project emphasis shifts its focus to developing low-power, high efficiency total processor hardening techniques. In addition to processor development, the project endeavors to demonstrate techniques applicable to reconfigurable computing and partially reconfigurable Field Programmable Gate Arrays (FPGAs). This capability enables avionic architectures the ability to develop FPGA-based, radiation tolerant processor boards that can serve in multiple physical locations throughout the spacecraft and perform multiple functions during the course of the mission. The individual tasks that comprise AAPS are diverse, yet united in the common endeavor to develop electronics capable of operating within the harsh environment of space. Specifically, the AAPS tasks for

  18. Diversity of cultivated and metabolically active aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    Jeanthon, C.; Boeuf, D.; Dahan, O.; Le Gall, F.; Garczarek, L.; Bendif, E. M.; Lehours, A.-C.

    2011-07-01

    Aerobic anoxygenic phototrophic (AAP) bacteria play significant roles in the bacterioplankton productivity and biogeochemical cycles of the surface ocean. In this study, we applied both cultivation and mRNA-based molecular methods to explore the diversity of AAP bacteria along an oligotrophic gradient in the Mediterranean Sea in early summer 2008. Colony-forming units obtained on three different agar media were screened for the production of bacteriochlorophyll-a (BChl-a), the light-harvesting pigment of AAP bacteria. BChl-a-containing colonies represented a low part of the cultivable fraction. In total, 54 AAP strains were isolated and the phylogenetic analyses based on their 16S rRNA and pufM genes showed that they were all affiliated to the Alphaproteobacteria. The most frequently isolated strains belonged to Citromicrobium bathyomarinum, and Erythrobacter and Roseovarius species. Most other isolates were related to species not reported to produce BChl-a and/or may represent novel taxa. Direct extraction of RNA from seawater samples enabled the analysis of the expression of pufM, the gene coding for the M subunit of the reaction centre complex of aerobic anoxygenic photosynthesis. Clone libraries of pufM gene transcripts revealed that most phylotypes were highly similar to sequences previously recovered from the Mediterranean Sea and a large majority (~94 %) was affiliated to the Gammaproteobacteria. The most abundantly detected phylotypes occurred in the western and eastern Mediterranean basins. However, some were exclusively detected in the eastern basin, reflecting the highest diversity of pufM transcripts observed in this ultra-oligotrophic region. To our knowledge, this is the first study to document extensively the diversity of AAP isolates and to unveil the active AAP community in an oligotrophic marine environment. By pointing out the discrepancies between culture-based and molecular methods, this study highlights the existing gaps in the understanding

  19. Picoplankton Bloom in Global South? A High Fraction of Aerobic Anoxygenic Phototrophic Bacteria in Metagenomes from a Coastal Bay (Arraial do Cabo--Brazil).

    Cuadrat, Rafael R C; Ferrera, Isabel; Grossart, Hans-Peter; Dávila, Alberto M R

    2016-02-01

    Marine habitats harbor a great diversity of microorganism from the three domains of life, only a small fraction of which can be cultivated. Metagenomic approaches are increasingly popular for addressing microbial diversity without culture, serving as sensitive and relatively unbiased methods for identifying and cataloging the diversity of nucleic acid sequences derived from organisms in environmental samples. Aerobic anoxygenic phototrophic bacteria (AAP) play important roles in carbon and energy cycling in aquatic systems. In oceans, those bacteria are widely distributed; however, their abundance and importance are still poorly understood. The aim of this study was to estimate abundance and diversity of AAPs in metagenomes from an upwelling affected coastal bay in Arraial do Cabo, Brazil, using in silico screening for the anoxygenic photosynthesis core genes. Metagenomes from the Global Ocean Sample Expedition (GOS) were screened for comparative purposes. AAPs were highly abundant in the free-living bacterial fraction from Arraial do Cabo: 23.88% of total bacterial cells, compared with 15% in the GOS dataset. Of the ten most AAP abundant samples from GOS, eight were collected close to the Equator where solar irradiation is high year-round. We were able to assign most retrieved sequences to phylo-groups, with a particularly high abundance of Roseobacter in Arraial do Cabo samples. The high abundance of AAP in this tropical bay may be related to the upwelling phenomenon and subsequent picoplankton bloom. These results suggest a link between upwelling and light abundance and demonstrate AAP even in oligotrophic tropical and subtropical environments. Longitudinal studies in the Arraial do Cabo region are warranted to understand the dynamics of AAP at different locations and seasons, and the ecological role of these unique bacteria for biogeochemical and energy cycling in the ocean. PMID:26871866

  20. Novel Spectrophotometric Method for Determination of Macro-paracetamol via Reaction with Bromine

    1999-01-01

    The reaction between Br2 and paracetamol(p-AAP) leads to the formation of a coloured product, which can be used for spectrophotometric determination of the p-AAP content in its pure form and in different pharmaceutical preparations with p-AAP. The stoichiometric composition of the reaction was found to be n(p-AAP)∶n(bromine)=1∶3. The effects of pH and time on the spectra of p-AAP-bromine redox reaction product were studied. The interference of different additives on the measured spectra of the obtained product was also studied. The results obtained by the present method were compared with those obtained by the standard method. The F- and t- test values were calculated for both of the applied procedures and they met a confidence level of 99%. The proposed procedure actually needs no separation of these drugs from their sources before analysis and was unaffected by interference of other phenolic compounds. The proposed method is simpler and faster than the repoeted ones.

  1. Ecology of aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    D. Lamy

    2011-01-01

    Full Text Available Aerobic anoxygenic phototrophic (AAP bacteria are photoheterotrophic prokaryotes able to use both light and organic substrates for energy production. They are widely distributed in coastal and oceanic environments and may contribute significantly to the carbon cycle in the upper ocean. To better understand questions regarding links between the ecology of these photoheterotrophic bacteria and the trophic status of water masses, we examined their horizontal and vertical distribution and the effects of nutrient additions on their growth along an oligotrophic gradient in the Mediterranean Sea. Concentrations of bacteriochlorophyll-a (BChl-a and AAP bacterial abundance decreased from the western to the eastern basins of the Mediterranean Sea and were linked with concentrations of chlorophyll-a, nutrient and dissolved organic carbon. Inorganic nutrient and glucose additions to surface seawater samples along the oligotrophic gradient revealed that AAP bacteria were nitrogen- and carbon-limited in the ultra-oligotrophic eastern basin. The intensity of the AAP bacterial growth response generally differed from that of the total bacterial growth response. BChl-a quota of AAP bacterial communities was significantly higher in the eastern basin than in the western basin, suggesting that reliance on phototrophy varied along the oligotrophic gradient and that nutrient and/or carbon limitation favors BChl-a synthesis.

  2. Ecology of aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    D. Lamy

    2011-04-01

    Full Text Available Aerobic anoxygenic phototrophic (AAP bacteria are photoheterotrophic prokaryotes able to use both light and organic substrates for energy production. They are widely distributed in coastal and oceanic environments and may contribute significantly to the carbon cycle in the upper ocean. To better understand questions regarding links between the ecology of these photoheterotrophic bacteria and the trophic status of water masses, we examined their horizontal and vertical distribution and the effects of nutrient additions on their growth along an oligotrophic gradient in the Mediterranean Sea. Concentrations of bacteriochlorophyll-a (BChl-a and AAP bacterial abundance decreased from the western to the eastern basin of the Mediterranean Sea and were linked with concentrations of chlorophyll-a, nutrient and dissolved organic carbon. Inorganic nutrient and glucose additions to surface seawater samples along the oligotrophic gradient revealed that AAP bacteria were nitrogen- and carbon-limited in the ultraoligotrophic eastern basin. The intensity of the AAP bacterial growth response generally differed from that of the total bacterial growth response. BChl-a quota of AAP bacterial communities was significantly higher in the eastern basin than in the western basin, suggesting that reliance on phototrophy varied along the oligotrophic gradient and that nutrient and/or carbon limitation favors BChl-a synthesis.

  3. Comparative validity of the Adult Attachment Interview and the Adult Attachment Projective.

    Jones-Mason, Karen; Allen, I Elaine; Hamilton, Steve; Weiss, Sandra J

    2015-01-01

    The Adult Attachment Interview (AAI) and the Adult Attachment Projective (AAP) purport to measure the same attachment classifications. The aims of this study were to determine the concurrent validity of the AAI and AAP, and to compare their ability to predict indicators of risk associated with socioeconomic status (SES), depression, and 5-HTTLPR genotype. Results indicated no agreement between AAI and AAP attachment classifications in a sample of late adolescents. As predicted, individuals classified as "unresolved" with regard to loss or trauma were significantly more likely to be of lower SES, have higher levels of depression, and have the 5-HTTLPR "ss" genotype than individuals with secure, preoccupied, or dismissing attachments. These associations, however, were only significant when attachment was classified with the AAI. Results suggest that the AAI and AAP measure different facets of attachment as a result of their unique methodologies and coding criteria. Further research is needed to support their comparability before investigators can assume that the AAP is a valid substitute for the AAI. PMID:26362584

  4. Influence of selected environmental factors on the abundance of aerobic anoxygenic phototrophs in peat-bog lakes.

    Lew, Sylwia; Lew, Marcin; Koblížek, Michal

    2016-07-01

    Aerobic anoxygenic phototrophs (AAPs) are photoheterotrophic prokaryotes that are widespread in many limnic and marine environments. So far, little is known about their distribution in peat-bog lakes. Seventeen peat-bog lakes were sampled during three summer seasons 2009, 2011, and 2012, and the vertical distribution of AAPs was determined by infrared epifluorescence microscopy. The analysis demonstrated that in the surface layers of the studied lakes, AAP abundance ranged from 0.3 to 12.04 × 10(5) cells mL(-1), which represents water column with minimum numbers in the anoxic bottom waters. We have shown that the AAP abundance was significantly positively correlated with the water pH, and the highest proportion of photoheterotrophs was found in peat-bog lakes with a pH between 6.7 and 7.6. Our results demonstrated an influence of water acidity on the abundance of AAPs, which may reflect a fundamental difference in the microbial composition between acidic and pH neutral peat-bog lakes. PMID:27032635

  5. Changes in Phosphorylation of Connexin43 in Rats during Acute Myocardial Hypoxia and Effects of Antiarrhythmic Peptide on the Phosphorylation

    WANG Rong; ZHANG Cuntai; RUAN Yanfei; LIU Nian; WANG Lin

    2007-01-01

    In order to confirm the hypothesis that during acute hypoxia, the antiarrhythmic peptide (AAP10) could improve conductance by changing the phosphorylation state of connexin43 (Cx43),isolated perfused rat hearts were randomly divided into three groups: control, hypoxia and AAP10 (n=9 in each group). The change in Cx43 phosphorylation was tested by Western-blot; the distribution of Cx43 was observed by confocal immunofluorescence microscopy. Western-blot analysis revealed that the expression of total Cx43 protein was significantly decreased during acute hypoxia,while nonphosphorylated Cx43 (NP-Cx43) was unchanged. AAP10 could increase the expression of total Cx43 protein, but had no effects on the NP-Cx43 protein. Immunofluorescence study showed that during acute hypoxia, both total Cx43 and NP-Cx43 proteins were greatly decreased, while AAP10 only increased the expression of total Cx43 protein, but had no effect of the NP-Cx43 protein expression. These findings suggested that the decrease of intercellular communication may be associated with the reduction of phosphorylated Cx43 (p-Cx43) and translocation of NP-Cx43 from the surface of gap junction into intracellular pools during acute hypoxia. AAP10 can improve intercelluar communication by enhancing phosphorylation of Cx43.

  6. Atypical antipsychotics in the treatment of early-onset schizophrenia

    Hrdlicka M

    2015-04-01

    Full Text Available Michal Hrdlicka, Iva Dudova Department of Child Psychiatry, Charles University Second Faculty of Medicine and University Hospital Motol, Prague, Czech Republic Abstract: Atypical antipsychotics (AAPs have been successfully used in early-onset schizophrenia (EOS. This review summarizes the randomized, double-blind, controlled studies of AAPs in EOS, including clozapine, risperidone, olanzapine, aripiprazole, paliperidone, quetiapine, and ziprasidone. No significant differences in efficacy between AAPs were found, with the exception of clozapine and ziprasidone. Clozapine demonstrated superior efficacy in treatment-resistant patients with EOS, whereas ziprasidone failed to demonstrate efficacy in the treatment of EOS. Our review also focuses on the onset of action and weight gain associated with AAPs. The data on onset of action of AAPs in pediatric psychiatry are scanty and inconsistent. Olanzapine appears to cause the most significant weight gain in patients with EOS, while ziprasidone and aripiprazole seem to cause the least. Keywords: early-onset schizophrenia, atypical antipsychotics, efficacy, onset of action, weight gain

  7. Effects of switching to aripiprazole from current atypical antipsychotics on subsyndromal symptoms and tolerability in patients with bipolar disorder.

    Woo, Young Sup; Bahk, Won-Myong; Park, Young-Min; Chung, Sangkeun; Yoon, Bo-Hyun; Won, Seunghee; Lee, Jeong Goo; Lee, Hwang-Bin; Kim, Won; Jeong, Jong-Hyun; Lee, Kwanghun; Kim, Moon-Doo

    2016-09-01

    We evaluated the effectiveness of aripiprazole among bipolar patients who had switched to this medication as a result of difficulty maintaining on their prestudy atypical antipsychotics (AAPs) because of subsyndromal mood symptoms or intolerance. This study included 77 bipolar patients who were in syndromal remission with an AAP as monotherapy or with an AAP combined with a mood stabilizer(s) who needed to switch from their present AAP because of subsyndromal symptoms or intolerance. At 24 weeks after switching to aripiprazole, the remission rates on the Montgomery-Åsberg Depression Rating Scale (MADRS) and on both the MADRS and the Young Mania Rating Scale were increased significantly in the full sample and in the inefficacy subgroup. In the inefficacy subgroup, the MADRS score change was significant during the 24 weeks of study. Total cholesterol and prolactin decreased significantly after switching to aripiprazole. The proportion of patients who had abnormal values for central obesity and hypercholesterolemia decreased significantly from baseline to week 24. These findings suggest that a change from the current AAP to aripiprazole was associated with improvement in subsyndromal mood symptoms and several lipid/metabolic or safety profile parameters in patients with bipolar disorder with tolerability concerns or subsyndromal mood symptoms. PMID:27487259

  8. Growth and characterization of ammonium acid phthalate single crystals

    Arunkumar, A.; Ramasamy, P.

    2013-04-01

    Ammonium acid phthalate (AAP) has been synthesized and single crystals were grown by slow evaporation solution growth technique. The unit cell parameters were confirmed by single crystal X-ray diffraction analysis and it belongs to orthorhombic system with the space group of Pcab. The high resolution X-ray diffraction studies revealed the crystalline perfection of the grown crystal. The various functional groups of AAP were identified by FT-IR and Raman spectral analyses. Thermal stability of the grown crystals was studied by TGA/DTA. The optical properties of the grown crystals were analyzed by UV-Vis-NIR and photoluminescence spectral studies. The mechanical property of the grown crystal was studied by Vickers microhardness measurement. The growth features of AAP were analyzed by chemical etching.

  9. Fabrication of multiwalled carbon nanotube-surfactant modified sensor for the direct determination of toxic drug 4-aminoantipyrine☆

    Jayant I. Gowda; Arunkumar T. Buddanavar; Sharanappa T. Nandibewoor

    2015-01-01

    A multi-walled carbon nanotube (MWCNT)-cetyltrimethylammonium bromide (CTAB) surfactant composite modified glassy carbon electrode (GCE) was developed as a novel system for the determination of 4-aminoantipyrine(AAP). The oxidation process was irreversible over the pH range studied and exhibited a diffusion controlled behavior. All experimental parameters were optimized. The combination of MWCNT-CTAB endows the biosensor with large surface area, good biological compatibility, electricity and stability, high selectivity and sensitivity. MWCNT-CTAB /GCE electrode gave a linear response for AAP from 5.0 × 10-9 to 4.0 × 10-8 M with a detection limit of 1.63 × 10-10 M. The modified electrode showed good selectivity against interfering species and also exhibited good reproducibility. The present electrochemical sensor based on the MWCNT-CTAB/GCE electrode was applied to the determination of AAP in real samples.

  10. Lawrence Berkeley Laboratory Affirmative Action Program. Revised

    NONE

    1995-06-01

    The Lawrence Berkeley Laboratory`s Affirmative Action Program (AAP) serves as a working document that describes current policies, practices, and results in the area of affirmative action. It represents the Laboratory`s framework for an affirmative approach to increasing the representation of people of color and women in segments of our work force where they have been underrepresented and taking action to increase the employment of persons with disabilities and special disabled and Vietnam era veterans. The AAP describes the hierarchy of responsibility for Laboratory affirmative action, the mechanisms that exist for full Laboratory participation in the AAP, the policies and procedures governing recruitment at all levels, the Laboratory`s plan for monitoring, reporting, and evaluating affirmative action progress, and a description of special affirmative action programs and plans the Laboratory has used and will use in its efforts to increase the representation and retention of groups historically underrepresented in our work force.

  11. Solar energy applications at Army ammunition plants

    Lowry, A. P.; Moy, S. M.

    1982-06-01

    The Army Ammunition Plants use significant quantities of fossil fuels. To reduce dependence on these scarce, costly, and non-renewable fuels, a study was conducted to investigate potential solar energy applications at the AAPs. Solar energy is a low-level energy source which is best applied to low temperature applications. It can be used at the AAPs to preheat boiler feedwater, provide hot air for dry-houses, provide domestic hot water and heat for administration buildings, and provide hot water for manufacturing processes such as metal cleaning, phosphating, and X-ray film processing. Use of the flat plate collectors, evacuated tube collectors, or solar ponds with the possible addition of a heat pump, offers reasonably economical means of applying solar technology to AAP needs.

  12. Growth and nutritional status of children from dysfunctional families with alcohol addicted parents in Poland.

    Hanć, Tomasz; Czapla, Zbigniew; Szwed, Anita; Durda, Magdalena; Krotowska, Aleksandra; Cieślik, Joachim

    2015-07-01

    The study was aimed at assessment of impact of parents' alcohol addiction on growth and prevalence of underweight and overweight in their children. Two groups of subjects were compared: 80 children of alcohol addicted parents (ChAAP) aged from 7 to 14 years and reference group (RG) of 1000 children selected in terms of age and place of residence. Differences in z scores for height and Body Mass Index (BMI), prevalence of underweight and overweight were assessed. Families of ChAAP were characterized by: lower parents' education, higher unemployment rate, a greater number of children than in RG. The differences between ChAAP and RG in z scores for height (z scores: -0.54 vs. 0.45, t = -7.01, p bad living conditions, e.g.: chronic post-natal stress, or adverse events during fetal development. PMID:26042531

  13. Pro-oxidant status and matrix metalloproteinases in apical lesions and gingival crevicular fluid as potential biomarkers for asymptomatic apical periodontitis and endodontic treatment response

    Dezerega Andrea

    2012-03-01

    Full Text Available Abstract Background Oxidative stress and matrix metalloproteinases -9 and -2 are involved in periodontal breakdown, whereas gingival crevicular fluid has been reported to reflect apical status. The aim of this study was to characterize oxidant balance and activity levels of MMP -2 and -9 in apical lesions and healthy periodontal ligament; and second, to determine whether potential changes in oxidant balance were reflected in gingival crevicular fluid from asymptomatic apical periodontitis (AAP-affected teeth at baseline and after endodontic treatment. Methods Patients with clinical diagnosis of AAP and healthy volunteers having indication of tooth extraction were recruited. Apical lesions and healthy periodontal ligaments, respectively, were homogenized or processed to obtain histological tissue sections. Matrix metalloproteinase -9 and -2 levels and/or activity were analyzed by Immunowestern blot, zymography and consecutive densitometric analysis, and their tissue localization was confirmed by immunohistochemistry. A second group of patients with AAP and indication of endodontic treatment was recruited. Gingival crevicular fluid was extracted from AAP-affected teeth at baseline, after endodontic treatment and healthy contralateral teeth. Total oxidant and antioxidant status were determined in homogenized tissue and GCF samples. Statistical analysis was performed using STATA v10 software with unpaired t test, Mann-Whitney test and Spearman's correlation. Results Activity of MMP-2 and MMP-9 along with oxidant status were higher in apical lesions (p Conclusions Apical lesions display an oxidant imbalance along with increased activity of matrix metalloproteinase-2 and -9 and might contribute to AAP progression. Oxidant imbalance can also be reflected in GCF from AAP-affected teeth and was restored to normal levels after conservative endodontic treatment. These mediators might be useful as potential biomarkers for chair-side complementary diagnostic

  14. Structural, thermal, morphological and biological studies of proton-transfer complexes formed from 4-aminoantipyrine with quinol and picric acid

    Adam, Abdel Majid A.

    2013-03-01

    4-Aminoantipyrine (4AAP) is widely used in the pharmaceutical industry, biochemical experiments and environmental monitoring. However, residual amounts of 4AAP in the environment may pose a threat to human health. To provide basic data that can be used to extract or eliminate 4AAP from the environment, the proton-transfer complexes of 4AAP with quinol (QL) and picric acid (PA) were synthesized and spectroscopically investigated. The interactions afforded two new proton-transfer salts named 1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-aminium-4-hydroxyphenolate and 1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-aminium-2,4,6-trinitrophenolate for QL and PA, respectively, via a 1:1 stoichiometry. Elemental analysis (CHN), electronic absorption, spectrophotometric titration, IR, Raman, 1H NMR and X-ray diffraction were used to characterize the new products. The thermal stability of the synthesized CT complexes was investigated using thermogravimetric (TG) analyses, and the morphology and particle size of these complexes were obtained from scanning electron microscopy (SEM). It was found that PA and 4AAP immediately formed a yellow precipitate with a remarkable sponge-like morphology and good thermal stability up to 180 °C. Finally, the biological activities of the newly synthesized CT complexes were tested for their antibacterial and antifungal activities. The results indicated that the [(4AAP)(QL)] complex exhibited strong antimicrobial activities against various bacterial and fungal strains compared with standard drugs.

  15. Active appearance pyramids for object parametrisation and fitting.

    Zhang, Qiang; Bhalerao, Abhir; Dickenson, Edward; Hutchinson, Charles

    2016-08-01

    Object class representation is one of the key problems in various medical image analysis tasks. We propose a part-based parametric appearance model we refer to as an Active Appearance Pyramid (AAP). The parts are delineated by multi-scale Local Feature Pyramids (LFPs) for superior spatial specificity and distinctiveness. An AAP models the variability within a population with local translations of multi-scale parts and linear appearance variations of the assembly of the parts. It can fit and represent new instances by adjusting the shape and appearance parameters. The fitting process uses a two-step iterative strategy: local landmark searching followed by shape regularisation. We present a simultaneous local feature searching and appearance fitting algorithm based on the weighted Lucas and Kanade method. A shape regulariser is derived to calculate the maximum likelihood shape with respect to the prior and multiple landmark candidates from multi-scale LFPs, with a compact closed-form solution. We apply the 2D AAP on the modelling of variability in patients with lumbar spinal stenosis (LSS) and validate its performance on 200 studies consisting of routine axial and sagittal MRI scans. Intervertebral sagittal and parasagittal cross-sections are typically used for the diagnosis of LSS, we therefore build three AAPs on L3/4, L4/5 and L5/S1 axial cross-sections and three on parasagittal slices. Experiments show significant improvement in convergence range, robustness to local minima and segmentation precision compared with Constrained Local Models (CLMs), Active Shape Models (ASMs) and Active Appearance Models (AAMs), as well as superior performance in appearance reconstruction compared with AAMs. We also validate the performance on 3D CT volumes of hip joints from 38 studies. Compared to AAMs, AAPs achieve a higher segmentation and reconstruction precision. Moreover, AAPs have a significant improvement in efficiency, consuming about half the memory and less than 10% of

  16. Fluorescence excitation spectrum and solvent-assisted conformational isomerization (SACI) of jet-cooled acetaminophen

    Sohn, Woon Yong; Kang, Jeong Seok; Lee, So Young; Kang, Hyuk

    2013-08-01

    Fluorescence excitation spectrum of jet-cooled acetaminophen was obtained. When AAP was expanded with a buffer gas containing 0.3-1.1% of water, absorption peaks of the less stable trans conformer was significantly reduced by solvent-assisted conformational isomerization (SACI), which is confirmed by a separately measured UV-UV hole burning spectroscopy. It is also confirmed by quantum mechanical calculation and RRKM calculation that it is energetically and kinetically possible to induce SACI in AAP with water. The SACI mechanism suggests a possible pathway that acetaminophen can adopt an active conformation in vivo, which is need for molecular recognition and drug activity.

  17. Precipitation estimation in mountainous terrain using multivariate geostatistics. Part II: isohyetal maps

    Hevesi, Joseph A.; Flint, Alan L.; Istok, Jonathan D.

    1992-01-01

    Values of average annual precipitation (AAP) may be important for hydrologic characterization of a potential high-level nuclear-waste repository site at Yucca Mountain, Nevada. Reliable measurements of AAP are sparse in the vicinity of Yucca Mountain, and estimates of AAP were needed for an isohyetal mapping over a 2600-square-mile watershed containing Yucca Mountain. Estimates were obtained with a multivariate geostatistical model developed using AAP and elevation data from a network of 42 precipitation stations in southern Nevada and southeastern California. An additional 1531 elevations were obtained to improve estimation accuracy. Isohyets representing estimates obtained using univariate geostatistics (kriging) defined a smooth and continuous surface. Isohyets representing estimates obtained using multivariate geostatistics (cokriging) defined an irregular surface that more accurately represented expected local orographic influences on AAP. Cokriging results included a maximum estimate within the study area of 335 mm at an elevation of 7400 ft, an average estimate of 157 mm for the study area, and an average estimate of 172 mm at eight locations in the vicinity of the potential repository site. Kriging estimates tended to be lower in comparison because the increased AAP expected for remote mountainous topography was not adequately represented by the available sample. Regression results between cokriging estimates and elevation were similar to regression results between measured AAP and elevation. The position of the cokriging 250-mm isohyet relative to the boundaries of pinyon pine and juniper woodlands provided indirect evidence of improved estimation accuracy because the cokriging result agreed well with investigations by others concerning the relationship between elevation, vegetation, and climate in the Great Basin. Calculated estimation variances were also mapped and compared to evaluate improvements in estimation accuracy. Cokriging estimation variances

  18. Advanced Avionics and Processor Systems for Space and Lunar Exploration

    Keys, Andrew S.; Adams, James H.; Ray, Robert E.; Johnson, Michael A.; Cressler, John D.

    2009-01-01

    NASA's newly named Advanced Avionics and Processor Systems (AAPS) project, formerly known as the Radiation Hardened Electronics for Space Environments (RHESE) project, endeavors to mature and develop the avionic and processor technologies required to fulfill NASA's goals for future space and lunar exploration. Over the past year, multiple advancements have been made within each of the individual AAPS technology development tasks that will facilitate the success of the Constellation program elements. This paper provides a brief review of the project's recent technology advancements, discusses their application to Constellation projects, and addresses the project's plans for the coming year.

  19. Efficiency and patient experience with propofol vsconventional sedation: A prospective study

    2016-01-01

    AIM To determine whether anaesthesiologistadministeredsedation with propofol (AAP) or endoscopist-administered conscious sedation (EAC) withfentanyl/midazolam shortens colonoscopy duration/totalroom time.METHODS: This is a prospective, non-randomized,comparative study that enrolled patients greater than18 years of age undergoing colonoscopy in a singleCanadian academic outpatient endoscopy unit over athree-month consecutive period. Colonoscopies in thisunit are performed both with AAP and EAC. Patientdemographics, procedure-related data and adverseevents were documented. Additionally, the level ofprocedure difficulty, and whether a staff endoscopist,trainee with assistance, or independent trainee, performedthe procedure were documented. A validatedmodified 4-question, 5-point Likert scale telephonesurvey was used to assess patient satisfaction withcolonoscopy. The telephone patient satisfaction surveywas conducted 24-72 h following the procedure.RESULTS: Two hundred and thirty patients were enrolled during the study period with 126 patients inthe AAP group and 104 patients in the EAC group.Mean procedure time was 18.3 ± 10.1 min in theAAP group and 14.7 ± 7.1 min in the EAC group (P =0.002). Mean total room time was 36.8 ± 13.7 with AAPand 30.1 ± 11 min with EAC (p 〈 0.001). Multivariateanalysis revealed the use of AAP (P = 0.002), residentparticipation (p 〈 0.001), diagnostic interventions (p= 0.033), therapeutic interventions (p 〈 0.001), lowerbody mass index (p = 0.008) and American Society ofAnaesthesiologist class (p = 0.016), to be predictorsof longer total room time. Patient age and genderwere not significant predictors. After excluding cases inwhich trainees were involved, there was no significantdifference in procedure time between the two groups (p= 0.941), however total room time was still prolongedin the AAP group (p = 0.019). The amount of painexperienced was lower with AAP (p = 0.02

  20. Well-Child-Care - A Check-Up for Success

    ... a Pediatrician Family Life Medical Home Health Insurance Pediatric Specialists Family Dynamics Media Work & Play Getting Involved in Your Community Healthy Children > Family Life > Medical Home > AAP Schedule of Well-Child Care Visits Family Life Listen Español Text Size Email ...

  1. When to Call Your Pediatrician

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... to Call Your Pediatrician Page Content Article Body Is it OK to call my child's pediatrician even if I'm not sure my ...

  2. Simultaneous Detection of Phenols and Anilines in Oilfield Waste Water

    Yuan Cunguang; Feng Chengwu

    1996-01-01

    @@ Phenols and aromatic anilines are monitored in many countries , because both of them pollute environment seriously. The methods of 4-AAP(4-Aminoantipyrine)photometric detection of volatile phenols and naphthalene -ethyl-diamine-azo photometric detection of anilines are recommended by the National Environmental Protection Bureau, China (NEPBC).

  3. Zirconyl acetaminophen phosphate: A nanoscaled analgetic with very high drug load.

    Heck, Joachim G; Feldmann, Claus

    2016-11-01

    Drug release belongs to the most challenging aspects of nanoparticles addressing molecular biology and medicine. Besides targeted delivery, obvious challenges are related to high drug load and continuous slow drug release. Based on our recently developed concept of inorganic-organic hybrid nanoparticles (IOH-NP), we here present [ZrO](2+)[AAP](2-) IOH-NPs containing the analgetic phosphate prodrug acetaminophen phosphate for drug release. [ZrO](2+)[AAP](2-) combines an uncomplex synthesis in water with a high prodrug load of 68wt.%. [ZrO](2+)[AAP](2-) nanoparticles exhibit a diameter of 37(11)nm and can be readily obtained as colloidally highly stable suspension in water. The chemical composition is studied in detail based on infrared spectroscopy, energy-dispersive X-ray analysis, thermogravimetry and elemental analysis. Moreover, the release of acetaminophen from [ZrO](2+)[AAP](2-) is studied by means of model experiments indicating the carbon content of the nanoparticles and, in alternative, the fluorescence of labeled nanoparticles. Both data show a continuous release of 80wt.% of the analgetic acetaminophen on a time scale up to 48h. PMID:27451036

  4. NCBI nr-aa BLAST: CBRC-MDOM-04-0142 [SEVENS

    Full Text Available CBRC-MDOM-04-0142 ref|YP_073290.1| NADH dehydrogenase subunit 5 [Pachypsylla venust...a] gb|AAP14655.1| NADH dehydrogenase subunit 5 [Pachypsylla venusta] YP_073290.1 0.039 25% ...

  5. Establishing a Book Publishing Curriculum.

    Ciofalo, Andrew

    Addressing the need to prepare college graduates for careers in book publishing, this report examines the necessity and structure of a book publishing curriculum at the undergraduate level at Loyola College in Maryland. A 1977 bulletin by the American Association of Publishers (AAP) cited a lack of awareness of publishing as a possible career, and…

  6. Korsten : tellimata tellised = Chimney : an outside job / Andres Aule

    Aule, Andres

    2012-01-01

    Aap Kaur Suvi kavandatud Tallinna linnainstallatsioonide festivali "LIFT11" installatsioonist "Korsten", mis pidi seisnema Tauno Kangro skulptuuri "Lõbus korstnapühkija" ümber ajutise telliskorstna ehitamises. Lift11 jättis selle installatsiooni ära, kuid ootamatult sai "Korsten" kodanikualgatusena 8. IX 2011 teoks

  7. Gene : CBRC-DYAK-06-0016 [SEVENS

    Full Text Available CBRC-DYAK-06-0016 Novel X A UNKNOWN TRFR_MOUSE 9e-14 35% pir||JC7978 proctolin receptor (CG6986) ... - fruit fly ... (Drosophila melanogaster) gb|AAP50844.1| peptide r ... LIAVVLMFIVCQLPWAIYLIVNQYMEIQVGTQVVAGNVCNLLASLHAASNFFLY CVLSDKYRKTVRELITGYRYRRRHARNNTSLYVPHTTTTLTQINGDHYGSN ...

  8. Gene : CBRC-DSIM-08-0021 [SEVENS

    Full Text Available CBRC-DSIM-08-0021 Novel UN A UNKNOWN OPRM_PANTR 8e-08 26% pir||JC7978 proctolin receptor (CG6986 ... ) - fruit fly ... (Drosophila melanogaster) gb|AAP50844.1| peptide r ... LIAVVLMFIVCQLPWAIYLIVNQYMEIQVGTQVVAGNVCNLLASLHAASNFFLY CVLSDKYRKTVRELITGYRYRRRHARNNTSLYVPHTTTTLTQINGDHYGSN ...

  9. Mechanisms of intramolecular communication in a hyperthermophilic acylaminoacyl peptidase

    Papaleo, Elena; Renzetti, Giulia; Tiberti, Matteo

    2012-01-01

    Protein dynamics and the underlying networks of intramolecular interactions and communicating residues within the three-dimensional (3D) structure are known to influence protein function and stability, as well as to modulate conformational changes and allostery. Acylaminoacyl peptidase (AAP) subf...

  10. Protein assay for heme oxygenase-1 (HO-1) induced by chemicals in HepG2 cells.

    Miyamoto, Yohei; Ohshida, Keiyu; Sasago, Kaori

    2009-12-01

    Levels of heme oxygenase-1 (HO-1), a stress response protein, were measured to examine oxidative stress induced by several chemicals in HepG2 cells with and without S9mix using an ELISA. CdCl(2), heme, and diclofenac sodium salt (diclofenac) were used as inducers of HO-1. Acetaminophen (AAP) and cyclophosphamide (CP) were used as oxidative stress inducers. Stannic mesoporphyrin (SnMP) was used as an inhibitor of HO activity. Cytotoxicity was determined, and HO-1 levels were measured in HepG2 cells exposed to chemicals other than CP with non-metabolic activation without S9mix, and to diclofenac, AAP and CP with metabolic activation with S9mix. HO-1 levels were increased by CdCl(2) (7.5 microM), heme (10, 100 microM), and stannic mesoporphyrin (SnMP) (10 microM), but were not changed by AAP, and were decreased by diclofenac. HO-1 levels were increased by diclofenac (300 microM), and CP (36 microM), but were unaffected by AAP because of low sensitivity in HepG2 cells. The induction of HO-1 expression was first observed in cultured HepG2 cells treated with CP under conditions involving metabolic activation. These results showed the measurement of HO-1 protein levels in this system is useful when assessing oxidative stress as a tool for detecting drug toxicity. PMID:19952508

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-2484 [SEVENS

    Full Text Available CBRC-DNOV-01-2484 ref|YP_006355.1| ATP synthase F0 subunit 6 [Siphonodentalium loba...tum] gb|AAP91676.1| ATP synthase F0 subunit 6 [Siphonodentalium lobatum] YP_006355.1 5e-04 29% ...

  12. Gay and Lesbian Parents

    ... may benefit from meeting other children who have gay or lesbian parents. You might find a local group of families, or your children might be interested in joining an e-mail list or finding a pen pal. Civil marriage. The AAP supports civil marriage for all parents. ...

  13. Vacuum mechatronic laser alignment system on the Nova laser

    The experiments conducted on NOVA are done to investigate inertially confined laser fusion reactions. To this end, the ten beams of the laser are aligned to within 30mm. The target chamber employs a vacuum mechatronic based reticle/target positioning system to accomplish this. It is a five degree-of-freedom chamber resident system, known as the Alignment Aids Positioner or AAP. The AAP aids in beam and diagnostic alignment by accurately positioning a reticle at target chamber center to with 7mm. The AAP system increases target positioning and alignment flexibility and accuracy through the use of a computer controlled multi degree-of-freedom stage assembly. This device uses microstepping DC stepper motors with encoders to achieve closed loop control in a 10-6 torr vacuum. The AAP has two positioning regimes to move the alignment reticle and do beam alignment. One is course positioning in the Y-Z plane that moves a high resolution stage assembly to target chamber center. The other regime is high resolution movement in the X,Y,Z and q directions. 5 refs., 9 figs

  14. 40 CFR Appendix A to Part 419 - Processes Included in the Determination of BAT Effluent Limitations for Total Chromium...

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Processes Included in the Determination of BAT Effluent Limitations for Total Chromium, Hexavalent Chromium, and Phenolic Compounds (4AAP) A...—Processes Included in the Determination of BAT Effluent Limitations for Total Chromium, Hexavalent...

  15. NCBI nr-aa BLAST: CBRC-TSYR-01-1170 [SEVENS

    Full Text Available CBRC-TSYR-01-1170 ref|NP_898745.1| putative cadmium resistance protein (CadA) [Rhod...ococcus erythropolis] gb|AAP74015.1| putative cadmium resistance protein (CadA) [Rhodococcus erythropolis] NP_898745.1 0.14 29% ...

  16. Study of the behaviour of various phenolic compounds in the 4-aminoantipyrine and ultraviolet-ratio spectrophotometric methods without and with distillation.

    Farino, J; Norwitz, G; Boyko, W J; Keliher, P N

    1981-09-01

    It is customary in industrial analysis in the determination of phenols by the 4-aminoantipyrine (4-AAP) and ultraviolet-ratio spectrophotometric methods to report the total of phenolic compounds as phenol. A study was therefore made of the behaviour of 36 representative phenolic compounds in the 4-AAP and UV-ratio methods, with and without distillation, to ascertain the apparent recoveries relative to that for phenol. The Fisher phenol analyser was used for the UV-ratio method, which depends upon the bathochromic shift (from about 270 to about 290 nm) usually obtained when the solution of the phenol is made alkaline. The apparent recoveries by the 4-AAP method both with and without distillation varied from 0 to 100%. The apparent recoveries by the UV-ratio method without distillation varied from 0 to 148%, and those with distillation varied from 0 to 110%. Sixteen of the compounds tested without distillation gave less than 10% recovery by the 4-AAP method and eleven gave less than 10% recovery by the UV-ratio method. The results after distillation indicated that several of the compounds did not distil completely. PMID:18962987

  17. Influence of the surface structure on the filtration performance of UV-modified PES membranes

    Kæselev, Bozena Alicja; Kingshott, P.; Jonsson, Gunnar Eigil

    2002-01-01

    Poly (ether sulfone) (PES) 50 kDa membranes were surface modified by irradiation with UV light (254 nm) in the presence of N-vinyl-2-pyrrolidine (NVP), 2-acrylamidoglycolic acid monohydrate (AAG) and 2-acrylamido-2-methyl-1-propanesulfonic acid (AAP). The surfaces of the modified membranes were c...

  18. Photoheterotrophic Microbes in the Arctic Ocean in Summer and Winter▿

    Cottrell, Matthew T.; Kirchman, David L.

    2009-01-01

    Photoheterotrophic microbes, which are capable of utilizing dissolved organic materials and harvesting light energy, include coccoid cyanobacteria (Synechococcus and Prochlorococcus), aerobic anoxygenic phototrophic (AAP) bacteria, and proteorhodopsin (PR)-containing bacteria. Our knowledge of photoheterotrophic microbes is largely incomplete, especially for high-latitude waters such as the Arctic Ocean, where photoheterotrophs may have special ecological relationships and distinct biogeochem...

  19. Unigene BLAST: CBRC-PMAR-01-0433 [SEVENS

    Full Text Available CBRC-PMAR-01-0433 gnl|UG|Pma#S35051446 PMAD-aap78e15.b1 Lamprey_WGS_pCMV-sport6 Petromyzon marin ... 1193 creatine kinase (EC 2.7.3.2) - African clawed frog ... (fragment), mRNA sequence /clone_end=3' /gb=DW0204 ...

  20. Unigene BLAST: CBRC-PMAR-01-0107 [SEVENS

    Full Text Available CBRC-PMAR-01-0107 gnl|UG|Pma#S35051349 PMAD-aap76d05.b1 Lamprey_WGS_pCMV-sport6 Petromyzon marin ... e protein precursor (clone X0286) - African clawed frog , mRNA sequence /clone_end=3' /gb=DW020364 /gi=8366 ...

  1. Enhancing School Asthma Action Plans: Qualitative Results from Southeast Minnesota Beacon Stakeholder Groups

    Egginton, Jason S.; Textor, Lauren; Knoebel, Erin; McWilliams, Deborah; Aleman, Marty; Yawn, Barbara

    2013-01-01

    Background: This study explores ways southeast Minnesota schools currently address asthma problems, identifies areas for improvement, and assesses the potential value of asthma action plans (AAPs) in schools. Methods: Focus groups were used to query stakeholder groups on asthma care in schools. Groups were held separately for elementary school…

  2. Recent evidence and potential mechanisms underlying weight gain and insulin resistance due to atypical antipsychotics

    Ana Maria Volpato

    2013-09-01

    Full Text Available Objective: Atypical antipsychotics (AAPs promote obesity and insulin resistance. In this regard, the main objective of this study was to present potential mechanisms and evidence concerning side effects of atypical antipsychotics in humans and rodents. Method: A systematic review of the literature was performed using the MEDLINE database. We checked the references of selected articles, review articles, and books on the subject. Results: This review provides consistent results concerning the side effects of olanzapine (OL and clozapine (CLZ, whereas we found conflicting results related to other AAPs. Most studies involving humans describe the effects on body weight, adiposity, lipid profile, and blood glucose levels. However, it seems difficult to identify an animal model replicating the wide range of changes observed in humans. Animal lineage, route of administration, dose, and duration of treatment should be carefully chosen for the replication of the findings in humans. Conclusions: Patients undergoing treatment with AAPs are at higher risk of developing adverse metabolic changes. This increased risk must be taken into account when making decisions about treatment. The influence of AAPs on multiple systems is certainly the cause of such effects. Specifically, muscarinic and histaminergic pathways seem to play important roles.

  3. A Novel Approach to Critical Congenital Heart Disease (CCHD Screening at Moderate Altitude

    Erin Lueth

    2016-07-01

    Full Text Available The American Academy of Pediatrics (AAP has endorsed Critical Congenital Heart Disease (CCHD screening using pulse oximetry nationwide, but, however, acknowledges that altitude may impact failure rates and alternative algorithms may be required at high altitudes. We therefore evaluated a modified screening protocol at an altitude of 6200 feet with the hypothesis that modifications could decrease failure rates. We evaluated 2001 well, newborn infants ≥35 weeks gestation using a modified protocol, which included a lower saturation cutoff for the first screen (85% instead of the AAP recommended 90% and an oxygen hood intervention between the first two screens. Using our modified screening algorithm, we found a 0.3% failure rate, which was similar to the 0.2% sea-level rate and statistically different from the 1.1% rate identified in a recent study at similar altitude. Had the AAP protocol been used, the failure rate would have increased to 0.8%, which is similar to prior reports near this altitude. Echocardiograms were performed on failing newborns with no CCHD identified. A Birth Defects Registry Database review demonstrated one newborn with CCHD was missed after meeting AAP passing criteria. Overall, this study demonstrates that an alternative algorithm can be implemented at moderate altitude with decreased failure rate and comparable false negative rate.

  4. Rundum artist-run space and its elusive form / Hanna Laura Kaljo, Mari-Leen Kiipli, Kulla Laas ... [jt.

    2015-01-01

    Rundum on 2013. a septembris Tallinnas loodud liikuv loominguline platvorm, mille eesmärgiks on suhestuda erinevate kohtadega, reageerida tühikutele Eesti loomemaastikus ning uurida sealjuures ka omaalgatuslike praktikate võimalikkust kohalikus kontekstis. Vestlusringis Rundumi algatajad Mari-Leen Kiipli, Kulla Laas, Aap Tepper, Mari Volens, Kristina Õllek

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0132 [SEVENS

    Full Text Available CBRC-MLUC-01-0132 gb|AAP36253.1| Homo sapiens MAP /microtubule affinity-regulating kinase 2 [synt ... hetic construct] gb|AAX29163.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ... c construct] gb|AAX29164.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0105 [SEVENS

    Full Text Available CBRC-MLUC-01-0105 gb|AAP36253.1| Homo sapiens MAP /microtubule affinity-regulating kinase 2 [synt ... hetic construct] gb|AAX29163.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ... c construct] gb|AAX29164.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0105 [SEVENS

    Full Text Available CBRC-MLUC-01-0105 gb|AAP36006.1| MAP /microtubule affinity-regulating kinase 2 [Homo sapiens] gb| ... AAX32569.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ... c construct] gb|AAX32570.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0358 [SEVENS

    Full Text Available CBRC-MLUC-01-0358 gb|AAP36006.1| MAP /microtubule affinity-regulating kinase 2 [Homo sapiens] gb| ... AAX32569.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ... c construct] gb|AAX32570.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ...

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-0358 [SEVENS

    Full Text Available CBRC-MLUC-01-0358 gb|AAP36253.1| Homo sapiens MAP /microtubule affinity-regulating kinase 2 [synt ... hetic construct] gb|AAX29163.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ... c construct] gb|AAX29164.1| MAP /microtubule affinity-regulating kinase 2 [syntheti ...

  10. Eesti paviljon "Koda" = Estonian pavilion "Koda"

    2015-01-01

    Eesti paviljon "Koda" Hollandi maailmanäitusel "Floriade". Arhitektuurivõistlus 2011. Arhitektid Joel Kopli, Koit Ojaliiv (Kuu Arhitektid), konstruktorid Alar Hammer, Marek Suursalu (Projekt 363). Lauad Kristel Jakobson (Haka Disain), toolid Aap Piho (Maast Furniture), valgustid Margus Triibmann (Keha3)

  11. Toddler Growth and Development

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a ... Body Your child is advancing from infancy toward and into the preschool years. During this time, his or her physical growth and motor development will slow, but you can expect to see ...

  12. Bemisia tabaci (Homoptera: Aleyrodidae) and Indian cassava mosaic virus transmission

    Bemisia tabaci (Gennadius) adults from colonies reared on cassava or sweet potato plants were studied to determine their ability to transmit Indian cassava mosaic virus (ICMV) (Geminiviridae: Begomovirus) from cassava to cassava. Virus acquisition access (feeding) periods (AAP) of 48 h on ICMV-infec...

  13. Phosphorus forms and bioavailability of lake sediments in the middle and lower reaches of Yangtze River

    ZHU; Guangwei; QIN; Boqiang; ZHANG; Lu

    2006-01-01

    Forms of phosphorus in sediments from 25 lakes in the middle and lower reaches of Yangtze River were analyzed by the sequential extraction procedure. Contents and spatial distrubution of algal available phosphorus (AAP) in sediments of Lake Taihu, the third largest freshwater lake of China, were also studied. Relationships between phosphorus forms in sediment and macrophytes coverage in sample sites, as well as phosphorus forms in sediments and chlorophyal contents in lake water were discussed. Exchangeable form of phosphorus (Ex-P) in surface sediments was significantly positive correlative to total phosphorus (TP), dissolved total phosphorus (DTP) and soluble reactive phosphorus (SRP) contents in the lake water. Bioavailable phosphorus (Bio-P) contents in sediments from macrophytes dominant sites were significantly lower than that in no macrophyte sites. In Lake Taihu, Ex-P content in top 3 cm sediment was highest.However, content of ferric fraction phosphorus (Fe-P) was highest in 4-10 cm. Bioavalilble phosphorus (Bio-P) contents in surface sediments positively correlated to Chlorophyll a contents in water of Lake Taihu with significant difference. Therefore, contents of Bio-P and AAP could be acted as the indicators of risks of internal release of phosphorus in the shallow lakes. It was estimated that there were 268.6 ton AAP in top 1 cm sediments in Lake Taihu. Sediment suspension caused by strong wind-induced wave disturbance could carry plenty of AAP into water in large shallow lakes like Lake Taihu.

  14. NCBI nr-aa BLAST: CBRC-TGUT-17-0007 [SEVENS

    Full Text Available CBRC-TGUT-17-0007 ref|NP_846391.1| cytochrome c oxidase, subunit I [Bacillus anthracis str. Ames ... ome c oxidase, subunit i [Bacillus anthracis str. 'Ames ... Ancestor'] gb|AAP27877.1| cytochrome c oxidase, su ... bunit I [Bacillus anthracis str. Ames ] gb|AAT33275.1| cytochrome c oxidase, subunit I [B ...

  15. NCBI nr-aa BLAST: CBRC-CREM-01-1294 [SEVENS

    Full Text Available CBRC-CREM-01-1294 ref|NP_847439.1| major facilitator family transporter [Bacillus anthracis str. ... Ames ] ref|YP_021916.2| major facilitator family transpo ... rter [Bacillus anthracis str. 'Ames ... Ancestor'] gb|AAP28925.1| major facilitator family ...

  16. NCBI nr-aa BLAST: CBRC-DYAK-04-0025 [SEVENS

    Full Text Available CBRC-DYAK-04-0025 ref|NP_834435.1| Spore germination protein IA [Bacillus cereus AT...CC 14579] gb|AAP11636.1| Spore germination protein IA [Bacillus cereus ATCC 14579] NP_834435.1 0.044 23% ...

  17. Gene : CBRC-CINT-01-0007 [SEVENS

    Full Text Available CBRC-CINT-01-0007 Novel UN A UNKNOWN SSR2_HUMAN 9e-33 29% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  18. Gene : CBRC-CINT-01-0071 [SEVENS

    Full Text Available CBRC-CINT-01-0071 Novel UN A UNKNOWN SSR5_MOUSE 2e-31 30% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  19. 75 FR 16188 - Work Reserved for Performance by Federal Government Employees

    2010-03-31

    ... 92-1. 57 FR 45096 (September 30, 1992). Most public commenters expressed general satisfaction with....gov/comp/aap/documents/Chapter6.pdf . The Panel concluded, among other things, that `` here is a need... governmental functions and criteria for identifying critical functions. See 74 FR 25775 (May 29, 2009) for...

  20. EST Table: BP124138 [KAIKOcDNA[Archive

    Full Text Available BP124138 epV31947 10/09/28 100 %/171 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx m ... 43 %/179 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  1. EST Table: BP123228 [KAIKOcDNA[Archive

    Full Text Available BP123228 epV30814 10/09/28 84 %/191 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx ma ... 37 %/199 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  2. EST Table: BP123162 [KAIKOcDNA[Archive

    Full Text Available BP123162 epV30654 10/09/28 99 %/215 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx ma ... 43 %/188 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  3. EST Table: BB983523 [KAIKOcDNA[Archive

    Full Text Available BB983523 ovS3021F10r 10/09/28 100 %/181 aa gb|ACN86367.1| troponin T transcript variant B [Bomby ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  4. EST Table: BP123798 [KAIKOcDNA[Archive

    Full Text Available BP123798 epV31491 10/09/28 81 %/238 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx ma ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  5. EST Table: BB983162 [KAIKOcDNA[Archive

    Full Text Available BB983162 ovS3016G07r 10/09/28 100 %/185 aa gb|ACN86367.1| troponin T transcript variant B [Bomby ... 43 %/188 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  6. EST Table: BB983418 [KAIKOcDNA[Archive

    Full Text Available BB983418 ovS3020D10r 10/09/28 87 %/217 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  7. EST Table: BB982235 [KAIKOcDNA[Archive

    Full Text Available BB982235 ovS3003H01r 10/09/28 100 %/166 aa gb|ACN86367.1| troponin T transcript variant B [Bomby ... 48 %/152 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  8. EST Table: BP122714 [KAIKOcDNA[Archive

    Full Text Available BP122714 epV30144 10/09/28 100 %/158 aa gb|ACN86367.1| troponin T transcript variant B [Bombyx m ... 42 %/166 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  9. EST Table: FS866570 [KAIKOcDNA[Archive

    Full Text Available FS866570 E_FL_fner_31I04_R_0 10/09/28 100 %/218 aa gb|ACN86367.1| troponin T transcript variant ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  10. EST Table: NM_001046756 [KAIKOcDNA[Archive

    Full Text Available NM_001046756 LOC692913 10/09/29 86 %/309 aa ref|NP_001040221.1| troponin T [Bombyx mori] gb|ABD3 ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  11. 75 FR 33321 - Federal Property Suitable as Facilities To Assist the Homeless

    2010-06-11

    ...: Underutilized Reasons: Secured Area Tennessee Bldgs. ZZ001, ZZ002 Milan AAP Milan TN 38358 Landholding Agency...: Secured Area District of Columbia Bldg. 51 Fort McNair Washington, DC Landholding Agency: Army Property Number: 21201020005 Status: Unutilized Reasons: Secured Area and Extensive deterioration Georgia...

  12. 75 FR 70941 - Federal Property Suitable as Facilities To Assist the Homeless

    2010-11-19

    ..., 7006, 7051, 7202, 7814, 8064, MM001 Reasons: Secured Area 4 Bldgs. Milan AAP Gibson TN 38358...: Unutilized Directions: 100, 338, 343, 385, 411, 412, 413, 486, 489, 490, 491, 493, 5006 Reasons: Secured Area...: 21201040004 Status: Unutilized Reasons: Secured Area Hawaii Bldg. 1000 Wheeler Army Airfield Wahiawa HI...

  13. 78 FR 71635 - Federal Property Suitable as Facilities To Assist the Homeless

    2013-11-29

    ...: Secured Area Tennessee 4 Buildings Milan AAP Milan TN 38358 Landholding Agency: Army Property Number.... ft.; storage; lead paint; dropping; secured area; contact Agriculture for more info. Imperial Dam....; stored targets; 66+ yrs.-old; extensive exterior/interior wood damage; asbestos/lead; secured...

  14. NCBI nr-aa BLAST: CBRC-DNOV-01-1344 [SEVENS

    Full Text Available CBRC-DNOV-01-1344 ref|YP_223898.1| putative tape measure protein [Lactobacillus pha...ge phiJL-1] gb|AAP74525.1| putative tape measure protein [Lactobacillus plantarum bacteriophage phiJL-1] YP_223898.1 0.015 22% ...

  15. Using Digital Materials in Online Courses: A Cautionary Tale of Georgia State University

    Talab, Rosemary

    2008-01-01

    On April 15, 2008, a lawsuit was filed against Georgia State University by Cambridge University Press, Oxford University Press, and Sage, supported by the American University Presses (AAP). The complaint asserted ""pervasive, flagrant, and ongoing" unauthorized distribution of copyrighted materials...through its electronic course reserves service,…

  16. Diversity of cultivated and metabolically active aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    C. Jeanthon

    2011-05-01

    Full Text Available Aerobic anoxygenic phototrophic (AAP bacteria play significant roles in the bacterioplankton productivity and biogeochemical cycles of the surface ocean. In this study, we applied both cultivation and mRNA-based molecular methods to explore the diversity of AAP bacteria along an oligotrophic gradient in the Mediterranean Sea in early summer 2008. Colony-forming units obtained on three different agar media were screened for the production of bacteriochlorophyll-a (BChl-a, the light-harvesting pigment of AAP bacteria. BChl-a-containing colonies represented a low part of the cultivable fraction. In total, 52 AAP strains were isolated and the phylogenetic analyses based on their 16S rRNA and pufM genes showed that they were all affiliated to the Alphaproteobacteria. The most frequently isolated strains belonged to Citromicrobium bathyomarinum, and Erythrobacter and Roseovarius species. Most other isolates were related to species not reported to produce BChl-a and/or may represent novel taxa. Direct extraction of RNA from seawater samples enabled the analysis of the expression of pufM, the gene coding for the M subunit of the reaction centre complex of aerobic anoxygenic photosynthesis. Clone libraries of pufM gene transcripts revealed that most phylotypes were highly similar to sequences previously recovered from the Mediterranean Sea and a large majority (~94% was affiliated with the Gammaproteobacteria. The most abundantly detected phylotypes occurred in the western and eastern Mediterranean basins. However, some were exclusively detected in the eastern basin, reflecting the highest diversity of pufM transcripts observed in this ultra-oligotrophic region. To our knowledge, this is the first study to document extensively the diversity of AAP isolates and to unveil the active AAP community in an oligotrophic marine environment. By pointing out the

  17. Diversity of cultivated and metabolically active aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    C. Jeanthon

    2011-07-01

    Full Text Available Aerobic anoxygenic phototrophic (AAP bacteria play significant roles in the bacterioplankton productivity and biogeochemical cycles of the surface ocean. In this study, we applied both cultivation and mRNA-based molecular methods to explore the diversity of AAP bacteria along an oligotrophic gradient in the Mediterranean Sea in early summer 2008. Colony-forming units obtained on three different agar media were screened for the production of bacteriochlorophyll-a (BChl-a, the light-harvesting pigment of AAP bacteria. BChl-a-containing colonies represented a low part of the cultivable fraction. In total, 54 AAP strains were isolated and the phylogenetic analyses based on their 16S rRNA and pufM genes showed that they were all affiliated to the Alphaproteobacteria. The most frequently isolated strains belonged to Citromicrobium bathyomarinum, and Erythrobacter and Roseovarius species. Most other isolates were related to species not reported to produce BChl-a and/or may represent novel taxa. Direct extraction of RNA from seawater samples enabled the analysis of the expression of pufM, the gene coding for the M subunit of the reaction centre complex of aerobic anoxygenic photosynthesis. Clone libraries of pufM gene transcripts revealed that most phylotypes were highly similar to sequences previously recovered from the Mediterranean Sea and a large majority (~94 % was affiliated to the Gammaproteobacteria. The most abundantly detected phylotypes occurred in the western and eastern Mediterranean basins. However, some were exclusively detected in the eastern basin, reflecting the highest diversity of pufM transcripts observed in this ultra-oligotrophic region. To our knowledge, this is the first study to document extensively the diversity of AAP isolates and to unveil the active AAP community in an oligotrophic marine environment. By pointing out the discrepancies

  18. Pathophysiological role of the acute inflammatory response during acetaminophen hepatotoxicity

    Neutrophils are recruited into the liver after acetaminophen (AAP) overdose but the pathophysiological relevance of this acute inflammatory response remains unclear. To address this question, we compared the time course of liver injury, hepatic neutrophil accumulation and inflammatory gene mRNA expression for up to 24 h after treatment with 300 mg/kg AAP in C3Heb/FeJ and C57BL/6 mice. Although there was no relevant difference in liver injury (assessed by the increase of plasma alanine aminotransferase activities and the areas of necrosis), the number of neutrophils and the expression of several pro-inflammatory genes (e.g., tumor necrosis factor-α, interleukin-1β and macrophage inflammatory protein-2) was higher in C3Heb/FeJ than in C57BL/6 mice. In contrast, the expression of the anti-inflammatory genes interleukin-10 and heme oxygenase-1 was higher in C57BL/6 mice. Despite substantial hepatic neutrophil accumulation, none of the liver sections from both strains stained positive for hypochlorite-modified proteins, a specific marker for a neutrophil-induced oxidant stress. In addition, treatment with the NADPH oxidase inhibitors diphenyleneiodonium chloride or apocynin or the anti-neutrophil antibody Gr-1 did not protect against AAP hepatotoxicity. Furthermore, although intercellular adhesion molecule-1 (ICAM-1) was previously shown to be important for neutrophil extravasation and tissue injury in several models, ICAM-1-deficient mice were not protected against AAP-mediated liver injury. Together, these data do not support the hypothesis that neutrophils aggravate liver injury induced by AAP overdose

  19. Premature adrenarche: etiology, clinical findings, and consequences.

    Voutilainen, Raimo; Jääskeläinen, Jarmo

    2015-01-01

    Adrenarche means the morphological and functional change of the adrenal cortex leading to increasing production of adrenal androgen precursors (AAPs) in mid childhood, typically at around 5-8 years of age in humans. The AAPs dehydroepiandrosterone (DHEA) and its sulfate conjugate (DHEAS) are the best serum markers of adrenal androgen (AA) secretion and adrenarche. Normal ACTH secretion and action are needed for adrenarche, but additional inherent and exogenous factors regulate AA secretion. Inter-individual variation in the timing of adrenarche and serum concentrations of DHEA(S) in adolescence and adulthood are remarkable. Premature adrenarche (PA) is defined as the appearance of clinical signs of androgen action (pubic/axillary hair, adult type body odor, oily skin or hair, comedones, acne, accelerated statural growth) before the age of 8 years in girls or 9 years in boys associated with AAP concentrations high for the prepubertal chronological age. To accept the diagnosis of PA, central puberty, adrenocortical and gonadal sex hormone secreting tumors, congenital adrenal hyperplasia, and exogenous source of androgens need to be excluded. The individually variable peripheral conversion of circulating AAPs to biologically more active androgens (testosterone, dihydrotestosterone) and the androgen receptor activity in the target tissues are as important as the circulating AAP concentrations as determinants of androgen action. PA has gained much attention during the last decades, as it has been associated with small birth size, the metabolic and polycystic ovarian syndrome (PCOS), and thus with an increased risk for type 2 diabetes and cardiovascular diseases in later life. The aim of this review is to describe the known hormonal changes and their possible regulators in on-time and premature adrenarche, and the clinical features and possible later health problems associating with PA. PMID:24923732

  20. Diverse arrangement of photosynthetic gene clusters in aerobic anoxygenic phototrophic bacteria.

    Qiang Zheng

    Full Text Available BACKGROUND: Aerobic anoxygenic photototrophic (AAP bacteria represent an important group of marine microorganisms inhabiting the euphotic zone of the ocean. They harvest light using bacteriochlorophyll (BChl a and are thought to be important players in carbon cycling in the ocean. METHODOLOGY/PRINCIPAL FINDINGS: Aerobic anoxygenic phototrophic (AAP bacteria represent an important part of marine microbial communities. Their photosynthetic apparatus is encoded by a number of genes organized in a so-called photosynthetic gene cluster (PGC. In this study, the organization of PGCs was analyzed in ten AAP species belonging to the orders Rhodobacterales, Sphingomonadales and the NOR5/OM60 clade. Sphingomonadales contained comparatively smaller PGCs with an approximately size of 39 kb whereas the average size of PGCs in Rhodobacterales and NOR5/OM60 clade was about 45 kb. The distribution of four arrangements, based on the permutation and combination of the two conserved regions bchFNBHLM-LhaA-puhABC and crtF-bchCXYZ, does not correspond to the phylogenetic affiliation of individual AAP bacterial species. While PGCs of all analyzed species contained the same set of genes for bacteriochlorophyll synthesis and assembly of photosynthetic centers, they differed largely in the carotenoid biosynthetic genes. Spheroidenone, spirilloxanthin, and zeaxanthin biosynthetic pathways were found in each clade respectively. All of the carotenoid biosynthetic genes were found in the PGCs of Rhodobacterales, however Sphingomonadales and NOR5/OM60 strains contained some of the carotenoid biosynthetic pathway genes outside of the PGC. CONCLUSIONS/SIGNIFICANCE: Our investigations shed light on the evolution and functional implications in PGCs of marine aerobic anoxygenic phototrophs, and support the notion that AAP are a heterogenous physiological group phylogenetically scattered among Proteobacteria.

  1. The Effect of Secretory Factors of Adipose-Derived Stem Cells on Human Keratinocytes

    Soo-Wan Nam

    2012-01-01

    Full Text Available The beneficial effects of adipose-derived stem cell conditioned medium (ADSC-CM on skin regeneration have been reported. Although the mechanism of how ADSC-CM promotes skin regeneration is unclear, ADSC-CM contained various growth factors and it is an excellent raw material for skin treatment. ADSC-CM produced in a hypoxia condition of ADSC—in other words, Advanced Adipose-Derived Stem cell Protein Extract (AAPE—has great merits for skin regeneration. In this study, human primary keratinocytes (HKs, which play fundamental roles in skin tissue, was used to examine how AAPE affects HK. HK proliferation was significantly higher in the experimental group (1.22 μg/mL than in the control group. DNA gene chip demonstrated that AAPE in keratinocytes (p < 0.05 notably affected expression of 290 identified transcripts, which were associated with cell proliferation, cycle and migration. More keratinocyte wound healing and migration was shown in the experimental group (1.22 μg/mL. AAPE treatment significantly stimulated stress fiber formation, which was linked to the RhoA-ROCK pathway. We identified 48 protein spots in 2-D gel analysis and selected proteins were divided into 64% collagen components and 30% non-collagen components as shown by the MALDI-TOF analysis. Antibody array results contained growth factor/cytokine such as HGF, FGF-1, G-CSF, GM-CSF, IL-6, VEGF, and TGF-β3 differing from that shown by 2-D analysis. Conclusion: AAPE activates HK proliferation and migration. These results highlight the potential of the topical application of AAPE in the treatment of skin regeneration.

  2. Metabolic Disturbances Independent of Body Mass in Patients with Schizophrenia Taking Atypical Antipsychotics

    Lee, Jong Il

    2015-01-01

    Objective Atypical antipsychotic (AAP) treatment is associated with weight gain and metabolic disturbances such as dyslipidemia and dysglycemia. The metabolic disturbances are usually considered to develop secondary to weight gain. We performed the comparison of metabolic disturbances of three AAP group with different risk of metabolic side effect after adjusting for body mass to investigate whether any metabolic disturbances develop independently from body mass index (BMI). Methods This cross-sectional study included 174 subjects with schizophrenia who were on 1) monotherapy with clozapine (CL), olanzapine (OL), or quetiapine (QT) (n=61), 2) monotherapy with risperidone (RSP) (n=89), or 3) monotherapy with aripiprizole (ARP), or ziprasidone (ZPS) (n=24) more than 1 year. Association between the prevalence of metabolic disturbances and groups were analysed using logistic regression after adjusting confounding variables including BMI. Analysese of covariance were used to compare the AAP groups in terms of the levels of metabolic parameters. Results There were significant differences among groups in terms of the prevalence of hypertriglyceridemia (p=0.015), low HDL-cholesterol (p=0.017), and hyperglycemia (p=0.022) after adjusting for BMI. Triglyceride level (p=0.014) and the ratio of triglyceride to HDL-cholesterol (p=0.004) were significantly different among groups after adjusting for BMI. Conclusion In conclusion, metabolic disturbances are significantly different in AAP groups even after adjusting BMI. AAPs may have direct effect on metabolic parameters. Blood lipid and glucose levels should be monitored regularly regardless of whether patients tend to gain weight. PMID:25866526

  3. Secondhand smoke in combination with ambient air pollution exposure is associated with increasedx CpG methylation and decreased expression of IFN-γ in T effector cells and Foxp3 in T regulatory cells in children

    Kohli Arunima

    2012-09-01

    Full Text Available Abstract Background Secondhand smoke (SHS and ambient air pollution (AAP exposures have been associated with increased prevalence and severity of asthma and DNA modifications of immune cells. In the current study, we examined the association between SHS and AAP with DNA methylation and expression of interferon-gamma (IFN-γ and forkhead box protein 3 (Foxp3 in T cell populations. Methods Subjects 7–18 years old were recruited from Fresno (high AAP; n = 62 and Stanford, CA (low AAP; n = 40 and divided into SHS-exposed (Fresno: n = 31, Stanford: n = 6 and non-SHS-exposed (nSHS; Fresno: n = 31, Stanford: n = 34 groups. T cells purified from peripheral blood were assessed for levels of DNA methylation and expression of IFN-γ (in effector T cells or Foxp3 (in regulatory T cells. Results Analysis showed a significant increase in mean % CpG methylation of IFN-γ and Foxp3 associated with SHS exposure (IFN-γ: FSHS 62.10%, FnSHS 41.29%, p p Foxp3: FSHS 74.60%, FnSHS 54.44%, p p IFN-γ: FSHS 0.75, FnSHS 1.52, p p Foxp3: FSHS 0.75, FnSHS 3.29, p p IFN-γ: FSHS vs. SSHS, p p Foxp3: FSHS vs. SSHS, p p IFN-γ: FSHS vs. SSHS, p p Foxp3: FSHS vs. SSHS, p p IFN-γ: p = 0.15; Foxp3: p = 0.27, nor was Foxp3 expression (p = 0.08; IFN-γ expression was significantly decreased in AAP-only subjects (p  Conclusions Exposures to SHS and AAP are associated with significant hypermethylation and decreased expression of IFN-γ in Teffs and Foxp3 in Tregs. Relative contributions of each exposure to DNA modification and asthma pathogenesis warrant further investigation.

  4. Au@Ag/Au nanoparticles assembled with activatable aptamer probes as smart ``nano-doctors'' for image-guided cancer thermotherapy

    Shi, Hui; Ye, Xiaosheng; He, Xiaoxiao; Wang, Kemin; Cui, Wensi; He, Dinggeng; Li, Duo; Jia, Xuekun

    2014-07-01

    Although nanomaterial-based theranostics have increased positive expectations from cancer treatment, it remains challenging to develop in vivo ``nano-doctors'' that provide high-contrast image-guided site-specific therapy. Here we designed an activatable theranostic nanoprobe (ATNP) via self-assembly of activatable aptamer probes (AAPs) on Au@Ag/Au nanoparticles (NPs). As both quenchers and heaters, novel Au@Ag/Au NPs were prepared, showing excellent fluorescence quenching and more effective near-infrared photothermal therapy than Au nanorods. The AAP comprised a thiolated aptamer and a fluorophore-labeled complementary DNA; thus, the ATNP with quenched fluorescence in the free state could realize signal activation through target binding-induced conformational change of the AAP, and then achieve on-demand treatment under image-guided irradiation. By using S6 aptamer as the model, in vitro and in vivo studies of A549 lung cancer verified that the ATNP greatly improved imaging contrast and specific destruction, suggesting a robust and versatile theranostic strategy for personalized medicine in future.Although nanomaterial-based theranostics have increased positive expectations from cancer treatment, it remains challenging to develop in vivo ``nano-doctors'' that provide high-contrast image-guided site-specific therapy. Here we designed an activatable theranostic nanoprobe (ATNP) via self-assembly of activatable aptamer probes (AAPs) on Au@Ag/Au nanoparticles (NPs). As both quenchers and heaters, novel Au@Ag/Au NPs were prepared, showing excellent fluorescence quenching and more effective near-infrared photothermal therapy than Au nanorods. The AAP comprised a thiolated aptamer and a fluorophore-labeled complementary DNA; thus, the ATNP with quenched fluorescence in the free state could realize signal activation through target binding-induced conformational change of the AAP, and then achieve on-demand treatment under image-guided irradiation. By using S6 aptamer as

  5. Surveying Turkish high school and university student attitudes and approaches to physics problem solving

    Balta, Nuri; Singh, Chandralekha

    2016-01-01

    Student attitudes and approaches to problem solving can impact how well they learn physics. Prior research in the US using a validated Attitude and Approaches to Problem Solving (AAPS) survey suggests that there are major differences between students in introductory physics and astronomy courses and physics experts in terms of their attitudes and approaches to physics problem solving. Here we discuss the validation, administration and analysis of data for the Turkish version of the AAPS survey for high school and university students in Turkey. After the validation and administration of the Turkish version of the survey, the analysis of the data was conducted by grouping the data by grade level, school type, and gender. While there are no statistically significant differences between the averages of various groups on the survey, overall, the university students in Turkey were more expert-like than vocational high school students. On an item by item basis, there are statistically differences between the average...

  6. Surveying college introductory physics students' attitudes and approaches to problem solving

    Mason, Andrew

    2016-01-01

    Students' attitudes and approaches to problem solving in physics can greatly impact their actual problem solving practices and also influence their motivation to learn and ultimately the development of expertise. We developed and validated an attitudes and approaches to problem solving (AAPS) survey and administered it to students in the introductory physics courses in a typical large research university in the US. Here, we discuss the development and validation of the survey and analysis of the student responses to the survey questions in introductory physics courses. The introductory physics students' responses to the survey questions were also compared with those of physics faculty members and physics PhD students. We find that introductory students are in general less expert-like than the physics faculty members and PhD students. Moreover, on some AAPS survey questions, the responses of students and faculty have unexpected trends. Those trends were interpreted via in

  7. Cadmium-induced oxidative stress in potato tuber

    Andrzej Stroiński

    2014-02-01

    Full Text Available Short-term treatment of tuber discs of potato (Solanum tuberosum L. with cadmium chloride elevated the concentration of active oxygen species (.O-2, H202 and activated the antioxidative system. Two cultivars, Bintje and Bzura, susceptible and tolerant, respectively, to cadmium were examined. In more tolerant, control tissues the activity of ascorbic acid peroxidase (AAP and catalase (CAT was higher than in the sensitive ones. During first hours of stress, the inhibition of superoxide dismutase (SOD, CAT and AAP was observed and it comes from inactivation of enzymes by cadmium ions. A subsequent activity increase of the enzymes aroused earlier in tolerant tissues. It seems therefore, that tolerant tissues possess a more efficient antioxidative system.

  8. Anorexia and Attachment: Dysregulated Defense and Pathological Mourning

    elisa edelvecchio

    2014-10-01

    Full Text Available The role of Defensive exclusion (Deactivation and Segregated Systems in the development of early relationships and related to subsequent manifestations of symptoms of eating disorders was assessed using the Adult Attachment Projective Picture System (AAP. Fifty-one DSM-IV diagnosed women with anorexia participated in the study. Anorexic patients were primarily classified as dismissing or unresolved. Quantitative and qualitative analyses of defensive exclusion were carried out. Results showed potential benefits of using the AAP defense exclusion coding system, in addition to the main attachment classifications, in order to better understand the developmental issues involved in anorexia. Discussion concerned the processes, such as pathological mourning, that may underlie the associations between dismissing and unresolved attachment and anorexia. Implications for developmental research and clinical nosology are discussed.

  9. Adverse Effects and Toxicity of the Atypical Antipsychotics: What is Important for the Pediatric Emergency Medicine Practitioner

    Rasimas, J.J.; Liebelt, Erica L.

    2012-01-01

    Medications are being used with greater frequency to address pediatric mental health problems, and in recent years atypical antipsychotic (AAP) prescriptions have increased more than any other class. Acute care practitioners must be aware of the pharmacology of AAPs and the conditions, on- and off-label, for which they are prescribed. This involves identifying and managing side effects that manifest both mentally and physically. Although “atypicality” confers a lower risk of movement side effects compared to conventional agents, children are more sensitive than adults to extrapyramidal reactions. Like adults, they also may present with toxic sedation, confusion, cardiovascular dysfunction, and metabolic derangements. Evaluation and management of these toxicities requires an index of suspicion, a careful symptom and medication history, physical examination, and targeted interventions. This review is designed to orient the emergency practitioner to the challenging task of recognizing and treating adverse effects related to acute and chronic atypical antipsychotic exposure in children. PMID:23471213

  10. Asymmetric dimethylarginine in somatically healthy schizophrenia patients treated with atypical antipsychotics

    Jørgensen, Anders; Knorr, Ulla Benedichte Søsted; Soendergaard, Mia Greisen;

    2015-01-01

    BACKGROUND: Schizophrenia is associated with increased cardiovascular morbidity and mortality. Asymmetric dimethylarginine (ADMA), an endogenous inhibitor of the nitric oxide synthase, and the L-arginine:ADMA ratio are markers of endothelial dysfunction that predict mortality and adverse outcome in...... a range of cardiovascular disorders. Increased ADMA levels may also lead to increased oxidative stress. We hypothesized that ADMA and the L-arginine:ADMA ratio are increased in somatically healthy schizophrenia patients treated with atypical antipsychotics (AAP), and that the ADMA and the L......-arginine: ADMA ratio are positively correlated to measures of oxidative stress. METHODS: We included 40 schizophrenia patients treated with AAP, but without somatic disease or drug abuse, and 40 healthy controls. Plasma concentrations of ADMA and L-arginine were determined by high-performance liquid...

  11. From porous gold nanocups to porous nanospheres and solid particles - A new synthetic approach

    Ihsan, Ayesha

    2015-05-01

    We report a versatile approach for the synthesis of porous gold nanocups, porous gold nanospheres and solid gold nanoparticles. Gold nanocups are formed by the slow reduction of gold salt (HAuCl4{dot operator}3H2O) using aminoantipyrene (AAP) as a reducing agent. Adding polyvinylpyrrolidone (PVP) to the gold salt followed by reduction with AAP resulted in the formation of porous gold nanospheres. Microwave irradiation of both of these porous gold particles resulted in the formation of slightly smaller but solid gold particles. All these nanoparticles are thoroughly characterized by UV-visible spectroscopy, scanning electron microscopy (SEM), high resolution transmission electron microscopy (HR-TEM) and bright-field tomography. Due to the larger size, porous nature, low density and higher surface area, these nanomaterials may have interesting applications in catalysis, drug delivery, phototherapy and sensing.

  12. Quantitative Enzymatic and Immunologic Histophotometry of Diseased Human Kid-Ney Tissues Using Tv-Camera and Computer Assisted Image Processing Systems.

    Heinert, G.; Mondorf, W.

    1982-11-01

    High speed image processing was used to analyse morphologic and metabolic characteristics of clinically relevant kidney tissue alterations.Qualitative computer-assisted histophotometry was performed to measure alterations in levels of the enzymes alkaline phosphatase (Ap),alanine aminopeptidase (AAP),g-glutamyltranspepti-dase (GGTP) and A-glucuronidase (B-G1) and AAP and GGTP immunologically determined in prepared renal and cancer tissue sections. A "Mioro-Videomat 2" image analysis system with a "Tessovar" macroscope,a computer-assisted "Axiomat" photomicroscope and an "Interactive Image Analysis System (IBAS)" were employed for analysing changes in enzyme activities determined by changes in absorbance or transmission.Diseased kidney as well as renal neoplastic tissues could be distinguished by significantly (wilcoxon test,phuman kidney tissues.This image analysis techniques might be of potential use in diagnostic and prognostic evaluation of renal cancer and diseased kidney tissues.

  13. The myADHDportal.com Improvement Program: An innovative quality improvement intervention for improving the quality of ADHD care among community-based pediatricians

    Epstein, Jeffery N.; Langberg, Joshua M.; Lichtenstein, Philip K.; Kolb, Rebecca; Simon, John O

    2013-01-01

    Though the American Academy of Pediatrics has developed and disseminated clear evidence-based guidelines for ADHD care, community-based pediatricians often have difficulty implementing these guidelines. New strategies are needed to improve the quality of care received by children with ADHD and to improve utilization of the AAP consensus guidelines by pediatricians. An evidence-based quality improvement intervention has been developed that effectively improves the quality of ADHD care delivere...

  14. Enteroaggregative Escherichia coli O78:H10, the cause of an outbreak of urinary tract infection

    Olesen, Bente; Scheutz, Flemming; Andersen, Rebecca L; Menard, Megan; Boisen, Nadia; Johnston, Brian; Hansen, Dennis S; Krogfelt, Karen; Nataro, James P; Johnson, James R

    2012-01-01

    by molecular methods as enteroaggregative E. coli (EAEC) (P <0.001). Genes present in >90% of outbreak isolates included fimH (type 1 fimbriae; ubiquitous in E. coli); fyuA, traT, and iutA (associated with extraintestinal pathogenic E. coli [ExPEC]); and sat, pic, aatA, aggR, aggA, ORF61, aaiC, aap...

  15. AcEST: DK962271 [AcEST

    Full Text Available TST39A01NGRL0013_G17 641 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_G17. 5' end seq ... 810 Query: 460 VVPTGGIPQPKEKLSPLGTIAAAPWGSALILPISYSYI CMMGSQGLTDASKLAILNANYM 639 V+PTGGIP+P E+ SPLGTI+AAP ... WGSALILPISY+YI ... MMGS GLTDASK+AILNANYM Sbjct: 811 VIPTGGIPEP-EQTSPL ... GTISAAPWGSALILPISYTYI AMMGSGGLTDASKIAILNANYM 869 Score = 38.1 bits (87), ... 822 Query: 460 VVPTGGIPQPKEKLSPLGTIAAAPWGSALILPISYSYI CMMGSQGLTDASKLAILNANYM 639 VVPTGGIP P E PLG+I+AAPWG ...

  16. AcEST: DK958768 [AcEST

    Full Text Available TST39A01NGRL0002_O02 684 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_O02. 5' end seq ... IGVKKHLAPFLPSHPVVPTGGIPQPKEKLSPLGTIAAAPWGSALILPISYSYI CMMGSQG 181 IGVK+HLAPFLPSHPV+PTGGIP+P E+ SPLGTI+AAP ... WGSALILPISY+YI ... MMGS G Sbjct: 796 IGVKQHLAPFLPSHPVIPTGGIPEP-EQTSPL ... GTISAAPWGSALILPISYTYI AMMGSGG 854 Query: 182 LTDASKLAILNANYMAKRLENHYPVLFR ... IGVKKHLAPFLPSHPVVPTGGIPQPKEKLSPLGTIAAAPWGSALILPISYSYI CMMGSQG 181 IGVKKHLAP+LPSHPVVPTGGIP P +K PLG I+AAPW ...

  17. Chapter Oral Health Advocates: A Nationwide Model for Pediatrician Peer Education and Advocacy about Oral Health

    Lewis, Charlotte W.; Lauren Barone; Rocio B. Quinonez; Suzanne Boulter; Mouradian, Wendy E.

    2013-01-01

    Objective. (1) To describe an innovative program training US pediatricians to be Chapter Oral Health Advocates (COHAs). (2) To provide insight into COHAs’ experiences disseminating oral health knowledge to fellow pediatricians. Patients and Methods. Interviews with 40 COHAs who responded to an email request, from a total of 64 (62% response). Transcripts were analyzed for common themes about COHA activities, facilitators, and barriers. Results. COHAs reported positive experiences at the AAP ...

  18. The cauliflower mosaic virus (CaMV) 35S promoter sequence alters the level and patterns of activity of adjacent tissue- and organ-specific gene promoters.

    Zheng, Xuelian; Deng, Wei; Luo, Keming; Duan, Hui; Chen, Yongqin; McAvoy, Richard; Song, Shuiqing; Pei, Yan; Li, Yi

    2007-08-01

    Here we report the effect of the 35S promoter sequence on activities of the tissue- and organ-specific gene promoters in tobacco plants. In the absence of the 35S promoter sequence the AAP2 promoter is active only in vascular tissues as indicated by expression of the AAP2:GUS gene. With the 35S promoter sequence in the same T-plasmid, transgenic plants exhibit twofold to fivefold increase in AAP2 promoter activity and the promoter becomes active in all tissue types. Transgenic plants hosting the ovary-specific AGL5:iaaM gene (iaaM coding an auxin biosynthetic gene) showed a wild-type phenotype except production of seedless fruits, whereas plants hosting the AGL5:iaaM gene along with the 35S promoter sequence showed drastic morphological alterations. RT-PCR analysis confirms that the phenotype was caused by activation of the AGL5:iaaM gene in non-ovary organs including roots, stems and flowers. When the pollen-, ovule- and early embryo-specific PAB5:barnase gene (barnase coding a RNase gene) was transformed, the presence of 35S promoter sequence drastically reduced transformation efficiencies. However, the transformation efficiencies were restored in the absence of 35S promoter, indicating that the 35S promoter might activate the expression of PAB5:barnase in non-reproductive organs such as calli and shoot primordia. Furthermore, if the 35S promoter sequence was replaced with the NOS promoter sequence, no alteration in AAP2, AGL5 or PAB5 promoter activities was observed. Our results demonstrate that the 35S promoter sequence can convert an adjacent tissue- and organ-specific gene promoter into a globally active promoter. PMID:17340093

  19. Modeling the Potential Impact of the 2014 American Academy of Pediatrics Respiratory Syncytial Virus Prophylaxis Guidance on Preterm Infant RSV Outcomes

    McLaurin, Kimmie K.; Chatterjee, Archana; Makari, Doris

    2015-01-01

    Introduction The American Academy of Pediatrics (AAP) Committee on Infectious Diseases issued updated guidance on respiratory syncytial virus (RSV) prophylaxis in 2014. This report models the potential impact of the new guidance on RSV outcomes in preterm infants 29–34 weeks’ gestational age (wGA) without chronic lung disease in the United States. Methods The number of preterm infants was estimated using 2012 natality data. Palivizumab utilization prior to the 2014 guidance update was estimat...

  20. Distribution of free-living and particle-attached aerobic anoxygenic phototrophic bacteria in marine environments

    Lami, R.; Čuperová, Zuzana; Ras, J.; Lebaron, P.; Koblížek, Michal

    2009-01-01

    Roč. 55, č. 1 (2009), s. 31-38. ISSN 0948-3055 R&D Projects: GA ČR GA206/07/0241; GA AV ČR 1QS500200570 Institutional research plan: CEZ:AV0Z50200510 Keywords : AAP bacteria * photoheterotrophy * free-living bacteria Subject RIV: EE - Microbiology, Virology Impact factor: 1.743, year: 2009

  1. Esiplaanil heli / Harri Slip

    Slip, Harri

    2015-01-01

    Kõrvaklapid hinnaga alla 200 €: AKG Y50BT, Audio-Technica, Beyerdynamic Custom Street, Bose SoundTrue around-ear II, Creative Aurvana Gold, Denon AH-MM200, Focal Spirit One S, Grado SR 80e, JBL Everest V300, Klipsch Reference On Ear, Panasonic RP-HD10, Philips SHB8850NC, Sennheiser HD 25, SMS Audio On-Ear Wired Sport, Sony MDR-100AAP

  2. Use of cough and cold preparations during breastfeeding.

    Mitchell, J L

    1999-12-01

    Adverse reactions in infants from maternal drug ingestion depend largely on the amount of milk consumed by the infant, timing of breastfeeding in relation to dosing, dose of the medication, dosing interval, and duration of therapy. When taking medications, breastfeeding mothers should be instructed to take their medication after breastfeeding, at the lowest effective dose and for the shortest duration. Overall, there are few data from human studies on the use of antihistamines, decongestants, and cough products during breastfeeding. Studies of pseudoephedrine, triprolidine, and loratadine in humans conclude that low levels of each drug would reach a breastfed infant. Since triprolidine and pseudoephedrine are also considered compatible with breastfeeding by the AAP, these 2 drugs should be the first-line choices. Codeine is considered compatible with breastfeeding by the AAP, and would be an acceptable choice for short-term use as a cough suppressant. It is important to note that many of the liquid cough and cold products contain alcohol. In addition, many of the combination products are a mixture of an antihistamine and a decongestant and may also contain aspirin, acetaminophen, ibuprofen, or caffeine. It is preferable for nursing mothers to only take medications that are necessary and to avoid such combination products. The AAP considers alcohol, acetaminophen, ibuprofen, and caffeine compatible with breastfeeding. Aspirin has been associated with significant negative effects on some nursing infants, and the AAP recommends giving aspirin to nursing mothers with caution. Mothers taking cough and cold products should watch for adverse events in their breastfed infants. Infants may experience paradoxical central nervous stimulation from antihistamines and irritability and insomnia from decongestants. PMID:10776186

  3. NCBI nr-aa BLAST: CBRC-FRUB-02-0117 [SEVENS

    Full Text Available CBRC-FRUB-02-0117 ref|NP_001075589.1| blood-brain barrier large neutral amino acid ...mall subunit 1 (L-type amino acid transporter 1) (4F2 light chain) (4F2 LC) (4F2LC) (LAT1 light chain) gb|AAP47189.1| blood-brain bar...rier large neutral amino acid transporter light chain [Oryctolagus cuniculus] NP_001075589.1 7e-70 61% ...

  4. Investigation of Antioxidant and Antimicrobial Potential of Chloroform and Petroleum Ether Extracts of Selected Medicinal Plants of Bangladesh

    Zulfiker, A. H. M.; P P Roy; Momin, M. A. M.; Khan, M.S.; Bulbul, I. J.; T. Ahmed; Rana, M. S.

    2013-01-01

    Aim: To investigate the antioxidant and antimicrobial potential of Chloroform and Pet ether extracts of Manilkara zapota (MZCE, MZPE), Polyalthia longifolia (PLCE, PLPE), Abroma augusta (AACE, AAPE) Ficus hispida (FHCE, FHPE), Vitex negundo (VNCE, VNPE) plants. Study Design: In vitro antioxidant and antimicrobial study. Place and Duration of Study: Department of Pharmacy, School of Science & Engineering, Southeast University, Banani, Dhaka between June 2011 and March 2012. Methodology: In...

  5. Aortic Arch Atherosclerosis in Ischaemic Stroke of Unknown Origin Affects Prognosis

    Abe, Arata; Harada-Abe, Mina; Ueda, Masayuki; Katano, Takehiro; Nakajima, Masataka; Muraga, Kanako; Suda, Satoshi; Nishiyama, Yasuhiro; Okubo, Seiji; Mishina, Masahiro; Katsura, Ken-ichiro; Katayama, Yasuo

    2014-01-01

    Background Cerebral infarction of unknown origin at admission accounts for half of all cerebral infarction cases in some institutions. However, the factors associated with cerebral infarction prognosis have not been sufficiently examined. Here, we investigated whether aortic arch plaques (AAPs) on transoesophageal echocardiography (TOE) were associated with the prognosis of cerebral infarction of unknown origin at admission. Methods Of 571 patients who were hospitalised between June 2009 and ...

  6. Impact of Utilizing Pharmacy Students as Workforce for Hawai‘i Asthma Friendly Pharmacy Project

    Ma, Carolyn S; Nett, Blythe; Kishaba, Gregg; Gomez, Lara

    2015-01-01

    A partnership was formed between the University of Hawai‘i at Hilo Daniel K. Inouye College of Pharmacy (DKICP) and the Department of Health to carry out the Hawai‘i Asthma Friendly Pharmacy Project (HAFPP), which utilizes pharmacy students as a workforce to administer Asthma Control Tests™ (ACT), and provide Asthma Action Plans (AAP) and inhaler technique education. Evaluation of data from a pilot project in 2008 with first and second year students prompted more intensive training in therape...

  7. Droplet Microfluidic Technique for the Study of Fermentation

    Krzysztof Churski; Artur Ruszczak; Slawomir Jakiela; Piotr Garstecki

    2015-01-01

    We demonstrate a technique that uses microdroplets for culturing and selecting bacterial cultures in a model biotechnological application. We propose an assay for determination of ethanol concentration that provides increased dynamic range and is compatible with droplet microfluidic screening technologies. The assay comprises two enzymes—alcohol oxidase (AOX) and horseradish peroxidase (HRP)—and a colorimetric readout system of phenol-4-sulfonic acid (PSA) and 4-aminoantipyrine (4-AAP). The m...

  8. Historical Overview of Transitional Feeding Recommendations and Vegetable Feeding Practices for Infants and Young Children

    Kleinman, Ronald E.; Coletta, Frances A.

    2016-01-01

    Although recommendations for introducing solid foods to infants and young children have changed significantly since the beginning of the 20th century, vegetable consumption recommendations have always been an important part of the child-feeding repertoire. In 1958, the first report of the American Academy of Pediatrics (AAP) Committee on Nutrition stated that developmental maturity of the gut and neuromuscular system, growth rate, and activity level were good indicators for determining when t...

  9. Gene : CBRC-OCUN-01-1579 [SEVENS

    Full Text Available CBRC-OCUN-01-1579 pseudo Novel UN B Odorant/olfactory and gustatory rec eptors O51A7_HUMAN 1e-48 ... 52% gb|AAP71064.1| olfactory rec eptor Olfr575 [Mus musculus] 5e-54 59% gnl|UG|Ocu#S ... mRNA for protein phosphatase-1 catalytic subunit (EC ... 3.1.3.-) /cds=p(241,1176) /gb=Y00701 /gi=1676 /ug= ...

  10. One-step in situ synthesis of polyamide microcapsules with inorganic payload and their transformation into responsive thermoplastic composite materials

    Dencheva, Nadya Vasileva; Denchev, Z.; Lanceros-Méndez, S.; Ezquerra Sanz, T.

    2016-01-01

    Well-dispersed loads of finely powdered metals, metal oxides, several carbon allotropes or nanoclays are incorporated into highly porous polyamide 6 microcapsules in controllable amounts via an original one-step in situ fabrication technique. It is based on activated anionic polymerization (AAP) of ε-caprolactam in a hydrocarbon solvent performed in the presence of the respective micro- or nanosized loads. The forming microcapsules with typical diameters of 25-50 µm entrap up ...

  11. Meeting Report: Metabolites in Safety Testing (MIST) Symposium—Safety Assessment of Human Metabolites: What’s REALLY Necessary to Ascertain Exposure Coverage in Safety Tests?

    GAO Hongying; Jacobs, Abigail; White, Ronald E.; Booth, Brian P.; Obach, R Scott

    2013-01-01

    In the 2012 AAPS metabolites in safety testing (MIST) symposium held in Chicago, IL, USA, on October 15, 2012, regulatory experts and industrial scientists joined together to discuss their perspectives and strategies in addressing contemporary MIST recommendations (FDA 2008, International Conference on Harmonization (ICH) M3(R2), ICH M(R2) Q&A). Overall, these regulatory guidances indicate that metabolites identified in human plasma should circulate at similar or greater concentrations in at ...

  12. EST Table: FY746730 [KAIKOcDNA[Archive

    Full Text Available FY746730 E_FL_famL_31G04_F_0 11/11/04 99 %/310 aa gb|ACN86367.1| troponin T transcript variant B ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  13. EST Table: FY761643 [KAIKOcDNA[Archive

    Full Text Available FY761643 E_FL_famL_42G23_R_0 11/11/04 99 %/280 aa gb|ACN86367.1| troponin T transcript variant B ... 44 %/181 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  14. EST Table: FS775378 [KAIKOcDNA[Archive

    Full Text Available FS775378 E_FL_fcaL_07N14_R_0 10/09/28 98 %/163 aa gb|ACN86367.1| troponin T transcript variant B ... 50 %/121 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  15. EST Table: FS778531 [KAIKOcDNA[Archive

    Full Text Available FS778531 E_FL_fcaL_17P07_R_0 10/09/28 97 %/167 aa gb|ACN86367.1| troponin T transcript variant B ... 51 %/123 aa F53A9.10b#CE34878#WBGene00006587#locus:tnt - 2#status:Confirmed#UniProt:Q7Z071#protein_id:AAP6 ...

  16. Barriers to Pediatricians’ Adherence to American Academy of Pediatrics Oral Health Referral Guidelines: North Carolina General Dentists’ Opinions

    Long, C. Marshall; Quinonez, Rocio B.; Rozier, R. Gary; Kranz, Ashley M.; Lee, Jessica Y.

    2015-01-01

    Purpose The purposes of this study were to: (1) assess knowledge, attitudes, and behaviors of North Carolina general dentists (GDs) regarding American Academy of Pediatrics (AAP) dental referral guidelines; and (2) determine factors that influence pediatricians’ ability to comply with AAP guidelines. Methods One thousand GDs were surveyed to determine barriers toward acceptance of physician referrals of infants and toddlers. The primary outcome using ordered logistic regression was GDs’ acceptance of children described in five case scenarios, with different levels of risk and oral health status. Results GDs believed pediatricians should refer patients at risk for caries to a dentist. While 61 to 75 percent of GDs were willing to accept low caries risk referrals of infants and toddlers, only 35 percent would accept referrals when caries was present. Predictors of referral acceptance were correct knowledge about AAP guidelines (OR=2.0, 95%CI=1.2-3.3), confidence in pro- viding preventive care to infants and toddlers (OR=2.6, 95%CI=1.3-4.9), and agreement that parents see importance in dental referrals (OR=2.1, 95% CI=1.2-3.6). Conclusions This study identified factors influencing acceptance of pediatrician referrals for the age one dental visit among North Carolina GDs and highlighted challenges pediatricians face in referring young children for dental care. PMID:25197996

  17. SIDS and other sleep-related infant deaths: expansion of recommendations for a safe infant sleeping environment.

    Moon, Rachel Y

    2011-11-01

    Despite a major decrease in the incidence of sudden infant death syndrome (SIDS) since the American Academy of Pediatrics (AAP) released its recommendation in 1992 that infants be placed for sleep in a nonprone position, this decline has plateaued in recent years. Concurrently, other causes of sudden unexpected infant death that occur during sleep (sleep-related deaths), including suffocation, asphyxia, and entrapment, and ill-defined or unspecified causes of death have increased in incidence, particularly since the AAP published its last statement on SIDS in 2005. It has become increasingly important to address these other causes of sleep-related infant death. Many of the modifiable and nonmodifiable risk factors for SIDS and suffocation are strikingly similar. The AAP, therefore, is expanding its recommendations from focusing only on SIDS to focusing on a safe sleep environment that can reduce the risk of all sleep-related infant deaths, including SIDS. The recommendations described in this policy statement include supine positioning, use of a firm sleep surface, breastfeeding, room-sharing without bed-sharing, routine immunizations, consideration of using a pacifier, and avoidance of soft bedding, overheating, and exposure to tobacco smoke, alcohol, and illicit drugs. The rationale for these recommendations is discussed in detail in the accompanying "Technical Report--SIDS and Other Sleep-Related Infant Deaths: Expansion of Recommendations for a Safe Infant Sleeping Environment," which is included in this issue of Pediatrics (www.pediatrics.org/cgi/content/full/128/5/e1341). PMID:22007004

  18. Promoting psychosocial adaptation of youths in residential care through animal-assisted psychotherapy.

    Balluerka, Nekane; Muela, Alexander; Amiano, Nora; Caldentey, Miguel A

    2015-12-01

    The goal of this study was to examine the influence of animal-assisted psychotherapy (AAP) on the psychosocial adaptation of a group of adolescents in residential care who had suffered traumatic childhood experiences and who presented with mental health problems. This study recruited 63 youths (mean age=15.27, SD=1.63) who were divided into two groups: a treatment group of 39 youths (19 female and 20 male; mean age=15.03, SD=0.51) and a control group of 24 (five female and 19 male; mean age=15.67, SD=1.63). The youths who underwent the AAP program had higher school adjustment in comparison to their peers who did not receive treatment. Their hyperactive behavior decreased, and they showed better social skills, more leadership, and fewer attention problems. They also showed a more positive attitude toward their teachers in comparison to controls. No differences were observed in other variables associated with clinical symptoms or personal adjustment. These results suggest that AAP can be effective with teenagers who have suffered childhood traumas and who present with problems of psychosocial adaptation. PMID:26443670

  19. Novel parvoviruses in reptiles and genome sequence of a lizard parvovirus shed light on Dependoparvovirus genus evolution.

    Pénzes, Judit J; Pham, Hanh T; Benkö, Mária; Tijssen, Peter

    2015-09-01

    Here, we report the detection and partial genome characterization of two novel reptilian parvoviruses derived from a short-tailed pygmy chameleon (Rampholeon brevicaudatus) and a corn snake (Pantherophis guttatus) along with the complete genome analysis of the first lizard parvovirus, obtained from four bearded dragons (Pogona vitticeps). Both homology searches and phylogenetic tree reconstructions demonstrated that all are members of the genus Dependoparvovirus. Even though most dependoparvoviruses replicate efficiently only in co-infections with large DNA viruses, no such agents could be detected in one of the bearded dragon samples, hence the possibility of autonomous replication was explored. The alternative ORF encoding the full assembly activating protein (AAP), typical for the genus, could be obtained from reptilian parvoviruses for the first time, with a structure that appears to be more ancient than that of avian and mammalian parvoviruses. All three viruses were found to harbour short introns as previously observed for snake adeno-associated virus, shorter than that of any non-reptilian dependoparvovirus. According to the phylogenetic calculations based on full non-structural protein (Rep) and AAP sequences, the monophyletic cluster of reptilian parvoviruses seems to be the most basal out of all lineages of genus Dependoparvovirus. The suspected ability for autonomous replication, results of phylogenetic tree reconstruction, intron lengths and the structure of the AAP suggested that a single Squamata origin instead of the earlier assumed diapsid (common avian-reptilian) origin is more likely for the genus Dependoparvovirus of the family Parvoviridae. PMID:26067293

  20. Oxytocin enhances the experience of attachment security

    Buchheim, Anna; Heinrichs, Markus; George, Carol; Pokorny, Dan; Koops, Eva; Henningsen, Peter; O’Connor, Mary-Frances; Gundel, Harald

    2011-01-01

    Summary Repeated interactions between infant and caregiver result in either secure or insecure relationship attachment patterns, and insecure attachment may affect individual emotion-regulation and health. Given that oxytocin enhances social approach behavior in animals and humans, we hypothesized that oxytocin might also promote the experience of attachment security in humans. Within a 3-week interval 26 healthy male students classified with an insecure attachment pattern were invited twice to an experimental session. Within each session, a single dose of oxytocin or placebo was administered, using a double-blind, placebo-controlled within-subject design. In both conditions, subjects completed an attachment task based on the Adult Attachment Projective Picture System (AAP). Thirty-two AAP picture system presentations depicted attachment-related events (e.g. illness, solitude, separation, loss), and were each accompanied by four prototypical phrases representing one secure and three insecure attachment categories. In the oxytocin condition, a significant proportion of these insecure subjects (N = 18; 69%) changed their rankings of “secure attachment” phrases towards the more appropriate for the AAP picture presentation, and the same subjects decreased in overall rating of the “insecure attachment” phrases. In particular, there was a significant decrease in the number of subjects ranking the pictures with “insecure-preoccupied” phrases from the placebo to the oxytocin condition. We find that a single dose of intranasally administered oxytocin is sufficient to induce a significant increase in the experience of attachment security in adults classified previously as insecure. PMID:19457618

  1. Medical Versus Nonmedical Immunization Exemptions for Child Care and School Attendance.

    2016-09-01

    Routine childhood immunizations against infectious diseases are an integral part of our public health infrastructure. They provide direct protection to the immunized individual and indirect protection to children and adults unable to be immunized via the effect of community immunity. All 50 states, the District of Columbia, and Puerto Rico have regulations requiring proof of immunization for child care and school attendance as a public health strategy to protect children in these settings and to secondarily serve as a mechanism to promote timely immunization of children by their caregivers. Although all states and the District of Columbia have mechanisms to exempt school attendees from specific immunization requirements for medical reasons, the majority also have a heterogeneous collection of regulations and laws that allow nonmedical exemptions from childhood immunizations otherwise required for child care and school attendance. The American Academy of Pediatrics (AAP) supports regulations and laws requiring certification of immunization to attend child care and school as a sound means of providing a safe environment for attendees and employees of these settings. The AAP also supports medically indicated exemptions to specific immunizations as determined for each individual child. The AAP views nonmedical exemptions to school-required immunizations as inappropriate for individual, public health, and ethical reasons and advocates for their elimination. PMID:27573087

  2. Experience in diagnosis and treatment of asparaginase-associated pancreatitis in children%门冬酰胺酶相关胰腺炎的诊治体会

    陈再生; 李健

    2014-01-01

    Objective To analyze the clinical characteristics and the course of diagnosis and therapy of PEG-asparaginase associated pancreatitis (AAP)in childhood,and to reveal the pathophysiology of AAP,enhance the ability of diagnosis and treament.Method Data of 13 cases with AAP in childhood seen from March 2011 to March 2014 were analyzed with regard to clinical manifestations,laboratory findings,imaging feature and treatment.Result AAP was found in 12 of acute lymphoblastic leukemia (ALL) and 1 of non-Hodgkin's lymphoma (NHL),8 were boys and 5 were girls,with a mean age 6 years.In 12 cases AAP occurred during the induction-remission treatment,in 1 case during the maintenance-intensification phase.AAP occurred after a median of two doses,and 9 d (median) from the latest administration of PEG-asparaginase.The major manifestations of AAP was abdominal pain (11/13).At the time of AAP diagnosis during the first 48 hours the median peak serum amylase and serum lipase levels were 559 U/L (range 118 -1 585,upper normal limit:125) and 934 U/L (range 221-1 673,upper normal limit:300).Three cases with serum amylase and serum lipase levels above 3 times upper normal limit were repeatedly complicated with pancreatic pseudocyst; 11 patients had abnormal CT imaging,8 cases revealed effusion around the pancreas,and 4 cases had pseudocyst.Therapy with ulinastatin,octreotide acetate,glucocorticoid could relieve abdominal pain significantly.Three cases underwent abdominal puncture drainage and 5 cases fulfilled nasojejunal nutrition therapy.Nine of them were cured,4 developed pseudocyst,in 2 AAP vanished gradually and 2 died with pseudocyst.Conclusion The major manifestations of AAP were abdominal pain,but sometimes apparent and sometimes latent.Condition of acute pancreatitis may exacerbate rapidly and easily.Early identification had significance.Pancreatic pseudocyst suggested a poor prognosis.%目的 分析门冬酰胺酶相关胰腺炎(AAP)的临床特征和诊治经过.方法 收集

  3. Serial Ultrasound Monitoring for Early Recognition of Asparaginase Associated Pancreatitis in Children With Acute Lymphoblastic Leukemia

    Raja, Raheel Altaf; Schmiegelow, K.; Henriksen, Birthe Merete;

    2015-01-01

    BACKGROUND: Acute lymphoblastic leukemia (ALL) is the most common cancer in children and L-asparaginase is an essential component of the treatment. Cessation of L-asparaginase decreases event free survival. Acute pancreatitis is the toxicity that most commonly results in cessation of L-asparagina......BACKGROUND: Acute lymphoblastic leukemia (ALL) is the most common cancer in children and L-asparaginase is an essential component of the treatment. Cessation of L-asparaginase decreases event free survival. Acute pancreatitis is the toxicity that most commonly results in cessation of L...... protocol, with PEG-asparaginase of 2 or 6 week intervals, for 30 weeks had their pancreas monitored using serial ultrasound in order to detect early signs of inflammation. RESULTS: Nineteen of 31 eligible patients were included. Three of the included patients developed AAP. None of the patients, including...... the three patients that developed AAP, had signs of inflammatory edema or pancreas enzymes above three times the upper normal limit prior to AAP. CONCLUSION: We found no signs of inflammatory edema within the pancreas on ultrasound during treatment with PEG-asparginase in our cohort prior to...

  4. Health information technology and the medical home.

    2011-05-01

    The American Academy of Pediatrics (AAP) supports development and universal implementation of a comprehensive electronic infrastructure to support pediatric information functions of the medical home. These functions include (1) timely and continuous management and tracking of health data and services over a patient's lifetime for all providers, patients, families, and guardians, (2) comprehensive organization and secure transfer of health data during patient-care transitions between providers, institutions, and practices, (3) establishment and maintenance of central coordination of a patient's health information among multiple repositories (including personal health records and information exchanges), (4) translation of evidence into actionable clinical decision support, and (5) reuse of archived clinical data for continuous quality improvement. The AAP supports universal, secure, and vendor-neutral portability of health information for all patients contained within the medical home across all care settings (ambulatory practices, inpatient settings, emergency departments, pharmacies, consultants, support service providers, and therapists) for multiple purposes including direct care, personal health records, public health, and registries. The AAP also supports financial incentives that promote the development of information tools that meet the needs of pediatric workflows and that appropriately recognize the added value of medical homes to pediatric care. PMID:21518710

  5. Precipitation estimation in mountainous terrain using multivariate geostatistics. Part I: structural analysis

    Hevesi, Joseph A.; Istok, Jonathan D.; Flint, Alan L.

    1992-01-01

    Values of average annual precipitation (AAP) are desired for hydrologic studies within a watershed containing Yucca Mountain, Nevada, a potential site for a high-level nuclear-waste repository. Reliable values of AAP are not yet available for most areas within this watershed because of a sparsity of precipitation measurements and the need to obtain measurements over a sufficient length of time. To estimate AAP over the entire watershed, historical precipitation data and station elevations were obtained from a network of 62 stations in southern Nevada and southeastern California. Multivariate geostatistics (cokriging) was selected as an estimation method because of a significant (p = 0.05) correlation of r = .75 between the natural log of AAP and station elevation. A sample direct variogram for the transformed variable, TAAP = ln [(AAP) 1000], was fitted with an isotropic, spherical model defined by a small nugget value of 5000, a range of 190 000 ft, and a sill value equal to the sample variance of 163 151. Elevations for 1531 additional locations were obtained from topographic maps to improve the accuracy of cokriged estimates. A sample direct variogram for elevation was fitted with an isotropic model consisting of a nugget value of 5500 and three nested transition structures: a Gaussian structure with a range of 61 000 ft, a spherical structure with a range of 70 000 ft, and a quasi-stationary, linear structure. The use of an isotropic, stationary model for elevation was considered valid within a sliding-neighborhood radius of 120 000 ft. The problem of fitting a positive-definite, nonlinear model of coregionalization to an inconsistent sample cross variogram for TAAP and elevation was solved by a modified use of the Cauchy-Schwarz inequality. A selected cross-variogram model consisted of two nested structures: a Gaussian structure with a range of 61 000 ft and a spherical structure with a range of 190 000 ft. Cross validation was used for model selection and for

  6. Ambient air pollution associated with suppressed serologic responses to Pneumocystis jirovecii in a prospective cohort of HIV-infected patients with Pneumocystis pneumonia.

    Robert J Blount

    Full Text Available Ambient air pollution (AAP may be associated with increased risk for Pneumocystis pneumonia (PCP. The mechanisms underlying this association remain uncertain.To determine if real-life exposures to AAP are associated with suppressed IgM antibody responses to P. jirovecii in HIV-infected (HIV+ patients with active PCP, and to determine if AAP, mediated by suppressed serologic responses to Pneumocystis, is associated with adverse clinical outcomes.We conducted a prospective cohort study in HIV+ patients residing in San Francisco and admitted to San Francisco General Hospital with microscopically confirmed PCP. Our AAP predictors were ambient air concentrations of particulate matter of < 10 µm in diameter (PM10 and < 2.5 µm in diameter (PM2.5, nitrogen dioxide (NO2, ozone (O3, and sulfur dioxide (SO2 measured immediately prior to hospital admission and 2 weeks prior to admission. Our primary outcomes were the IgM serologic responses to four recombinant P. jirovecii major surface glycoprotein (Msg constructs: MsgC1, MsgC3, MsgC8, and MsgC9.Elevated PM10 and NO2 exposures immediately prior to and two weeks prior to hospital admission were associated with decreased IgM antibody responses to P. jirovecii Msg. For exposures immediately prior to admission, every 10 µg/m(3 increase in PM10 was associated with a 25 to 35% decrease in IgM responses to Msg (statistically significant for all the Msg constructs, and every 10 ppb increase in NO2 was associated with a 19-45% decrease in IgM responses to Msg (statistically significant for MsgC8 and MsgC9. Similar findings were seen with exposures two weeks prior to admission, but for fewer of the Msg constructs.Real life exposures to PM10 and NO2 were associated with suppressed IgM responses to P. jirovecii Msg in HIV+ patients admitted with PCP, suggesting a mechanism of immunotoxicity by which AAP increases host susceptibility to pulmonary infection.

  7. Acquisition, Replication and Inoculation of Candidatus Liberibacter asiaticus following Various Acquisition Periods on Huanglongbing-Infected Citrus by Nymphs and Adults of the Asian Citrus Psyllid.

    El-Desouky Ammar

    Full Text Available The Asian citrus psyllid, Diaphorina citri (Hemiptera: Liviidae, is the primary vector of Candidatus Liberibacter asiaticus (Las implicated as causative agent of citrus huanglongbing (citrus greening, currently the most serious citrus disease worldwide. Las is transmitted by D. citri in a persistent-circulative manner, but the question of replication of this bacterium in its psyllid vector has not been resolved. Thus, we studied the effects of the acquisition access period (AAP by nymphs and adults of D. citri on Las acquisition, multiplication and inoculation/transmission. D. citri nymphs or adults (previously non-exposed to Las were caged on Las-infected citrus plants for an AAP of 1, 7 or 14 days. These 'Las-exposed' psyllids were then transferred weekly to healthy citrus or orange jasmine plants, and sampled via quantitative polymerase chain reaction (qPCR analysis 1-42 days post-first access to diseased plants (padp; all tested nymphs became adults 7-14 days padp. Our results indicate that following 1 or 7 day AAP as nymphs 49-59% of Las-exposed psyllids became Las-infected (qPCR-positive, whereas only 8-29% of the psyllids were infected following 1-14 day AAP as adults. Q-PCR analysis also indicated that Las titer in the Las-exposed psyllids (relative to that of the psyllid S20 ribosomal protein gene was: 1 significantly higher, and increasing at a faster rate, following Las acquisition as nymphs compared to that following Las acquisition as adults; 2 higher as post-acquisition time of psyllids on healthy plants increased reaching a peak at 14-28 days padp for nymphs and 21-35 days padp for adults, with Las titer decreasing or fluctuating after that; 3 higher with longer AAP on infected plants, especially with acquisition as adults. Our results strongly suggest that Las multiplies in both nymphs and adults of D. citri but attains much higher levels in a shorter period of time post-acquisition when acquired by nymphs than when acquired by

  8. Korean Medication Algorithm for Bipolar Disorder 2014: comparisons with other treatment guidelines

    Jeong JH

    2015-06-01

    Full Text Available Jong-Hyun Jeong,1 Jeong Goo Lee,2,3 Moon-Doo Kim,4 Inki Sohn,5 Se-Hoon Shim,6 Hee Ryung Wang,1 Young Sup Woo,1 Duk-In Jon,7 Jeong Seok Seo,8 Young-Chul Shin,9 Kyung Joon Min,10 Bo-Hyun Yoon,11 Won-Myong Bahk1 1Department of Psychiatry, College of Medicine, The Catholic University of Korea, Seoul, 2Department of Psychiatry, Haeundae Paik Hospital, College of Medicine, Paik Institute for Clinical Research, Inje University, 3Department of Health Science and Technology, Graduate School of Inje University, Busan, 4Department of Psychiatry, Jeju National University Hospital, Jeju, 5Department of Psychiatry, Keyo Hospital, Keyo Medical Foundation, Uiwang, 6Department of Psychiatry, Soonchunhyang University Cheonan Hospital, College of Medicine, Soonchunhyang University, Cheonan, 7Department of Psychiatry, Sacred Heart Hospital, College of Medicine, Hallym University, Anyang, 8Department of Psychiatry, Konkuk University Chungju Hospital, School of Medicine, Konkuk University, Chungju, 9Department of Psychiatry, Kangbuk Samsung Hospital, School of Medicine, Sungkyunkwan University, Seoul, 10Department of Psychiatry, Chung-Ang University Hospital, College of Medicine, Chung-Ang University, Seoul, 11Department of Psychiatry, Naju National Hospital, Naju, Korea Abstract: Our goal was to compare the recommendations of the Korean Medication Algorithm Project for Bipolar Disorder 2014 (KMAP-BP 2014 with other recently published guidelines for the treatment of bipolar disorder. We reviewed a total of four recently published global treatment guidelines and compared each treatment recommendation of the KMAP-BP 2014 with those in other guidelines. For the initial treatment of mania, there were no significant differences across treatment guidelines. All recommended mood stabilizer (MS or atypical antipsychotic (AAP monotherapy or the combination of an MS with an AAP as a first-line treatment strategy for mania. However, the KMAP-BP 2014 did not prefer monotherapy

  9. Apodized-aperture pixel design to increase high-frequency DQE and reduce noise aliasing in x-ray detectors

    Ismailova, Elina; Karim, Karim; Cunningham, Ian A.

    2015-03-01

    The detective quantum efficiency (DQE) of an x-ray detector, expressed as a function of spatial frequency, describes the ability to produce high-quality images relative to an ideal detector. While the DQE normally decreases substantially with increasing frequency, we describe an approach that can be used to improve the DQE response by increasing the DQE at high spatial frequencies. The approach makes use of an apodized-aperture pixel (AAP) design that requires use of a high-resolution x-ray converter such as selenium coupled to a sensor array with very small physical sensor elements, such as CMOS sensors. While sensors with elements of 10 - 25 μm are too small for most practical applications in medical radiography, we describe how larger image pixels of a practical size can be synthesized to provide a better DQE than simple binning or using physical pixels of the same size. A theoretical cascaded-systems analysis shows the DQE at the image sampling cut-off frequency can be improved by up to a factor of 2.5x. The AAP approach was validated experimentally using a CMOS/CsI-based detector having 0.05-mm sensor elements. Using AAP images with 0.2-mm pixels, the high-frequency DQE value was increased from 0.2 to 0.4 compared to simple 4x4 binning. It is concluded that ultra-high-resolution sensors can be used to optimize the high-frequency performance of x-ray detectors and make substantial improvements in image quality for visualization of small stuctures and fine image detail in comparison to current imaging systems.

  10. Promoting the well-being of children whose parents are gay or lesbian.

    2013-04-01

    To promote optimal health and well-being of all children, the American Academy of Pediatrics (AAP) supports access for all children to (1) civil marriage rights for their parents and (2) willing and capable foster and adoptive parents, regardless of the parents' sexual orientation. The AAP has always been an advocate for, and has developed policies to support, the optimal physical, mental, and social health and well-being of all infants, children, adolescents, and young adults. In so doing, the AAP has supported families in all their diversity, because the family has always been the basic social unit in which children develop the supporting and nurturing relationships with adults that they need to thrive. Children may be born to, adopted by, or cared for temporarily by married couples, nonmarried couples, single parents, grandparents, or legal guardians, and any of these may be heterosexual, gay or lesbian, or of another orientation. Children need secure and enduring relationships with committed and nurturing adults to enhance their life experiences for optimal social-emotional and cognitive development. Scientific evidence affirms that children have similar developmental and emotional needs and receive similar parenting whether they are raised by parents of the same or different genders. If a child has 2 living and capable parents who choose to create a permanent bond by way of civil marriage, it is in the best interests of their child(ren) that legal and social institutions allow and support them to do so, irrespective of their sexual orientation. If 2 parents are not available to the child, adoption or foster parenting remain acceptable options to provide a loving home for a child and should be available without regard to the sexual orientation of the parent(s). PMID:23519941