
Sample records for aaf

  1. Crystallization and initial crystallographic analysis of AafA: the major adhesive subunit of the enteroaggregative Escherichia coli AAF/II pilus

    The Enteroaggregative Escherichia coli AAF/II pilus plays an important role in the attachment to and invasion of the host during the initial stages of colonization. Here, the major adhesive subunit of AAF/II has been crystallized at pH 3.4 and diffraction data have been collected to 2.1 Å resolution. AafA is the major adhesive pilin subunit of the aggregative adherence fimbriae (AAF) from enteroaggregative Escherichia coli, which play an important role by attaching to the host cells during the initial phase of bacterial colonization and invasion. AafA has been crystallized at pH 3.4 and diffraction data have been collected to 2.1 Å resolution. Molecular replacement was unsuccessful and selenomethionine-substituted protein and heavy-atom derivatives are being prepared for phasing


    The Environmental Technology Verification report discusses the technology and performance of the DriPak 90/95% air filter for dust and bioaerosol filtration manufactured by AAF International. The pressure drop across the filter was 104 Pa clean and 348 Pa dust loaded, and the fil...


    The Environmental Technology Verification report discusses the technology and performance of the BioCel I (Type SH) air filter for dust and bioaerosol filtration manufactured by AAF International. The pressure drop across the filter was 236 Pa clean and 478 Pa dust loaded, and th...

  4. Deployment of ARM Aerial Facility (AAF) Scanning Mobility Particle Sizer Field Campaign Report

    Wang, J. [Brookhaven National Lab. (BNL), Upton, NY (United States)


    Atmospheric aerosols influence global climate by scattering and absorbing sunlight (direct effects) and by changing the microphysical structure, lifetime, and coverage of clouds (indirect effects). While it is widely accepted that aerosol indirect effects act to cool the Earth-atmosphere system by increasing cloud reflectivity and coverage, the magnitudes of the indirect effects are poorly quantified. One key aerosol property for understanding aerosol indirect effects is the ability of aerosol particles to form cloud droplets at atmospheric relevant supersaturations—i.e., cloud condensation nuclei (CCN) activity. For particles consisting of typical atmospheric inorganic compounds, their CCN activity is well understood and can be effectively predicted using Köhler theory based on physicochemical properties of the solute, such as its mass, molar volume, and activity coefficient. However, atmospheric aerosols often consist of hundreds of organic species, which can contribute ~20-90% to the total fine aerosol mass. Depending on their properties, organic species can significantly influence the ability of aerosol particles to act as CCN and form cloud droplets. This project focuses on the CCN activity of secondary organic aerosol compounds formed from key biogenic volatile organic compounds (VOCs) under representative conditions, and the relationship between the hygroscopicity and composition of organic aerosols. The ARM Aerial Facility (AAF) scanning mobility particles sizer (SMPS) was deployed during a ~ 6 week intensive measurement campaign, taking place June 15-July 31 2015 at the Pacific Northwest National Laboratory (PNNL) Environmental Simulation Chamber. The SMPS was operated with a CCN counter. Aerosol particles were first classified by the differential mobility analyzer inside the SMPS; the classified aerosol will then be simultaneously characterized by a condensation particle counter (part of the SMPS) and the CCN counter.

  5. Aggregative adherence fimbriae I (AAF/I) mediate colonization of fresh produce and abiotic surface by Shiga toxigenic enteroaggregative Escherichia coli O104:H4.

    Nagy, Attila; Xu, Yunfeng; Bauchan, Gary R; Shelton, Daniel R; Nou, Xiangwu


    The Shiga toxigenic Escherichia coli O104:H4 isolated during the 2011 European outbreak expresses Shiga toxin 2a and possess virulence genes associated with the enteroaggregative E. coli (EAEC) pathotype. It produces plasmid encoded aggregative adherence fimbriae I (AAF/I) which mediate cell aggregation and biofilm formation in human intestine and promote Shiga-toxin adsorption, but it is not clear whether the AAF/I fimbriae are involved in the colonization and biofilm formation on food and environmental matrices such as the surface of fresh produce. We deleted the gene encoding for the AAF/I fimbriae main subunit (AggA) from an outbreak associated E. coli O104:H4 strain, and evaluated the role of AAF/I fimbriae in the adherence and colonization of E. coli O104:H4 to spinach and abiotic surfaces. The deletion of aggA did not affect the adherence of E. coli O104:H4 to these surfaces. However, it severely diminished the colonization and biofilm formation of E. coli O104:H4 on these surfaces. Strong aggregation and biofilm formation on spinach and abiotic surfaces were observed with the wild type strain but not the isogenic aggA deletion mutant, suggesting that AAF/I fimbriae play a crucial role in persistence of O104:H4 cells outside of the intestines of host species, such as on the surface of fresh produce. PMID:27099984


    The Environmental Technology Verification report discusses the technology and performance of the PerfectPleat Ultra 175-102-863 air filter for dust and bioaerosol filtration manufactured by AAF International. The pressure drop across the filter was 112 Pa clean and 229 Pa dust lo...

  7. Visualization of an AAF induced frameshift mutation: molecular views of base displacement in B-DNA from minimized potential energy calculations.

    Broyde, S; Hingerty, B E


    Energy minimized structures of base displacement in an AAF modified B-DNA dodecamer are presented. A rational search strategy, beginning with a global search of the conformation space of the modified deoxydinucleoside monophosphate, together with model building by computer graphics, has been employed. A number of different minimum energy conformations have been located which reveal base displaced structures. These show fluorene interstrand stacking, fluorene inter- and intrastrand stacking, a...

  8. Direct in vivo cell lineage analysis in the retrorsine and 2AAF models of liver injury after genetic labeling in adult and newborn rats.

    Virginie Pichard

    Full Text Available BACKGROUNDS AND AIMS: When hepatocyte proliferation is impaired, liver regeneration proceeds from the division of non parenchymal hepatocyte progenitors. Oval cells and Small Hepatocyte-like Progenitor Cells (SHPCs represent the two most studied examples of such epithelial cells with putative stem cell capacity. In the present study we wished to compare the origin of SHPCs proliferating after retrorsine administration to the one of oval cells observed after 2-Acetyl-Amino fluorene (2-AAF treatment. METHODOLOGY/PRINCIPAL FINDINGS: We used retroviral-mediated nlslacZ genetic labeling of dividing cells to study the fate of cells in the liver. Labeling was performed either in adult rats before treatment or in newborn animals. Labeled cells were identified and characterised by immunohistochemistry. In adult-labeled animals, labeling was restricted to mature hepatocytes. Retrorsine treatment did not modify the overall number of labeled cells in the liver whereas after 2-AAF administration unlabeled oval cells were recorded and the total number of labeled cells decreased significantly. When labeling was performed in newborn rats, results after retrorsine administration were identical to those obtained in adult-labeled rats. In contrast, in the 2-AAF regimen numerous labeled oval cells were present and were able to generate new labeled hepatocytes. Furthermore, we also observed labeled biliary tracts in 2-AAF treated rats. CONCLUSIONS: Our results strongly suggest that SHPCs are derived from hepatocytes and we confirm that SHPCs and oval cells do not share the same origin. We also show that hepatic progenitors are labeled in newborn rats suggesting future directions for in vivo lineage studies.

  9. The fermentation stress response protein Aaf1p/Yml081Wp regulates acetate production in Saccharomyces cerevisiae.

    Christopher J Walkey

    Full Text Available The production of acetic acid during wine fermentation is a critical issue for wineries since the sensory quality of a wine can be affected by the amount of acetic acid it contains. We found that the C2H2-type zinc-finger transcription factor YML081Wp regulated the mRNA levels of ALD4 and ALD6, which encode a cytosolic acetaldehyde dehydrogenase (ACDH and a mitochondrial ACDH, respectively. These enzymes produce acetate from acetaldehyde as part of the pyruvate dehydrogenase bypass. This regulation was also reflected in the protein levels of Ald4p and Ald6p, as well as total ACDH activity. In the absence of ALD6, YML081W had no effect on acetic acid levels, suggesting that this transcription factor's effects are mediated primarily through this gene. lacZ reporter assays revealed that Yml081wp stimulates ALD6 transcription, in large part from a GAGGGG element 590 base pairs upstream of the translation start site. The non-annotated ORF YML081W therefore encodes a transcription factor that regulates acetate production in Saccharomyces cerevisiae. We propose AAF1 as a gene name for the YML081W ORF.

  10. Vitamin K2-enhanced liver regeneration is associated with oval cell expansion and up-regulation of matrilin-2 expression in 2-AAF/PH rat model.

    Lin, M; Sun, P; Zhang, G; Xu, X; Liu, G; Miao, H; Yang, Y; Xu, H; Zhang, L; Wu, P; Li, M


    Normal liver has a great potential of regenerative capacity after partial hepatectomy. In clinic, however, most patients receiving partial hepatectomy are usually suffering from chronic liver diseases with severely damaged hepatocyte population. Under these conditions, activation of hepatic progenitor cell (oval cell in rodents) population might be considered as an alternative mean to enhance liver functional recovery. Vitamin K2 has been shown to promote liver functional recovery in patients with liver cirrhosis. In this study, we explored the possibility of vitamin K2 treatment in activating hepatic oval cell for liver regeneration with the classic 2-acetamido-fluorene/partial hepatectomy (2-AAF/PH) model in Sprague-Dawley rats. In 2-AAF/PH animals, vitamin K2 treatment induced a dose-dependent increase of liver regeneration as assessed by the weight ratio of remnant liver versus whole body and by measuring serum albumin level. In parallel, a drastic expansion of oval cell population as assessed by anti-OV6 and anti-CK19 immunostaining was noticed in the periportal zone of the remnant liver. Since matrilin-2 was linked to oval cell proliferation and liver regeneration after partial hepatectomy, we assessed its expression at both the mRNA and protein levels. The results revealed a significant increase after vitamin K2 treatment in parallel with the expansion of oval cell population. Consistently, knocking down matrilin-2 expression in vivo largely reduced vitamin K2-induced liver regeneration and oval cell proliferation in 2-AAF/PH animals. In conclusion, these data suggest that vitamin K2 treatment enhances liver regeneration after partial hepatectomy, which is associated with oval cell expansion and matrilin-2 up-regulation. PMID:24236453

  11. Insulin-like growth factor binding protein-3 is required for the regulation of rat oval cell proliferation and differentiation in the 2AAF/PHX model

    Nicole C Steiger-Luther


    RNA (siRNA treated animals determined that expression of TGFβ family members, including TGF-βRII and Smads 2–4, were significantly downregulated compared to animals at day 9 post-PHx alone or animals that received negative control siRNA. In conclusion, IGFBP-3 may function as a potent chemoattractant of oval cells during specific types of liver regeneration and may be involved in regulating oval cell proliferation and differentiation in vivo via the TGF-β pathway.Keywords: hepatic stem cells, transforming growth factor-beta, N-2-acetylaminofluorene (2AAF, partial hepatectomy (PHx

  12. 76 FR 14421 - Section 8 Housing Assistance Payments Program-Contract Rent Annual Adjustment Factors (AAFs...


    ... rent for a comparable unassisted unit of similar quality, type and age in the market area. 42 U.S.C... the unassisted market. Since HUD pays the full amount of any rent increases for assisted tenants... discount.'' Turnover is lower in assisted properties than in the unassisted market, so the effect of...

  13. Insulin-like growth factor binding protein-3 is required for the regulation of rat oval cell proliferation and differentiation in the 2AAF/PHX model

    Steiger-Luther, Nicole C; Darwiche, Houda; Oh, Seh-Hoon; Williams, Jennifer M.; PETERSEN, BRYON E.


    Oval cell-mediated liver regeneration is a highly complex process that involves the coordination of several signaling factors, chemokines and cytokines to allow for proper maintenance of the liver architecture. When hepatocyte proliferation is inhibited, an hepatic stem cell population, often referred to as “oval cells”, is activated to aid in liver regeneration. The function of insulin-like growth factor binding protein-3 (IGFBP-3) during this process of oval cell activation is of particular...

  14. Influence of an oligodendroglial component on the survival of patients with anaplastic astrocytomas: a report of radiation therapy oncology group 83-02

    Purpose: Seven percent of patients with high grade gliomas enrolled in RTOG 83-02 had mixed astrocytoma/oligodenroglial elements on central pathology review. It has often been assumed that the most aggressive histologic component of a tumor determines biologic behavior; however in this trial, the survival of patients who had mixed glioblastomas/oligodenrogliomas was significantly longer than that of patients with pure glioblastomas (GBM). We therefore evaluated the effect of an oligodendroglial component on the survival of patients who had anaplastic astrocytomas (AAF) treated in the same trial. Methods and Materials: One hundred nine patients who had AAF and 24 patients with mixed AAF/oligodendrogliomas (AAF/OL) were enrolled in a Phase I/II trial of randomized dose-escalation hyper fractioned radiotherapy plus BCNU. AAF/OL patients were older and more likely to have had more aggressive surgery than AAF patients. Other pretreatment characteristics were balanced between groups, as was assigned treatment. Results: The median survival time for AAF was 3.0 years versus 7.3 years for AAF/OL (p = 0.019). In a multivariate analysis, adjusting for extent of surgical resection and age, an oligodendroglial component was an independent prognostic factor for survival. Conclusion: The results support the concept that AAFs with an oligodendroglial component have a better prognosis than pure AAF tumors, similar to the effect seen among patients with glioblastoma multiforme tumors. This better survival outcome should be taken into consideration in the design and stratification of future trials. Additionally, in contrast to patients with GBMs, patients who have AAF/OL have the potential for prolonged survival; therefore, late sequelae of treatment (both radiation and chemotherapy) must be weighed more heavily in the benefits to risks analysis

  15. The effect of activating solution on the mechanical strength, reaction rate, mineralogy, and microstructure of alkali-activated fly ash

    Ma, Y.; Hu. J.; Ye, G.


    Alkali-activated fly ash (AAF) is a promising material that exhibits comparable material properties as cement-based materials but with much less CO2 emission. In the present work, the effect of activating solution (SiO2 and Na2O content) on the performance of AAF was studied by means of isothermal c

  16. NCBI nr-aa BLAST: CBRC-RMAC-18-0006 [SEVENS

    Full Text Available CBRC-RMAC-18-0006 emb|CAB91059.1| NADH dehydrogenase subunit 4 [Drosophila melanogas...ter] gb|AAF77234.1| NADH dehydrogenase subunit 4 [Drosophila melanogaster] gb|AAF77246.1| NADH dehydrogenase subunit 4 [Drosophila melanogaster] CAB91059.1 0.16 26% ...

  17. Bacterial dynamics and metabolite changes in solid-state acetic acid fermentation of Shanxi aged vinegar.

    Li, Sha; Li, Pan; Liu, Xiong; Luo, Lixin; Lin, Weifeng


    Solid-state acetic acid fermentation (AAF), a natural or semi-controlled fermentation process driven by reproducible microbial communities, is an important technique to produce traditional Chinese cereal vinegars. Highly complex microbial communities and metabolites are involved in traditional Chinese solid-state AAF, but the association between microbiota and metabolites during this process are still poorly understood. In this study, we performed amplicon 16S rRNA gene sequencing on the Illumina MiSeq platform, PCR-denaturing gradient gel electrophoresis, and metabolite analysis to trace the bacterial dynamics and metabolite changes under AAF process. A succession of bacterial assemblages was observed during the AAF process. Lactobacillales dominated all the stages. However, Acetobacter species in Rhodospirillales were considerably accelerated during AAF until the end of fermentation. Quantitative PCR results indicated that the biomass of total bacteria showed a "system microbe self-domestication" process in the first 3 days, and then peaked at the seventh day before gradually decreasing until the end of AAF. Moreover, a total of 88 metabolites, including 8 organic acids, 16 free amino acids, and 66 aroma compounds were detected during AAF. Principal component analysis and cluster analyses revealed the high correlation between the dynamics of bacterial community and metabolites. PMID:26754813

  18. Making and monitoring errors based on altered auditory feedback

    Peter ePfordresher


    Full Text Available Previous research has demonstrated that altered auditory feedback (AAF disrupts music performance and causes disruptions in both action planning and the perception of feedback events. It has been proposed that this disruption occurs because of interference within a shared representation for perception and action (Pfordresher, 2006. Studies reported here address this claim from the standpoint of error monitoring. In Experiment 1 participants performed short melodies on a keyboard while hearing no auditory feedback, normal auditory feedback, or alterations to feedback pitch on some subset of events. Participants overestimated error frequency when AAF was present but not for normal feedback. Experiment 2 introduced a concurrent load task to determine whether error monitoring requires executive resources. Although the concurrent task enhanced the effect of AAF, it did not alter participants’ tendency to overestimate errors when AAF was present. A third correlational study addressed whether effects of AAF are reduced for a subset of the population who may lack the kind of perception/action associations that lead to AAF disruption: poor-pitch singers. Effects of manipulations similar to those presented in Experiments 1 and 2 were reduced for these individuals. We propose that these results are consistent with the notion that AAF interference is based on associations between perception and action within a forward internal model of auditory-motor relationships.

  19. The effect of activating solution on the mechanical strength, reaction rate, mineralogy, and microstructure of alkali-activated fly ash

    Ma, Y.; Hu J.; Ye, G.


    Alkali-activated fly ash (AAF) is a promising material that exhibits comparable material properties as cement-based materials but with much less CO2 emission. In the present work, the effect of activating solution (SiO2 and Na2O content) on the performance of AAF was studied by means of isothermal calorimetry and X-ray diffraction analysis. Meanwhile, the pore structure of AAF was examined by mercury intrusion porosimetry combined with environmental scanning electron microscope. The results i...

  20. Annual Adjustment Factors

    Department of Housing and Urban Development — The Department of Housing and Urban Development establishes the rent adjustment factors - called Annual Adjustment Factors (AAFs) - on the basis of Consumer Price...

  1. Dicty_cDB: AFE624 [Dicty_cDB


  2. The tumor-promoting activity of 2-acetylaminofluorene is associated with disruption of the p53 signaling pathway and the balance between apoptosis and cell proliferation

    The aromatic amine 2-acetylaminofluore (2-AAF) is a powerful complete genotoxic rat liver carcinogen that induces tumors without any additional interventions. While the tumor-initiating genotoxic activity of 2-AAF is well established, its tumor-promotion activity is far less understood. It is believed that the tumor-promoting property of 2-AAF is associated with selective enhancement of cell replication and sustained suppression of apoptosis in initiated cells. In the present study, we investigated the underlying mechanisms of tumor-promoting events induced by 2-AAF-exposure. Male Sprague-Dawley rats were fed NIH-31 diet containing 0.02% of 2-AAF for 12 and 24 weeks, and the expression pattern of genes associated with the p53-signaling pathway and microRNA genes was determined in the livers of control and 2-AAF-fed rats. The results indicate that the tumor-promoting property of 2-AAF during hepatocarcinogenesis is associated predominantly with the up-regulation of anti-apoptotic growth-related genes and down-regulation of expression of pro-apoptotic genes. This disrupts the balance between cell proliferation and apoptosis, which leads to consequential unrestricted cell proliferation, especially of initiated cells. Also, the long-term-administration of 2-AAF resulted in disruption of regulatory miR-34a-p53 feed-back loop that mediates apoptosis. This was evidenced by an increased expression of miR-34a in response to genotoxic effects of 2-AAF in the absence of p53 up-regulation, and loss of regulatory control of mir-34a on SIRT1 function. Additionally, the livers of 2-AAF-exposed rats were characterized by the substantial deregulation of expression of miR-18, miR-21, miR-182, and miR-200 family, microRNAs involved in control of apoptosis/cell proliferation and cell-cell contact pathways, two major pathways disrupted during the promotion stage of hepatocarcinogenesis

  3. Dicty_cDB: AFE403 [Dicty_cDB

    Full Text Available URL seq. ID AFE403P (Link to Original site) Representative DNA sequence >AFE403 (AFE403Q) /CSM/AF/AFE4-A/AFE4...APEEHPVLLTEAPLNPKANR EKMTQIMFETFNTPAMYVAIQAVLSLYASG--- ---XLTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHR KCF*tiktsdesas...LYASG--- ---XLTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHR KCF*tiktsdesashtnkyi*mynn Frame C: tik...kqlklvmkvlltqtnifkciii Homology vs CSM-cDNA Score E Sequences producing significa

  4. Tolerance to a new free amino acid-based formula in children with IgE or non-IgE-mediated cow’s milk allergy: a randomized controlled clinical trial

    Berni Canani Roberto


    Full Text Available Abstract Background Amino acid-based formulas (Aaf are increasingly used in children with cow’s milk allergy (CMA. To be labeled hypoallergenic these formulas must demonstrate in clinical studies that they don’t provoke reactions in 90% of subjects with confirmed CMA with 95% confidence when given in prospective randomized, double-blind, placebo-controlled challenge (DBPCFC trials. The majority of available safety data on Aaf derived from patients with IgE-mediated CMA. Considering substantial differences in the immunologic mechanism and clinical presentation of non-IgE-mediated CMA it’s important to investigate the hypoallergenicity of these formulas also in these patients. We prospectively assessed the tolerance to a new commercially available Aaf in children affected by IgE- or non-IgE-mediated CMA. Methods Consecutive patients affected by IgE- or non-IgE-mediated CMA, aged ≤ 4 years, were enrolled. DBPCFC was carried out with increasing doses of the new Aaf (Sineall, Humana, Milan, Italy, using validated Aaf as placebo. Faecal concentrations of calprotectin (FC and eosinophilic cationic protein (ECP were monitored. Results Sixty patients (44 male, 73.3%, median age 37, 95%CI 34.5–39.6 months, IgE-mediated CMA 29, 48.3% were enrolled. At the diagnosis clinical symptoms were gastrointestinal (46.6%, cutaneous (36.6%, respiratory (23.3%, and systemic (10.0%. After DBPCFC with the new Aaf, no patient presented early or delayed clinical reactions. Faecal concentration of calprotectin and of ECP remained stable after the exposure to the new Aaf. Conclusions The new Aaf is well tolerated in children with IgE- or non-IgE-mediated CMA, and it could be used as a safe dietotherapy regimen for children with this condition. Trial registration The trial was registered in the Protocol Registration System (ID number: NCT01622426.

  5. Tolerance to a new free amino acid-based formula in children with IgE or non-IgE-mediated cow’s milk allergy: a randomized controlled clinical trial


    Background Amino acid-based formulas (Aaf) are increasingly used in children with cow’s milk allergy (CMA). To be labeled hypoallergenic these formulas must demonstrate in clinical studies that they don’t provoke reactions in 90% of subjects with confirmed CMA with 95% confidence when given in prospective randomized, double-blind, placebo-controlled challenge (DBPCFC) trials. The majority of available safety data on Aaf derived from patients with IgE-mediated CMA. Considering substantial differences in the immunologic mechanism and clinical presentation of non-IgE-mediated CMA it’s important to investigate the hypoallergenicity of these formulas also in these patients. We prospectively assessed the tolerance to a new commercially available Aaf in children affected by IgE- or non-IgE-mediated CMA. Methods Consecutive patients affected by IgE- or non-IgE-mediated CMA, aged ≤ 4 years, were enrolled. DBPCFC was carried out with increasing doses of the new Aaf (Sineall, Humana, Milan, Italy), using validated Aaf as placebo. Faecal concentrations of calprotectin (FC) and eosinophilic cationic protein (ECP) were monitored. Results Sixty patients (44 male, 73.3%, median age 37, 95%CI 34.5–39.6 months, IgE-mediated CMA 29, 48.3%) were enrolled. At the diagnosis clinical symptoms were gastrointestinal (46.6%), cutaneous (36.6%), respiratory (23.3%), and systemic (10.0%). After DBPCFC with the new Aaf, no patient presented early or delayed clinical reactions. Faecal concentration of calprotectin and of ECP remained stable after the exposure to the new Aaf. Conclusions The new Aaf is well tolerated in children with IgE- or non-IgE-mediated CMA, and it could be used as a safe dietotherapy regimen for children with this condition. Trial registration The trial was registered in the Protocol Registration System (ID number: NCT01622426). PMID:23418822

  6. Total energy of deoxyguanosine bonded to N-2-acetylaminofluorene by the semiempirical modified-neglect of differential diatomic overlap method

    Besson, Morgan


    We have computed the total energy surface as a function of two important torsion angles of the carcinogen N-2-acetylaminofluorene (AAF) bonded to the carbon C8 of deoxyguanosine using the semiempirical quantum mechanical method MNDO. One global minimum and one local minimum are found separated by an appreciable barrier. The equilibrium geometries show the rearrangement of AAF and the base consistent with experimental observations of DNA by previous investigators.

  7. Targeted mutations induced by a single acetylaminofluorene DNA adduct in mammalian cells and bacteria

    Mutagenic specificity of 2-acetylaminofluorene (AAF) has been established in mammalian cells and several strains of bacteria by using a shuttle plasmid vector containing a single N-(deoxyguanosin-8-yl)acetylaminofluorene (C8-dG-AAF) adduct. The nucleotide sequence of the gene conferring tetracycline resistance was modified by conservative codon replacement so as to accommodate the sequence d(CCTTCGCTAC) flanked by two restriction sites, Bsm I and Xho I. The corresponding synthetic oligodeoxynucleotide underwent reaction with 2-(N-acetoxy-N-acetylamino)-fluorene (AAAF), forming a single dG-AAF adduct. This modified oligodeoxynucleotide was hybridized to its complementary strand and ligated between the Bsm I and Xho I sites of the vector. Plasmids containing the C8-dG-AAF adduct were used to transfect simian virus 40-transformed simian kidney (COS-1) cells and to transform several AB strains of Escherichia coli. Colonies containing mutant plasmides were detected by hybridization to 32P-labeled oligodeoxynucleotides. Presence of the single DNA adduct increased the mutation frequency by 8-fold in both COS cells and E. coli. Over 80% of mutations detected in both systems were targeted and represented G x C → C x G or G x C → T x A transversions or single nucleotide deletions. The authors conclude that modification of a deoxyguanosine residue with AAF preferentially induces mutations targeted at this site when a plasmid containing a single C8-dG-AAF adduct is introduced into mammalian cells or bacteria

  8. Effects of 2-acetylaminofluorene, dietary fats and antioxidants on nuclear envelope cytochrome P-450

    Carubelli, R.; Graham, S.A.; Griffin, M.J.; McCay, P.B.


    The authors reported a marked loss of cytochrome P-450 in hepatic nuclear envelope (NE) but not in microsomes of male Sprague-Dawley rats fed a semipurified diet containing 0.05% w/w 2-acetylaminofluorene (AAF) for 3 weeks. This may reflect loss of NE capacity to detoxify AAF metabolites generated by microsomal P-450. They are now investigating if dietary effects such as progressive decrease in the incidence of AAF-induced tumors in rats fed high polyunsaturated fat diet (HPUF) vs. high saturated fat diet (HSF) vs. low fat diet (LF), and the anticarcinogenic activity of butylated hydroxytoluene (BHT; 0.3% w/w) correlate with preservation of NE P-450. Rats fed AAF HSF (25.6% w/w corn oil) showed marked loss of NE P-450 after 3 weeks; BHT protected against this loss. Rats fed AAF in HSF (25.6% w/w; 18 parts beef tallow + 2 parts corn oil), on the other hand, experienced a marked drop in NE P-450 after 9 weeks; BHT protected against this loss. Comparison of NE P-450 levels in control rats fed HPUF or HSF for 3 weeks with those of rats fed a semipurified diet with 10% fat or Purina chow (ca. 5% fat), support the prediction of an inverse correlation between the levels of dietary fat and the NE P-450 content. Studies on AAF and BHT effects using LF (2% w/w corn oil) are in progress.

  9. Cost-effectiveness of using an extensively hydrolyzed casein formula plus the probiotic Lactobacillus rhamnosus GG compared to an extensively hydrolyzed formula alone or an amino acid formula as first-line dietary management for cow’s milk allergy in the US

    Ovcinnikova O


    Full Text Available Olga Ovcinnikova,1 Monica Panca,1 Julian F Guest1,2 1CATALYST Health Economics Consultants, Northwood, London, 2Faculty of Life Sciences and Medicine, King’s College, London, UK Objectives: The aim was to estimate the cost-effectiveness of using an extensively hydrolyzed casein formula (eHCF plus the probiotic Lactobacillus rhamnosus GG (eHCF + LGG; Nutramigen LGG compared to an eHCF alone (Nutramigen and an amino acid formula (AAF; Neocate as first-line dietary management for cow’s milk allergy (CMA in the US. Methods: Using a cohort study design, the analysis was based on the case records of 136 eHCF-fed, 59 eHCF + LGG-fed, and 217 matched AAF-fed infants extracted from the Truven Health MarketScan® Commercial Claims Database (a nationally representative database of the commercially insured population of the US. Clinical outcomes and health care resource use (with corresponding costs at 2012 prices, following first-line dietary management with each formula, were estimated over 12 months from the start of feeding. Differences in infants’ outcomes and resource use between groups were adjusted for any differences in baseline covariates. Results: Infants were <6 months of age at presentation. Fifty-six percent of eHCF + LGG-fed infants were estimated to have been successfully managed by 9 months compared to 38% of eHCF-fed infants and 35% of AAF-fed infants (P<0.05 and P=0.003 respectively. Infants in the AAF group used significantly more health care resources and prescribed drugs than infants in the other two groups. The estimated cost of managing a CMA infant over the first 12 months following the start of feeding was $3,577, $3,781, and $6,255 for an eHCF + LGG-fed, eHCF-fed, and AAF-fed infant, respectively. Parents’ costs accounted for up to 10% of the total costs and the remainder was incurred by insurers. The analyses were robust to plausible changes in all variables. Conclusion: Using real world evidence, initial dietary

  10. Carcinogen-DNA interaction study by base sequence footprinting. Final report, July 1, 1983-June 30, 1986

    Our previous studies on acetylaminofluorene (AAF) modified DNA demonstrated three kinds of structural changes in DNA of defined base sequence. For example, adduct formation by N-Aco-AAF was found at each guanine. We studied the interaction of IgG specific for AAF guanosine in an in vitro system using AAF modified phi X-174 rf DNA. We had expected to find protection against DNAase I digestion. Instead, when the DNA was immunobound to an inert matrix via the IgG, DNAase I digestion was enhanced 20 fold without changing the base sequence pattern of digestion. DNAase I hypersensitive sites are a necessary but not a sufficient condition for transcription. Moreover, some hypersensitive sites are stably propagated, independent of the continued presence of the inducer. Stability of these hypersensitive sites in the absence of their inducer suggests that they can be propagated. It appeared likely that distortion of DNA by a carcinogen adduct such as AAF, and the interaction of this modified DNA with a specific protein such as IgG or cellular proteins might inappropriately enhance the transcription of specific genes. That hypothesis will be tested; surprisingly, little is known about the early action of carcinogens on expression of specific genes. 34 refs., 2 figs., 1 tab

  11. Expression and localization of regenerating gene I in a rat liver regeneration model

    Regenerating gene (Reg) I has been identified as a regenerative/proliferative factor for pancreatic islet cells. We examined Reg I expression in the regenerating liver of a rat model that had been administered 2-acetylaminofluorene and treated with 70% partial hepatectomy (2-AAF/PH model), where hepatocyte and cholangiocyte proliferation was suppressed and the hepatic stem cells and/or hepatic progenitor cells were activated. In a detailed time course study of activation of hepatic stem cells in the 2-AAF/PH model, utilizing immunofluorescence staining with antibodies of Reg I and other cell-type-specific markers, we found that Reg I-expressing cells are present in the bile ductules and increased during regeneration. Reg I-expressing cells were colocalized with CK19, OV6, and AFP. These results demonstrate that Reg I is significantly upregulated in the liver of the 2-AAF/PH rat model, accompanied by the formation of bile ductules during liver regeneration.

  12. Performance analysis of acceleration resolution for radar signal

    赵宏钟; 付强


    The high acceleration of moving targets has brought severe problems in radar signal processing, such as the decrease in output signal-noise-ratio and the deterioration of Doppler resolution. This paper presents an acceleration ambiguity function (AAF) for characterizing the acceleration effects and the acceleration resolution property in radar signal processing. The definition of the acceleration resolution based on AAF is also presented. Using AAF as an analyzing tool, some factors are derived including the loss factor of output SNR, the broadening factor of Doppler resolution, and the optimal accumulative time (OPT) caused by acceleration in linear-phase matched filtering. The convergent property of quadratic-phase matched-filter for searching for and estimating the acceleration is discussed. The results and conclusions are helpful for the quantitative analysis of the acceleration effects on signal processing, and for evaluation of the performance of acceleration in radar signal waveform design.

  13. Carcinogen-DNA interaction study by base sequence footprinting. Progress report, July 1, 1985-January 21, 1986

    Acetyl-aminofluorene (AAF) modified plasmid pSV2 CAT is being studied to learn how the adducts influence expression of chloramphenicol acetyltransferase (CAT) genes. phi X-174 RF DNA exhibits specific base sequence abnormalities induced by the formation of AAF adducts. The DNAase I sensitive state of AAF modified DNA sequences could presumably lead to enhanced expression of genes since it is a well-known characteristic of active or potentially active derepressed genes. DNAase I hypersensitive sites are necessary but not sufficient for transcription. We observed enhanced expression of CAT genes in CV-1 cells after transfection with modified plasmids, using electroporation to introduce the plasmids into the cells. 34 refs., 2 figs

  14. Molecular cloning and characterization of a flavanone 3-Hydroxylase gene from Artemisia annua L.

    Xiong, Shuo; Tian, Na; Long, Jinhua; Chen, Yuhong; Qin, Yu; Feng, Jinyu; Xiao, Wenjun; Liu, Shuoqian


    Flavonoids were found to synergize anti-malaria and anti-cancer compounds in Artemisia annua, a very important economic crop in China. In order to discover the regulation mechanism of flavonoids in Artemisia annua, the full length cDNA of flavanone 3-hydroxylase (F3H) were isolated from Artemisia annua for the first time by using RACE (rapid amplification of cDNA ends). The completed open read frame of AaF3H was 1095 bp and it encoded a 364-amino acid protein with a predicted molecular mass of 41.18 kDa and a pI of 5.67. The recombinant protein of AaF3H was expressed in E. coli BL21(DE3) as His-tagged protein, purified by Ni-NTA agrose affinity chromatography, and functionally characterized in vitro. The results showed that the His-tagged protein (AaF3H) catalyzed naringenin to dihydrokaempferol in the present of Fe(2+). The Km for naringenin was 218.03 μM. The optimum pH for AaF3H reaction was determined to be pH 8.5, and the optimum temperature was determined to be 35 °C. The AaF3H transcripts were found to be accumulated in the cultivar with higher level of flavonoids than that with lower level of flavonoids, which implied that AaF3H was a potential target for regulation of flavonoids biosynthesis in Artemisia annua through metabolic engineering. PMID:27070290

  15. Differences in gene expression profiles in the liver between carcinogenic and non-carcinogenic isomers of compounds given to rats in a 28-day repeat-dose toxicity study.

    Nakayama, Koji; Kawano, Yukiko; Kawakami, Yuuki; Moriwaki, Norichika; Sekijima, Masaru; Otsuka, Masanori; Yakabe, Yoshikuni; Miyaura, Hideki; Saito, Koichi; Sumida, Kayo; Shirai, Tomoyuki


    Some compounds have structural isomers of which one is apparently carcinogenic, and the other not. Because of the similarity of their chemical structures, comparisons of their effects can allow gene expression elicited in response to the basic skeletons of the isomers to be disregarded. We compared the gene expression profiles of male Fischer 344 rats administered by daily oral gavage up to 28 days using an in-house oligo microarray. 2-Acetylaminofluorene (2-AAF), 2,4-diaminotoluene (2,4-DAT), 2-nitropropane (2-NP), and 2-nitro-p-phenylenediamine (2-NpP) are hepatocarcinogenic. However, their isomers, 4-acetylaminofluorene (4-AAF), 2,6-diaminotoluene (2,6-DAT), 1-nitropropane (1-NP), and 4-nitro-o-phenylenediamine (4-NoP), are non-hepatocarcinogenic. Because of the limited carcinogenicity of 2-NpP, we attempted to perform two-parametric comparison analyses with (1) a set of 4 isomers: 2-AAF, 2,4-DAT, 2-NP, and 2-NpP as "carcinogenic", and 4-AAF, 2,6-DAT, 1-NP, and 4-NoP as "non-carcinogenic"; and (2) a set of 3 isomers: 2-AAF, 2,4-DAT, and 2-NP, as "carcinogenic", and 4-AAF, 2,6-DAT, and 1-NP as "non-carcinogenic". After ratio filtering and Welch's approximate t-test analysis, 54 and 28 genes were selected from comparisons between the sets of 3 and 4 isomers, respectively, for day 28 data. Using hierarchical clustering analysis with the 54 or 28 genes, 2-AAF, 2,4-DAT, and 2-NP clustered into a "carcinogenic" branch. 2-NpP was in the same cluster as 4-NoP and 4-AAF. This clustering corresponded to the previous finding that 2-NpP is not carcinogenic in male Fischer 344 rats, which indicates that comparing the differences in gene expression elicited by different isomers is an effective method of developing a prediction system for carcinogenicity. PMID:17070881

  16. Replacing a piece of loop-structure in the substrate-binding groove of Aspergillus usamii β-mannanase, AuMan5A, to improve its enzymatic properties by rational design.

    Dong, Yun Hai; Li, Jian Fang; Hu, Die; Yin, Xin; Wang, Chun Juan; Tang, Shi Han; Wu, Min Chen


    To perfect the enzymatic properties of AuMan5A, a mesophilic glycoside hydrolase (GH) family 5 β-mannanase from Aspergillus usamii, its loop-structure substitution was carried out by rational design and followed by megaprimer PCR. Based on the structural analysis and enzymatic property comparison of various β-mannanases, a piece of loop-structure with seven amino acids between two β-strands (βD and βE) in the substrate-binding groove, named "Loop DE," was speculated to be correlative to the thermostability and catalytic efficiency of GH family 5 β-mannanases. Therefore, three AuMan5A's mutants, AuMan5A-Af, AuMan5A-An, and AuMan5A-Th, were designed by substituting a Loop DE sequence ((316)KSPDGGN(322)) of AuMan5A with the corresponding sequences of other three family 5 β-mannanases, respectively. Then, the mutant-encoding genes, Auman5A-Af, Auman5A-An, and Auman5A-Th, were constructed as designed theoretically and then expressed in Pichia pastoris GS115. The expressed recombinant AuMan5A-Af (re-AuMan5A-Af) displayed the temperature optimum (T opt) of 75 °C, T m value of 76.6 °C and half-life (t 1/2) of 480 min at 70 °C, which were 10 and 12.1 °C higher and 48-fold longer than those of re-AuMan5A, respectively. Its catalytic efficiency (k cat/K m) was 12.7-fold that of re-AuMan5A. What is more, the site-directed mutagenesis of D320G in AuMan5A-Af was performed. The T opt and t 1/2 of expressed re-AuMan5A-Af(D320G) decreased to 70 °C and 40 min, respectively, while its k cat/K m was only 35 % of that of re-AuMan5A-Af. These results demonstrated that the mutation of G320 (in AuMan5A) into D320 (in AuMan5A-Af) through Loop DE substitution was mainly responsible for the thermostability and catalytic efficiency improvement of AuMan5A-Af. PMID:26678079

  17. Arabidopsis CDS blastp result: AK241111 [KOME

    Full Text Available AK241111 J065091A02 At2g04032.1 68415.m00373 metal transporter, putative (ZIP7) identical to put ... psis thaliana] gi|17385788|gb|AAL38434; similar to iron -regulated transporter 1 [Lycopersicon esculentum] ... gi|9716481|gb|AAF97509; similar to root iron ... transporter protein [Pisum sativum] gi|3153889|gb| ...

  18. EST Table: AU002007 [KAIKOcDNA[Archive

    Full Text Available AU002007 mg0315 10/09/28 55 %/139 aa ref|XP_001653426.1| synaptic glycoprotein sc2 [Aedes aegypt ... 7 40 %/142 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ...

  19. 78 FR 22363 - Environmental Impact Statement for the All Aboard Florida Miami-Orlando Passenger Rail Project


    ... be made available through the FRA Web site at and the AAF Web site at www.... 4321 et seq.) (NEPA) and FRA's Procedures for Considering Environmental Impacts (64 FR 28545, May 26... major population, employment, and tourism growth, which is expected to continue in the coming...

  20. NCBI nr-aa BLAST: CBRC-CFAM-09-0036 [SEVENS

    Full Text Available CBRC-CFAM-09-0036 ref|NP_726856.1| dunce CG32498-PN, isoform N [Drosophila melanogaster] sp|Q9W4 ... '-cyclic phosphodiesterase, isoforms N/G (Learning/memory ... process protein) (Protein dunce) gb|AAF45863.2| CG ...

  1. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1975 [SEVENS

    Full Text Available CBRC-MEUG-01-1975 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 0.0 78% ...

  3. NCBI nr-aa BLAST: CBRC-DMEL-06-0010 [SEVENS

    Full Text Available CBRC-DMEL-06-0010 ref|NP_525045.2| pecanex CG3443-PB [Drosophila melanogaster] sp|P...18490|PCX_DROME Protein pecanex gb|AAF45756.2| CG3443-PB [Drosophila melanogaster] NP_525045.2 0.0 95% ...

  4. NCBI nr-aa BLAST: CBRC-PABE-20-0089 [SEVENS

    Full Text Available CBRC-PABE-20-0089 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 9e-07 26% ...

  5. NCBI nr-aa BLAST: CBRC-CFAM-20-0124 [SEVENS

    Full Text Available CBRC-CFAM-20-0124 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 2e-14 29% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-02-0087 [SEVENS

    Full Text Available CBRC-AGAM-02-0087 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 0.006 28% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-05-0030 [SEVENS

    Full Text Available CBRC-AGAM-05-0030 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 5e-08 31% ...

  8. NCBI nr-aa BLAST: CBRC-PMAR-01-0058 [SEVENS

    Full Text Available CBRC-PMAR-01-0058 ref|NP_524253.1| Male -specific RNA 84Dd CG17935-PA [Drosophila melanogaster] s ... p|Q01645|MS84D_DROME Male -specific sperm protein Mst84Dd gb|AAF54026.1| CG17 ...

  9. Detection of DNA adducts in N-acetoxy-2-acetylaminofluorene-treated human fibroblasts by means of immunofluorescence microscopy and quantitative immunoautoradiography

    An immunohistochemical procedure was developed for the detection of adducts in DNA of cultured cells exposed to N-acetoxy-2-acetylaminofluorene (N-AcO-AAF) with the use of antibodies raised in rabbits against N-(guanosin-8-yl)-2-acetyl-aminofluorene (Guo-8-AAF) conjugated to bovine serum albumin. Binding of these antibodies to the nuclear DNA was visualized by means of immunofluorescence microscopy with fluorescein-conjugated anti-rabbit-Ig antibodies, or by means of immunoautoradiography with 125I-labeled protein A. The dose-response curve obtained when the number of autoradiographic grains developed over the nuclei was plotted as a function of the concentration of N-AcO-AAF used to treat the cells, indicated that the extent of specific antibody-binding is determined by the amount of adducts in the cells. DNA modification levels allowing for 20% survival of the cells could be detected with the immunofluorescence technique, while cells exposed to concentrations of N-AcO-AAF resulting in 60% survival were still positive with the immunoautoradiographic method

  10. NCBI nr-aa BLAST: CBRC-AGAM-01-0071 [SEVENS

    Full Text Available CBRC-AGAM-01-0071 ref|NP_476722.1| shotgun CG3722-PA [Drosophila melanogaster] sp|Q...24298|CADE_DROME DE-cadherin precursor (Protein shotgun) gb|AAF46659.1| CG3722-PA [Drosophila melanogaster] NP_476722.1 0.0 40% ...

  11. InterProScan Result: NM_001146251 [KAIKOcDNA[Archive

    Full Text Available NM_001146251 NM_001146251_1_ORF1 0510AAF8B621539F SMART SM00093 SERPIN 1.9000069431...526123E-51 T IPR000215 Protease inhibitor I4, serpin Molecular Function: serine-type endopeptidase inhibitor activity (GO:0004867) ...

  12. NCBI nr-aa BLAST: CBRC-CREM-01-0003 [SEVENS

    Full Text Available CBRC-CREM-01-0003 ref|NP_051147.1| NADH dehydrogenase subunit 2 [Cafeteria roenberg...ensis] gb|AAF05798.1|AF193903_21 NADH dehydrogenase subunit 2 [Cafeteria roenbergensis] NP_051147.1 1e-04 27% ...

  13. NCBI nr-aa BLAST: CBRC-CBRE-01-1180 [SEVENS

    Full Text Available CBRC-CBRE-01-1180 ref|NP_051147.1| NADH dehydrogenase subunit 2 [Cafeteria roenberg...ensis] gb|AAF05798.1|AF193903_21 NADH dehydrogenase subunit 2 [Cafeteria roenbergensis] NP_051147.1 2e-05 24% ...

  14. NCBI nr-aa BLAST: CBRC-DNOV-01-2064 [SEVENS

    Full Text Available CBRC-DNOV-01-2064 ref|NP_051147.1| NADH dehydrogenase subunit 2 [Cafeteria roenberg...ensis] gb|AAF05798.1|AF193903_21 NADH dehydrogenase subunit 2 [Cafeteria roenbergensis] NP_051147.1 0.009 24% ...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-1294 [SEVENS

    Full Text Available CBRC-TTRU-01-1294 ref|NP_051157.1| ATP synthase F0 subunit 6 [Cafeteria] gb|AAF05808.1|AF193903_31 ATP synthase F0 subunit 6 [Cafeteria roenbergensis] NP_051157.1 0.057 29% ...

  16. NCBI nr-aa BLAST: CBRC-DNOV-01-2150 [SEVENS

    Full Text Available CBRC-DNOV-01-2150 ref|NP_051152.1| ribosomal protein S4 [Cafeteria roenbergensis] g...b|AAF05803.1|AF193903_26 ribosomal protein S4 [Cafeteria roenbergensis] NP_051152.1 0.86 27% ...

  17. NCBI nr-aa BLAST: CBRC-DNOV-01-0972 [SEVENS

    Full Text Available CBRC-DNOV-01-0972 ref|NP_051157.1| ATP synthase F0 subunit 6 [Cafeteria] gb|AAF05808.1|AF193903_31 ATP synthase F0 subunit 6 [Cafeteria roenbergensis] NP_051157.1 0.001 29% ...

  18. Repair of DNA lesions induced by ultraviolet irradiation and aromatic amines in normal and repair-deficient human lymphoblastoid cell lines

    Stevnsner, Tinna; Frandsen, Henrik; Autrup, Herman


    (AAF) respectively. The cell line belonging to xeroderma pigmentosum complementation group C (XP-C) removed all three types of damage less efficiently than the normal cell line, but more efficiently than the cell line belonging to xeroderma pigmentosum complementation group D (XP-D). The cell line...

  19. InterProScan Result: AU006297 [KAIKOcDNA[Archive


  20. NCBI nr-aa BLAST: CBRC-AGAM-02-0188 [SEVENS

    Full Text Available CBRC-AGAM-02-0188 ref|NP_649789.1| CG9613-PA [Drosophila melanogaster] sp|Q9VHS7|COQ2_DROME Para ... e--polyprenyltransferase, mitochondrial precursor (PHB :polyprenyltransferase) gb|AAF54222.1| CG9613-PA [D ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-01-0070 [SEVENS

    Full Text Available CBRC-AGAM-01-0070 ref|NP_476722.1| shotgun CG3722-PA [Drosophila melanogaster] sp|Q...24298|CADE_DROME DE-cadherin precursor (Protein shotgun) gb|AAF46659.1| CG3722-PA [Drosophila melanogaster] NP_476722.1 0.0 42% ...

  2. 34 CFR 464.42 - What limit applies to purchasing computer hardware and software?


    ... computer hardware and software? Not more than ten percent of funds received under any grant under this part may be used to purchase computer hardware or software. (Authority: 20 U.S.C. 1208aa(f)) ... 34 Education 3 2010-07-01 2010-07-01 false What limit applies to purchasing computer hardware...

  3. Gene : CBRC-DDIS-01-0132 [SEVENS

    Full Text Available CBRC-DDIS-01-0132 1 B UNKNOWN BCSA_SALTY 9e-24 34% ref|XP_646256.1| cellulose ... synthase [Dictyost ... elium discoideum AX4] gb|AAF00200.1|AF163835_1 cellulose ... synthase [Dictyostelium discoideum] gb|EAL71912.1| ... cellulose ... synthase [Dictyostelium discoideum AX4] 0.0 99% gn ...

  4. Gene : CBRC-ATHA-03-0002 [SEVENS

    Full Text Available CBRC-ATHA-03-0002 3 C UNKNOWN CESA7_ARATH 1e-171 52% ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE- ... LIKE 3); cellulose ... synthase/ transferase, transferring glycosyl group ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ...

  5. Arabidopsis CDS blastp result: AK241162 [KOME

    Full Text Available AK241162 J065116A05 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 2e-11 ...

  6. Arabidopsis CDS blastp result: AK289248 [KOME

    Full Text Available AK289248 J100079D02 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 7e-19 ...

  7. NCBI nr-aa BLAST: CBRC-CELE-01-0000 [SEVENS

    Full Text Available CBRC-CELE-01-0000 ref|NP_490796.2| abnormal cell MIGration ... family member (mig-1) [Caenorhabditis ... ransmembrane receptor gb|AAF60492.1| Abnormal cell migration ... protein 1, isoform a [Caenorhabditis elegans] NP_4 ...

  8. NCBI nr-aa BLAST: CBRC-CBRI-01-0000 [SEVENS

    Full Text Available CBRC-CBRI-01-0000 ref|NP_490796.2| abnormal cell MIGration ... family member (mig-1) [Caenorhabditis ... ransmembrane receptor gb|AAF60492.1| Abnormal cell migration ... protein 1, isoform a [Caenorhabditis elegans] NP_4 ...

  9. Gene : CBRC-CELE-01-0000 [SEVENS

    Full Text Available CBRC-CELE-01-0000 I B Family fz/smo receptors FZD4_CHICK 5e-37 29% ref|NP_490796.2| abnormal cel ... l MIGration ... family member (mig-1) [Caenorhabditis elegans] gb| ... ransmembrane receptor gb|AAF60492.1| Abnormal cell migration ... protein 1, isoform a [Caenorhabditis elegans] 1e-1 ...

  10. Kitchen Appliance Upgrades Improve Water Efficiency at DOD Exchange Facilities: Best Management Practice Case Study #11: Commercial Kitchen Equipment (Brochure)


    The Exchange, formerly the Army and Air Force Exchange Service (AAFES), is a joint military activity and the U.S. Department of Defense?s (DOD) oldest and largest retailer. The Exchange is taking a leadership role in water efficiency improvements in their commercial kitchens by integrating water efficiency concepts into the organization?s overall sustainability plan and objectives.

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-1399 [SEVENS

    Full Text Available CBRC-LAFR-01-1399 ref|NP_274062.1| hypothetical protein NMB1028 [Neisseria meningit...idis MC58] gb|AAF41427.1| conserved hypothetical protein [Neisseria meningitidis MC58] NP_274062.1 1.9 31% ...

  12. NCBI nr-aa BLAST: CBRC-DSIM-03-0004 [SEVENS

    Full Text Available CBRC-DSIM-03-0004 ref|NP_274421.1| hypothetical protein NMB1408 [Neisseria meningit...idis MC58] gb|AAF41770.1| hypothetical protein NMB1408 [Neisseria meningitidis MC58] NP_274421.1 0.62 21% ...

  13. NCBI nr-aa BLAST: CBRC-HSAP-04-0040 [SEVENS

    Full Text Available CBRC-HSAP-04-0040 sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein... (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] gb|AAF42472.1|AF163151_1 dentin sialophosphoprotein precursor [Homo sapiens] Q9NZW4 0.0 93% ...

  14. NCBI nr-aa BLAST: CBRC-PMAR-01-0431 [SEVENS

    Full Text Available CBRC-PMAR-01-0431 sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein... (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] gb|AAF42472.1|AF163151_1 dentin sialophosphoprotein precursor [Homo sapiens] Q9NZW4 1e-157 47% ...

  15. NCBI nr-aa BLAST: CBRC-DDIS-02-0178 [SEVENS

    Full Text Available CBRC-DDIS-02-0178 sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein... (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] gb|AAF42472.1|AF163151_1 dentin sialophosphoprotein precursor [Homo sapiens] Q9NZW4 1e-119 32% ...

  16. NCBI nr-aa BLAST: CBRC-RMAC-05-0016 [SEVENS

    Full Text Available CBRC-RMAC-05-0016 sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein... (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] gb|AAF42472.1|AF163151_1 dentin sialophosphoprotein precursor [Homo sapiens] Q9NZW4 0.0 83% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-04-0027 [SEVENS

    Full Text Available CBRC-AGAM-04-0027 ref|NP_611385.1| Juvenile hormone epoxide ... hydrolase 1 CG15101-PA [Drosophila m ... ogaster] gb|AAM88327.1|AF517545_1 juvenile hormone epoxide ... hydrolase I [Drosophila melanogaster] gb|AAF57622. ...

  18. 32 CFR Appendix F to Part 516 - Glossary


    ... Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY AID OF CIVIL AUTHORITIES AND PUBLIC RELATIONS LITIGATION Pt. 516, App. F Appendix F to Part 516—Glossary Abbreviations AAFES: Army and Air Force...: Armed Services Board of Contract Appeals AUSA: Assistant United States Attorney CFR: Code of...

  19. Real-time dosimeter employed to evaluate the half-value layer in CT.

    McKenney, Sarah E; Seibert, J Anthony; Burkett, George W; Gelskey, Dale; Sunde, Paul B; Newman, James D; Boone, John M


    Half-value layer (HVL) measurements on commercial whole body computer tomography (CT) scanners require serial measurements and, in many institutions, the presence of a service engineer. An assembly of aluminum filters (AAF), designed to be used in conjunction with a real-time dosimeter, was developed to provide estimates of the HVL using clinical protocols. Two real-time dose probes, a solid-state and air ionization chamber, were examined. The AAF consisted of eight rectangular filters of high-purity aluminum (Type 1100), symmetrically positioned to form a cylindrical 'cage' around the probe's detective volume. The incident x-ray beam was attenuated by varying thicknesses of aluminum filters as the gantry completed a minimum of one rotation. Measurements employing real-time chambers were conducted both in service mode and with a routine abdomen/pelvis protocol for several combinations of x-ray tube potentials and bow tie filters. These measurements were validated against conventional serial HVL measurements. The average relative difference between the HVL measurements using the two methods was less than 5% when using a 122 mm diameter AAF; relative differences were reduced to 1.1% when the diameter was increased to 505 mm, possibly due to reduced scatter contamination. Use of a real-time dose probe and the AAF allowed for time-efficient measurements of beam quality on a clinical CT scanner using clinical protocols. PMID:24351935

  20. The experience of agency in sequence production with altered auditory feedback.

    Couchman, Justin J; Beasley, Robertson; Pfordresher, Peter Q


    When speaking or producing music, people rely in part on auditory feedback - the sounds associated with the performed action. Three experiments investigated the degree to which alterations of auditory feedback (AAF) during music performances influence the experience of agency (i.e., the sense that your actions led to auditory events) and the possible link between agency and the disruptive effect of AAF on production. Participants performed short novel melodies from memory on a keyboard. Auditory feedback during performances was manipulated with respect to its pitch contents and/or its synchrony with actions. Participants rated their experience of agency after each trial. In all experiments, AAF reduced judgments of agency across conditions. Performance was most disrupted (measured by error rates and slowing) when AAF led to an ambiguous experience of agency, suggesting that there may be some causal relationship between agency and disruption. However, analyses revealed that these two effects were probably independent. A control experiment verified that performers can make veridical judgments of agency. PMID:22056210

  1. NCBI nr-aa BLAST: CBRC-OSAT-02-0045 [SEVENS

    Full Text Available CBRC-OSAT-02-0045 gb|AAF81343.1|AC007767_23 Contains similarit y to a peptide transport protein h ... from Arabidopsis thaliana BAC F17L22 gb|AL035527. It ... contains a POT family domain PF|00854. ESTs gb|BE0 ...

  2. NCBI nr-aa BLAST: CBRC-ATHA-01-0053 [SEVENS

    Full Text Available CBRC-ATHA-01-0053 ref|NP_177332.1| MATE efflux family protein [Arabidopsis thaliana] gb|AAF43240 ... .1|AC012654_24 Contains similarit y to the ZF14 mRNA from Arabidopsis thaliana gb|AB0 ... 28198; It ... is a member of the uncharacterized membrane protei ...

  3. NCBI nr-aa BLAST: CBRC-CBRI-01-0000 [SEVENS

    Full Text Available CBRC-CBRI-01-0000 ref|NP_001021744.1| abnormal cell MIGration family member (mig-1)... [Caenorhabditis elegans] gb|AAF60493.1| Abnormal cell migration protein 1, isoform b [Caenorhabditis elegans] NP_001021744.1 0.0 76% ...

  4. NCBI nr-aa BLAST: CBRC-CELE-01-0000 [SEVENS

    Full Text Available CBRC-CELE-01-0000 ref|NP_001021744.1| abnormal cell MIGration family member (mig-1)... [Caenorhabditis elegans] gb|AAF60493.1| Abnormal cell migration protein 1, isoform b [Caenorhabditis elegans] NP_001021744.1 1e-95 87% ...

  5. EST Table: DC535792 [KAIKOcDNA[Archive

    Full Text Available DC535792 E_FL_MFB-_03L23_F_0 10/09/28 88 %/137 aa ref|NP_001037074.2| hemolymph ... juvenile hormone ... ing protein [Bombyx mori] gb|AAF19268.1|AF098305_1 hemolymph ... juvenile hormone binding protein precursor [Bombyx ...

  6. EST Table: NM_001043609 [KAIKOcDNA[Archive

    Full Text Available NM_001043609 hJHBP 10/09/29 93 %/243 aa ref|NP_001037074.2| hemolymph ... juvenile hormone binding p ... rotein [Bombyx mori] gb|AAF19268.1|AF098305_1 hemolymph ... juvenile hormone binding protein precursor [Bombyx ...

  7. Anti-inflammatory effect of 3-O-[(6'-O-palmitoyl)-β-D-glucopyranosyl sitosterol] from Agave angustifolia on ear edema in mice.

    Hernández-Valle, Elizabeth; Herrera-Ruiz, Maribel; Salgado, Gabriela Rosas; Zamilpa, Alejandro; Ocampo, Martha Lucia Arenas; Aparicio, Antonio Jiménez; Tortoriello, Jaime; Jiménez-Ferrer, Enrique


    In Mexico Agave angustifolia has traditionally been used to treat inflammation. The aim of this study was to measure the anti-inflammatory effect of the extract of A. angustifolia, the isolation and identification of active compounds. From the acetone extract two active fractions were obtained, (AsF13 and AaF16). For the characterization of pharmacological activity, the acute inflammatory model of mouse ear edema induced with TPA was used. The tissue exposed to TPA and treatments were subjected to two analysis, cytokine quantification (IL-1β, IL-6, IL-10 and TNF-α) and histopathological evaluation. The active fraction (AaF16) consisted principally of 3-O-[(6'-O-palmitoyl)-β-D-glucopyranpsyl] sitosterol. In AaF13 fraction was identified β-sitosteryl glucoside (2) and stigmasterol (3). The three treatments tested showed a concentration-dependent anti-inflammatory effect (AaAc Emax = 33.10%, EC50 = 0.126 mg/ear; AaF13 Emax = 54.22%, EC50 = 0.0524 mg/ear; AaF16 Emax = 61.01%, EC50 = 0.050 mg/ear). The application of TPA caused a significant increase on level of IL-1β, IL-6 and TNFα compared with basal condition, which was countered by any of the experimental treatments. Moreover, the experimental treatments induced a significant increase in the levels of IL-4 and IL-10, compared to the level observed when stimulated with TPA. Therefore, the anti-inflammatory effect of Agave angustifolia, is associated with the presence of 3-O-[(6'-O-palmitoyl)-β-D-glucopyranosyl] sitosterol. PMID:25268718

  8. Anti-Inflammatory Effect of 3-O-[(6'-O-Palmitoyl-β-D-glucopyranosyl Sitosterol] from Agave angustifolia on Ear Edema in Mice

    Elizabeth Hernández-Valle


    Full Text Available In Mexico Agave angustifolia has traditionally been used to treat inflammation. The aim of this study was to measure the anti-inflammatory effect of the extract of A. angustifolia, the isolation and identification of active compounds. From the acetone extract two active fractions were obtained, (AsF13 and AaF16. For the characterization of pharmacological activity, the acute inflammatory model of mouse ear edema induced with TPA was used. The tissue exposed to TPA and treatments were subjected to two analysis, cytokine quantification (IL-1β, IL-6, IL-10 and TNF-α and histopathological evaluation. The active fraction (AaF16 consisted principally of 3-O-[(6'-O-palmitoyl-β-D-glucopyranpsyl] sitosterol. In AaF13 fraction was identified β-sitosteryl glucoside (2 and stigmasterol (3. The three treatments tested showed a concentration-dependent anti-inflammatory effect (AaAc Emax = 33.10%, EC50 = 0.126 mg/ear; AaF13 Emax = 54.22%, EC50 = 0.0524 mg/ear; AaF16 Emax = 61.01%, EC50 = 0.050 mg/ear. The application of TPA caused a significant increase on level of IL-1β, IL-6 and TNFα compared with basal condition, which was countered by any of the experimental treatments. Moreover, the experimental treatments induced a significant increase in the levels of IL-4 and IL-10, compared to the level observed when stimulated with TPA. Therefore, the anti-inflammatory effect of Agave angustifolia, is associated with the presence of 3-O-[(6'-O-palmitoyl-β-D-glucopyranosyl] sitosterol.

  9. Deeper insights into PCBs in orcas

    Dietz, Rune; Eulaers, Igor; Desforges, Jean-Pierre;


    Having read the recent article by Jepson and Law (DOI: 10.1126/science.aaf9075) we want to emphasise the worrying nature of the fact that at present many marine apex predators, including killer whales, remain highly polluted with PCBs despite world-wide initiatives over past decades to restrict t...... whales are excellent marine sentinel species, indicating that not one nation can address the persistent threat that is environmental PCB pollution. We believe the choice for international PCB mitigation is timely in order to not lose this canary in the coalmine.......Having read the recent article by Jepson and Law (DOI: 10.1126/science.aaf9075) we want to emphasise the worrying nature of the fact that at present many marine apex predators, including killer whales, remain highly polluted with PCBs despite world-wide initiatives over past decades to restrict the...

  10. Engineering of spin filtering in double epitaxial tunnel junctions

    Double-barrier fully epitaxial crystalline magnetic tunnel junctions employing a class of artificial antiferromagnetic (AAF) subsystem are elaborated by molecular-beam epitaxy. Our specific AAF subsystem is constituted by an Fe(10 nm)/MgO(0.7 nm)/Fe(20 nm) trilayer stack where the antiferromagnetic coupling between the two Fe layers occurs by spin-polarized tunneling of electrons across the three, atomic-layer thin MgO insulating barrier. In our junctions, the efficiency of spin filtering is validated by the tunnel magnetoresistance effects of about 140% at room temperature and a high output voltage up to 500 mV at 1.3 V

  11. Puesta a punto e interpretación de la aspiración con aguja fina en el diagnóstico de hiperplasia prostática y prostatitis crónica canina

    González, Griselda; Maffrand, C.; Guendulain, Corina F.; Otegui, F.; Gobello, Cristina


    La hiperplasia prostática benigna (HPB) y sus complicaciones infecciosas son las enfermedades prostáticas más prevalentes en perros de edad avanzada. Aunque la biopsia ofrece el diagnóstico definitivo, la aspiración con aguja fina (AAF) con guía ecográfica es una herramienta rápida y segura para el diagnóstico citológico presuntivo de las alteraciones prostáticas. El objetivo del presente trabajo fue poner a punto la técnica de AAF prostática ecodirigida y la interpretación del material obten...

  12. First Study Of HEPA Filter Prototype Performance To Control The Airborne Pollution

    This paper will report the efficiency test result of the filtration tool prototype of High Efficiency Particulate Air (HEPA filter) for low temperature, to control the airborne pollution of aerosol particle of solid and liquid. The prototype design of HEPA filter was based on the characteristic data of filter material (fibrous diameter, density, filter thickness), flow rate of air and first pressure drop. From the result of laboratory scale test, using DOP/PSL aerosol with 0,3 mum diameter and the flow rate of 3,78 m exp.3/min, was obtained filtration efficiency revolve between 89,90 and 99,94 % for the filter prototype of A, B, C, and D. the efficiency estimation of theory with filtration programme and the experiment was different amount 1 %. The value of the prototype efficiency of D filter was not far different with AAF-USA filter and its price is cheaper 30 % than the price of AAF-USA filter

  13. Arylamine-DNA adducts in vitro and in vivo: their role in bacterial mutagenesis and urinary bladder carcinogenesis

    Beland, Frederick A.; Beranek, David T.; Dooley, Kenneth L.; Heflich, Robert H; Kadlubar, Fred F.


    Hepatic N-oxidation, followed by N-glucuronidation, has been proposed as a route of metabolic activation for arylamine bladder carcinogens. It is postulated that the N-glucuronides are transported to the bladder lumen where they are hydrolyzed under slightly acidic conditions to release direct-acting carcinogenic and mutagenic N-hydroxyarylamines. In this study, 4-aminobiphenyl (ABP), 1-naphthylamine (1-NA), 2-naphthylamine (2-NA), 2-acetylaminofluorene (AAF), 4-nitrobiphenyl (NBP), benzidine...

  14. EST Table: FY020030 [KAIKOcDNA[Archive

    Full Text Available FY020030 rbmov26m08 11/11/04 73 %/182 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pisum] 11/11 ... 4 67 %/174 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 74 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  15. A Reconfigurable Radio Architecture for Cognitive Radio in Emergency Networks

    Zhang, Qiwei; Kokkeler, Andre B.J.; Smit, Gerard J.M.


    Cognitive Radio has been proposed as a promising technology to solve today's spectrum scarcity problem. Cognitive Radio is able to sense the spectrum to find the free spectrum, which can be optimally used by Cognitive Radio without causing interference to the licensed user. In the scope of the Adaptive Adhoc Freeband (AAF) project, an emergency network built on top of Cognitive Radio is proposed. New functional requirements and system specifications for Cognitive Radio have to be supported by...

  16. Some ozone advanced oxidation processes to improve the biological removal of selected pharmaceutical contaminants from urban wastewater

    Espejo, Azahara; Aguinaco, Almudena; Amat Payá, Ana María; Fernando J. Beltrán


    Removal of nine pharmaceutical compounds¿acetaminophen (AAF), antipyrine (ANT), caffeine (CAF), carbamazepine (CRB), diclofenac (DCF), hydrochlorothiazide (HCT), ketorolac (KET), metoprolol (MET) and sulfamethoxazole (SMX)¿spiked in a primary sedimentation effluent of a municipal wastewater has been studied with sequential aerobic biological and ozone advanced oxidation systems. Combinations of ozone, UVA black light and Fe(III) or Fe3O4 constituted the chemical systems. During the ...

  17. Loss of ICG uptake in the process of rat hepatocarcinogenesis correlates to the disappearance of glutathione-S-transferase alpha subunit.

    Ling, Liu; Higashi,Toshihiro; Tsuchida, Shigeki; Sato, Kiyomi; Tsuji, Takao


    Reduced indocyanine green (ICG) uptake is one of the functional changes of human hepatocellular carcinoma (HCC). To clarify the mechanisms of loss of ICG uptake, and determine which subunit of glutathione-S-transferase (GST), alpha or pi, plays a role in ICG transport in hepatocytes, an experimental HCC model was developed that used nodules induced by 2-acetylamino-fluorene (2-AAF) administration. Many of the ICG stained nodules, which consisted of benign and borderline lesions, were GST-alph...

  18. EST Table: FS730102 [KAIKOcDNA[Archive

    Full Text Available FS730102 E_FL_bmmt_17O20_F_0 10/09/28 75 %/142 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/09/03 75 %/142 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 bmmt ...

  19. EST Table: BY922941 [KAIKOcDNA[Archive

    Full Text Available BY922941 E_EL_ovS0_23G12_F_0 10/09/28 66 %/206 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/08/29 66 %/206 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 ovS0 ...

  20. EST Table: FS760443 [KAIKOcDNA[Archive

    Full Text Available FS760443 E_FL_fcaL_14G03_F_0 10/09/28 66 %/220 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/09/08 66 %/220 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 fcaL ...

  1. EST Table: DC558789 [KAIKOcDNA[Archive

    Full Text Available DC558789 E_FL_wd--_19N19_F_0 10/09/28 72 %/118 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/09/02 72 %/118 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 wd-- ...

  2. EST Table: FY748353 [KAIKOcDNA[Archive

    Full Text Available FY748353 E_FL_famL_37N10_F_0 11/11/04 65 %/226 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 11/11/04 65 %/226 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 famL ...

  3. EST Table: FS760916 [KAIKOcDNA[Archive

    Full Text Available FS760916 E_FL_fcaL_15N11_F_0 10/09/28 65 %/226 aa ref|NP_726360.3| egalitarian ... [Drosophila melan ... ogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/09/08 65 %/226 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 fcaL ...

  4. EST Table: FS766799 [KAIKOcDNA[Archive

    Full Text Available FS766799 E_FL_fcaL_44A12_F_0 11/12/09 n.h 10/09/28 64 %/225 aa ref|NP_726360.3| egalitarian ... [Dro ... sophila melanogaster] gb|AAF47054.4| egalitarian ... [Drosophila melanogaster] 10/09/08 64 %/225 aa FBp ... gi|91084227|ref|XP_969046.1| PREDICTED: similar to egalitarian ... CG4051-PA [Tribolium castaneum] FS766799 fcaL ...

  5. 環境財務会計: 制度会計領域における環境関連事象の取扱い

    赤塚, 尚之


    The purpose of this paper is to review current accounting treatments for environmental issues todevelop “environmental financial accounting” by mainly referring authoritative documents issued byCICA, AAF, ICAEW, FEE, EU Recommendation, accounting standards issued by FASB and IASB (including some interpretations by EITF, IFRIC, and AICPA), and some previous articles and books related to this topic. Issues addressed in this paper are: (1)boundaries of private environmental costs, (2)definition ...

  6. Effect of Boschniakia rossica on expression of GST-P, p53 and p21(ras)proteins in early stage of chemical hepatocarcinogenesis and its anti-inflammatory activities in rats.

    Yin, Zong-Zhu; Jin, Hai-Ling; Yin, Xue-Zhe; Li, Tian-Zhu; Quan, Ji-Shu; Jin, Zeng-Nan


    AIM:To investigate the effect of Boschniakia rossica (BR) extract on expression of GST-P, p53 and p21(ras) proteins in early stage of chemical hepatocarcinogenesis in rats and its anti-inflammatory activities.METHODS:The expression of tumor marker-placental form glutathione S-transferase (GST-P), p53 and p21(ras) proteins were investigated by immunohisto-chemical techniques and ABC method. Anti-inflammatory activities of BR were studied by xylene and croton oil-induced mouse ear edema, carrageenin, histamine and hot scald-induced rat pow edema, adjuvant-induced rat arthritis and cotton pellet induced mouse granuloma formation methods.RESULTS:The 500mg/kg of BR-H2O extract frac-tionated from BR-Methanol extract had inhibitory effect on the formation of DEN-induced GST-P-positive foci in rat liver (GST-P staining was 78% positive in DEN+AAF group vs 20% positive in DEN+AAF+BR group, P<0.05) and the expression of mutant p53 and p21(ras) protein was lower than that of hepatic preneoplastic lesions (33% and 22% positive respectively in DEN+AAF group vs negative in DEN+AAF+BR group). Both CH(2)Cl(2) and H(2)O extracts from BR had anti-inflamatory effect in xylene and crotonoil induced mouse ear edema (inhibitory rates were 26%-29% and 35%-59%, respectively). BR H(2)O extract exhibited inhibitory effect in carrageenin, histamine and hot scald-induced hind paw edema and adjuvant-induced arthritis in rats and cotton pellet-induced granuloma formation in mice.CONCLUSION:BR extract exhibited inhibitory effect on formation of preneoplastic hepatic foci in early stage of rat chemical hepato-carcinogenesis.Both CH(2)Cl(2) and H(2)O extracts from BR exerted anti-inflammatory effect in rats and mice. PMID:11819701

  7. Exploring flavour-producing core microbiota in multispecies solid-state fermentation of traditional Chinese vinegar

    Zong-Min Wang; Zhen-Ming Lu; Jin-Song Shi; Zheng-Hong Xu


    Multispecies solid-state fermentation (MSSF), a natural fermentation process driven by reproducible microbiota, is an important technique to produce traditional fermented foods. Flavours, skeleton of fermented foods, was mostly produced by microbiota in food ecosystem. However, the association between microbiota and flavours and flavour-producing core microbiota are still poorly understood. Here, acetic acid fermentation (AAF) of Zhenjiang aromatic vinegar was taken as a typical case of MSSF....

  8. Gene : CBRC-FRUB-02-0231 [SEVENS

    Full Text Available CBRC-FRUB-02-0231 UN A Opsins OPSG_ORYLA 1e-160 76% ref|NP_001028884.1| green ... opsin [Takifugu ru ... bripes] gb|AAF44648.1|AF226989_1 green ... opsin [Takifugu rubripes] 0.0 100% gnl|UG|Tru#S214 ... 58670 Takifugu rubripes green ... opsin mRNA, complete cds /cds=p(47,1105) /gb=AF226 ...

  9. Altered Sensory Feedbacks in Pianist's Dystonia: the altered auditory feedback paradigm and the glove effect

    Felicia Pei-Hsin Cheng


    Full Text Available Background: This study investigates the effect of altered auditory feedback (AAF in musician's dystonia (MD and discusses whether altered auditory feedback can be considered as a sensory trick in MD. Furthermore, the effect of AAF is compared with altered tactile feedback, which can serve as a sensory trick in several other forms of focal dystonia. Methods: The method is based on scale analysis (Jabusch et al. 2004. Experiment 1 employs synchronization paradigm: 12 MD patients and 25 healthy pianists had to repeatedly play C-major scales in synchrony with a metronome on a MIDI-piano with 3 auditory feedback conditions: 1. normal feedback; 2. no feedback; 3. constant delayed feedback. Experiment 2 employs synchronization-continuation paradigm: 12 MD patients and 12 healthy pianists had to repeatedly play C-major scales in two phases: first in synchrony with a metronome, secondly continue the established tempo without the metronome. There are 4 experimental conditions, among them 3 are the same altered auditory feedback as in Experiment 1 and 1 is related to altered tactile sensory input. The coefficient of variation of inter-onset intervals of the key depressions was calculated to evaluate fine motor control. Results: In both experiments, the healthy controls and the patients behaved very similarly. There is no difference in the regularity of playing between the two groups under any condition, and neither did AAF nor did altered tactile feedback have a beneficial effect on patients’ fine motor control. Conclusions: The results of the two experiments suggest that in the context of our experimental designs, AAF and altered tactile feedback play a minor role in motor coordination in patients with musicians' dystonia. We propose that altered auditory and tactile feedback do not serve as effective sensory tricks and may not temporarily reduce the symptoms of patients suffering from MD in this experimental context.

  10. Compound list: acetamidofluorene [Open TG-GATEs

    Full Text Available acetamidofluorene AAF 00144 ftp...:// ...

  11. Alternative aircraft anti-icing formulations with reduced aquatic toxicity and biochemical oxygen demand

    Gold, Harris; Joback, Kevin; Geis, Steven; Bowman, George; Mericas, Dean; Corsi, Steven R.; Ferguson, Lee


    The current research was conducted to identify alternative aircraft and pavement deicer and anti-icer formulations with improved environmental characteristics compared to currently used commercial products (2007). The environmental characteristics of primary concern are the biochemical oxygen demand (BOD) and aquatic toxicity of the fully formulated products. Except when the distinction among products is necessary for clarity, “deicer” will refer to aircraft-deicing fluids (ADFs), aircraft anti-icing fluids (AAFs), and pavementdeicing materials (PDMs).

  12. Mutagenesis by site-specific arylamine adducts in plasmid DNA: Enhancing replication of the adducted strand alters mutation frequency

    Site specifically modified plasmids were used to determine the mutagenic effects of single arylamine adducts in bacterial cells. A synthetic heptadecamer bearing a single N-(guanin-8-yl)-2-aminofluorene (AF) or N-(guanin-8-yl)-2-(acetylamino)fluorene (AAF) adduct was used to introduce the adducts into a specific site in plasmid DNA that contained a 17-base single-stranded region complementary to the modified oligonucleotide. Following transformation of bacterial cells with the adduct-bearing DNA, putative mutants were detected by colony hybridization techniques that allowed unbiased detection of all mutations at or near the site of the adduct. The site-specific AF or AAF adducts were also placed into plasmid DNA that contained uracil residues on the strand opposite that bearing the lesions. The presence of uracil in one strand of the DNA decreases the ability of the bacterial replication system to use the uracil-containing strand, thereby favoring the use of the strand bearing the adducts. In a comparison of the results obtained with site specifically modified DNA, either with or without uracil, the presence of the uracil increased the mutation frequencies of the AF adduct by >7-fold to 2.9% and of the AAF adduct by >12-fold to 0.75%. The AF adduct produced primarily single-base deletions in the absence of uracil but only base substitutions in the uracil-containing constructs. The AAF adduct produced mutations only in the uracil-containing DNA, which included both frame shifts and base substitutions. Mutations produced by both adducts were SOS dependent

  13. NCBI nr-aa BLAST: CBRC-OSAT-12-0025 [SEVENS

    Full Text Available CBRC-OSAT-12-0025 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  14. NCBI nr-aa BLAST: CBRC-ATHA-01-0023 [SEVENS

    Full Text Available CBRC-ATHA-01-0023 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  15. NCBI nr-aa BLAST: CBRC-OSAT-10-0021 [SEVENS

    Full Text Available CBRC-OSAT-10-0021 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  16. NCBI nr-aa BLAST: CBRC-ATHA-05-0009 [SEVENS

    Full Text Available CBRC-ATHA-05-0009 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  17. NCBI nr-aa BLAST: CBRC-OSAT-06-0033 [SEVENS

    Full Text Available CBRC-OSAT-06-0033 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  18. NCBI nr-aa BLAST: CBRC-ATHA-03-0002 [SEVENS

    Full Text Available CBRC-ATHA-03-0002 ref|NP_186955.1| CSLD3 (CELLULOSE ... SYNTHASE-LIKE 3); cellulose ... synthase/ transf ... opsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose ... synthase catalytic subunit [Arabidopsis thaliana] ... gb|AAG60543.1|AF232907_1 cellulose ... synthase-like CSLD3 [Arabidopsis thaliana] gb|AAK2 ...

  19. AM1 study of N-2-acetylaminofluorene bonded to deoxyguanosine at the minor adduct site

    Besson, Morgan


    We have computed the total energy as a function of six important torsion angles of the carcinogen N-2-acetylaminofluorene (AAF) bonded to the nitrogen N2 of deoxyguanosine using the semiempirical quantum mechanical method AM1. One global minimum and one local minimum are found separated by a modest barrier. We have computed the normal-mode frequencies of the relevant torsional motions and have determined the rate of conversion between the two minima.

  20. Evaluation of Propineb, a dithiocarbamate pesticide, in the mouse-sperm morphology assay.

    Quinto, I; De Marinis, E


    Propineb, a dithiocarbamate fungicide, was studied by using the sperm morphology assay in (C57BL6 male X C3H female) F1 mice. At all dose levels, no statistically significant increase in the percentage of sperm abnormalities was observed. Methyl methanesulfonate (MMS) and 2-acetylaminofluorene (2-AAF), which were tested as positive controls, induced a dose-effect-related increase in teratospermia. PMID:6656825

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1243 [SEVENS

    Full Text Available CBRC-MEUG-01-1243 ref|NP_172195.1| MAPKKK13; ATP binding / kinase/ protein kinase/ protein serin ... thaliana] gb|AAF82205.1|AC067971_13 Strong similarit y to a protein kinase homolog F23F1.4 gi|7488253 fr ... om Arabidopsis thaliana BAC F23F1 gb|AC004680. It ... contains a eukaryotic protein kinase domain PF|000 ...

  2. Gene : CBRC-ATHA-01-0053 [SEVENS

    Full Text Available CBRC-ATHA-01-0053 1 D UNKNOWN TT12_ARATH 2e-27 24% ref|NP_177332.1| MATE efflux family protein [ ... haliana] gb|AAF43240.1|AC012654_24 Contains similarit y to the ZF14 mRNA from Arabidopsis thaliana gb|AB0 ... 28198; It ... is a member of the uncharacterized membrane protei ... en=1533 0.0 100% MEDKIQSDDFTSHKNPTLPQVIEELKELWAMVLPIT AMNCLVYVRAVVSVLFLGRLGSLELAGGALSIGFTNIT GYSVMVGLASGLE ... VCSQAYGSKNWDLLTLSLHRMVVILLMASLPISLLWINLGPIMLFMGQNPEIT ATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCTLAAVAFHVPLN ...

  3. Tripeptidyl Peptidase II Promotes Maturation of Caspase-1 in Shigella flexneri-Induced Macrophage Apoptosis

    Hilbi, Hubert; Puro, Robyn J.; Zychlinsky, Arturo


    The invasive enteropathogenic bacterium Shigella flexneri activates apoptosis in macrophages. Shigella-induced apoptosis requires caspase-1. We demonstrate here that tripeptidyl peptidase II (TPPII), a cytoplasmic, high-molecular-weight protease, participates in the apoptotic pathway triggered by Shigella. The TPPII inhibitor Ala-Ala-Phe-chloromethylketone (AAF-cmk) and clasto-lactacystin β-lactone (lactacystin), an inhibitor of both TPPII and the proteasome, protected macrophages from Shigel...

  4. Bronze Civilization Shines Asia Art Festival

    Hu Chunliang


    @@ The 11th Asia Arts Festival (AAF) was held from August 18 through 26, 2009 in Ordos, a city in the northern China's Inner Mongolia autonomous region. This event was jointly sponsored by the Ministry of Culture of the People's Republic of China and the People's Government of Inner Mongolia Autonomous Region, and organized by the Ordos Municipal People's Government, Culture Department of Inner Mongolia Autonomous Region and China Arts and Entertainment Group.

  5. Use of ARM Mobile Facility (AMF) Data to Study Aerosol Indirect Effects in China

    Li, Zhanqing [Univ. of Maryland, College Park, MD (United States)


    General goals: 1) Facilitating the deployment of the ARM Mobile Facility (AMF) and Ancillary Facility (AAF) in China in 2008, 2) Processing, retrieving, improving and analyzing observation data from ground-based, air-borne and space-borne instruments; 3) Conducting a series of studies to gain insights into the direct and indirect effects of these aerosols on radiation, clouds, and precipitation using both

  6. Comparison between the Effect of Soybean and Goat’s Milk on Tumor-Marker Enzyme Activities During Hepatocarcinogenesis in Rats

    Rahmat, Asmah; Seam, Chin Kam; Endrini, Susi; Mansor, Siti Muskinah Hj.


    Milk is a physiological fluid which has high nutritional value and soybean has strong antioxidant characteristics which is believed to inhibit carcinogenesis. The objective of this study was to investigate the effects of administration of soybean and goat’s milk on hepatocarcinogenesis in rats (fed with diethylnitrosamine; DEN and acetylaminofluorene; AAF) by determining the activities of plasma gamma-glutamyl transpeptidase (GGT) and alkaline phosphatase (ALP). Thirty-six rats from the speci...

  7. NCBI nr-aa BLAST: CBRC-MDOM-02-0047 [SEVENS

    Full Text Available CBRC-MDOM-02-0047 sp|Q9N1U2|HSP76_SAGOE RecName: Full=Heat shock 70 kDa protein 6; AltName: Full ... =Hsp-70-related intracellular vitamin ... D-binding protein gb|AAF66617.1|AF142572_1 hsp-70- ... related intracellular vitamin ... D binding protein [Saguinus oedipus] Q9N1U2 0.0 82 ...

  8. NCBI nr-aa BLAST: CBRC-STRI-01-2091 [SEVENS

    Full Text Available CBRC-STRI-01-2091 sp|Q9N1U2|HSP76_SAGOE RecName: Full=Heat shock 70 kDa protein 6; AltName: Full ... =Hsp-70-related intracellular vitamin ... D-binding protein gb|AAF66617.1|AF142572_1 hsp-70- ... related intracellular vitamin ... D binding protein [Saguinus oedipus] Q9N1U2 0.0 92 ...

  9. EST Table: BY929895 [KAIKOcDNA[Archive

    Full Text Available BY929895 E_EL_ovS0_02E03_R_0 10/09/28 70 %/178 aa ref|NP_477114.1| noisette [Drosop...hila melanogaster] sp|O46106.1|NOI_DROME RecName: Full=Splicing factor 3A subunit 3; AltName: Full=Protein noise...tte emb|CAA11045.1| noisette [Drosophila melanogaster] gb|AAF51999.1| noisette [Drosophila melanogaster

  10. EST Table: CK499375 [KAIKOcDNA[Archive

    Full Text Available CK499375 rswbb0_009754.y1 11/12/09 n.h 10/09/29 88 %/124 aa ref|NP_477114.1| noiset...te [Drosophila melanogaster] sp|O46106.1|NOI_DROME RecName: Full=Splicing factor 3A subunit 3; AltName: Full=Protein noise...tte emb|CAA11045.1| noisette [Drosophila melanogaster] gb|AAF51999.1| noisette [Drosophila mel

  11. EST Table: BY929840 [KAIKOcDNA[Archive

    Full Text Available BY929840 E_EL_ovS0_01F10_R_0 10/09/28 89 %/127 aa ref|NP_477114.1| noisette [Drosop...hila melanogaster] sp|O46106.1|NOI_DROME RecName: Full=Splicing factor 3A subunit 3; AltName: Full=Protein noise...tte emb|CAA11045.1| noisette [Drosophila melanogaster] gb|AAF51999.1| noisette [Drosophila melanogaster

  12. Formation and persistence of DNA adducts from the carcinogen N-hydroxy-2-acetylaminofluorene in rat mammary gland in vivo

    The rat mammary carcinogen, N-hydroxy-2-acetylaminofluorene (N-hydroxy-2-AAF), has been proposed to be metabolically activated by mammary cytosolic N,O-acetyltransferase to a DNA binding species. To test this hypothesis, adult female Sprague-Dawley derived CD rats were treated, i.p., with 4.0 mg/kg [ring-3H]N-hydroxy-2-AAF. After 4 h, 1, 3, 14, and 28 days, the animals were killed, the mammary epithelium DNA was isolated and the carcinogen-deoxyribonucleoside adducts present were analyzed by high pressure liquid chromatography. At each time, only one adduct was detected and it was chromatographically identical to N-(deoxyguanosin-8-yl)-2-aminofluorene. The level of the adduct was maximal at 4 h (1.5 adducts/10(6) nucleotides) and then decreased, following first order kinetics with a t1/2 of 14.2 days. The detection of a single non-acetylated aminofluorene adduct is consistent with N,O-acyltransferase being involved in the metabolic activation of N-hydroxy-2-AAF in the rat mammary gland

  13. Exploring flavour-producing core microbiota in multispecies solid-state fermentation of traditional Chinese vinegar.

    Wang, Zong-Min; Lu, Zhen-Ming; Shi, Jin-Song; Xu, Zheng-Hong


    Multispecies solid-state fermentation (MSSF), a natural fermentation process driven by reproducible microbiota, is an important technique to produce traditional fermented foods. Flavours, skeleton of fermented foods, was mostly produced by microbiota in food ecosystem. However, the association between microbiota and flavours and flavour-producing core microbiota are still poorly understood. Here, acetic acid fermentation (AAF) of Zhenjiang aromatic vinegar was taken as a typical case of MSSF. The structural and functional dynamics of microbiota during AAF process was determined by metagenomics and favour analyses. The dominant bacteria and fungi were identified as Acetobacter, Lactobacillus, Aspergillus, and Alternaria, respectively. Total 88 flavours including 2 sugars, 9 organic acids, 18 amino acids, and 59 volatile flavours were detected during AAF process. O2PLS-based correlation analysis between microbiota succession and flavours dynamics showed bacteria made more contribution to flavour formation than fungi. Seven genera including Acetobacter, Lactobacillus, Enhydrobacter, Lactococcus, Gluconacetobacer, Bacillus and Staphylococcus were determined as functional core microbiota for production of flavours in Zhenjiang aromatic vinegar, based on their dominance and functionality in microbial community. This study provides a perspective for bridging the gap between the phenotype and genotype of ecological system, and advances our understanding of MSSF mechanisms in Zhenjiang aromatic vinegar. PMID:27241188

  14. Integrable theories and generalized graded Maillet algebras

    We present a general formalism to investigate the integrable properties of a large class of non-ultralocal models which in principle allows the construction of the corresponding lattice versions. Our main motivation comes from the su(1|1) subsector of the string theory on AdS5 × S5 in the uniform gauge, where such type of non-ultralocality appears in the resulting Alday–Arutyunov–Frolov (AAF) model. We first show how to account for the second derivative of the delta function in the Lax algebra of the AAF model by modifying Maillet’s r- and s-matrices formalism, and derive a well-defined algebra of transition matrices, which allows for the lattice formulation of the theory. We illustrate our formalism on the examples of the bosonic Wadati–Konno–Ichikawa–Shimizu (WKIS) model and the two-dimensional free massive Dirac fermion model, which can be obtained by a consistent reduction of the full AAF model, and give the explicit forms of their corresponding r-matrices. (paper)

  15. Exploring flavour-producing core microbiota in multispecies solid-state fermentation of traditional Chinese vinegar

    Wang, Zong-Min; Lu, Zhen-Ming; Shi, Jin-Song; Xu, Zheng-Hong


    Multispecies solid-state fermentation (MSSF), a natural fermentation process driven by reproducible microbiota, is an important technique to produce traditional fermented foods. Flavours, skeleton of fermented foods, was mostly produced by microbiota in food ecosystem. However, the association between microbiota and flavours and flavour-producing core microbiota are still poorly understood. Here, acetic acid fermentation (AAF) of Zhenjiang aromatic vinegar was taken as a typical case of MSSF. The structural and functional dynamics of microbiota during AAF process was determined by metagenomics and favour analyses. The dominant bacteria and fungi were identified as Acetobacter, Lactobacillus, Aspergillus, and Alternaria, respectively. Total 88 flavours including 2 sugars, 9 organic acids, 18 amino acids, and 59 volatile flavours were detected during AAF process. O2PLS-based correlation analysis between microbiota succession and flavours dynamics showed bacteria made more contribution to flavour formation than fungi. Seven genera including Acetobacter, Lactobacillus, Enhydrobacter, Lactococcus, Gluconacetobacer, Bacillus and Staphylococcus were determined as functional core microbiota for production of flavours in Zhenjiang aromatic vinegar, based on their dominance and functionality in microbial community. This study provides a perspective for bridging the gap between the phenotype and genotype of ecological system, and advances our understanding of MSSF mechanisms in Zhenjiang aromatic vinegar. PMID:27241188

  16. Serum Potassium Levels Inversely Correlate with D-Dimer In Patients with Acute-Onset Atrial Fibrillation

    Gianfranco Cervellin


    Full Text Available Background: D-dimer values are frequently increased in patients with atrial fibrillation (AF compared to subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. Objective: D-dimer values are frequently increased in patients with atrial fibrillation (AF compared with subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. The aim of this study was to investigate correlations between D-dimer and serum potassium in acute-onset AF (AAF. Methods: To investigate the potential correlation between the values of serum potassium and D-dimer in patients with AAF, we retrospectively reviewed clinical and laboratory data of all emergency department visits for AAF in 2013. Results: Among 271 consecutive AAF patients with D-dimer assessments, those with hypokalemia (n = 98 had significantly higher D-dimer values than normokalemic patients (139 versus 114 ng/mL, p = 0.004. The rate of patients with D-dimer values exceeding the diagnostic cut-off was higher in the group of patients with hypokalemia than in those with normal serum potassium (26.5% versus 16.2%; p = 0.029. An inverse and highly significant correlation was found between serum potassium and D-dimer (r = −0.21; p < 0.001, even after adjustments for age and sex (beta coefficient −94.8; p = 0.001. The relative risk for a positive D-dimer value attributed to hypokalemia was 1.64 (95% CI, 1.02 to 2.63; p = 0.040. The correlation remained statistically significant in patients free from antihypertensive drugs (r = −0.25; p = 0.018, but not in those taking angiotensin-receptor blockers, angiotensin-converting enzyme inhibitors, or diuretics. Conclusions: The inverse correlation between values of potassium and D-dimer in patients with AAF provides important and complementary information about the thromboembolic risk of these patients.

  17. Serum Potassium Levels Inversely Correlate with D-Dimer In Patients with Acute-Onset Atrial Fibrillation

    Cervellin, Gianfranco, E-mail:; Bonfanti, Laura; Picanza, Alessandra; Lippi, Giuseppe [1Academic Hospital of Parma (Italy)


    D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared to subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared with subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. The aim of this study was to investigate correlations between D-dimer and serum potassium in acute-onset AF (AAF). To investigate the potential correlation between the values of serum potassium and D-dimer in patients with AAF, we retrospectively reviewed clinical and laboratory data of all emergency department visits for AAF in 2013. Among 271 consecutive AAF patients with D-dimer assessments, those with hypokalemia (n = 98) had significantly higher D-dimer values than normokalemic patients (139 versus 114 ng/mL, p = 0.004). The rate of patients with D-dimer values exceeding the diagnostic cut-off was higher in the group of patients with hypokalemia than in those with normal serum potassium (26.5% versus 16.2%; p = 0.029). An inverse and highly significant correlation was found between serum potassium and D-dimer (r = −0.21; p < 0.001), even after adjustments for age and sex (beta coefficient −94.8; p = 0.001). The relative risk for a positive D-dimer value attributed to hypokalemia was 1.64 (95% CI, 1.02 to 2.63; p = 0.040). The correlation remained statistically significant in patients free from antihypertensive drugs (r = −0.25; p = 0.018), but not in those taking angiotensin-receptor blockers, angiotensin-converting enzyme inhibitors, or diuretics. The inverse correlation between values of potassium and D-dimer in patients with AAF provides important and complementary information about the thromboembolic risk of these patients.

  18. Relative cost-effectiveness of using an extensively hydrolyzed casein formula containing the probiotic Lactobacillus rhamnosus GG in managing infants with cow’s milk allergy in Poland

    Guest, Julian F; Weidlich, Diana; Kaczmarski, Maciej; Jarocka-Cyrta, Elzbieta; Kobelska-Dubiel, Natalia; Krauze, Agnieszka; Sakowska-Maliszewska, Iwona; Zawadzka-Krajewska, Anna


    Objective To estimate the cost-effectiveness of using an extensively hydrolyzed casein formula (eHCF) containing the probiotic Lactobacillus rhamnosus GG (eHCF + LGG; Nutramigen LGG) as an initial treatment for cow’s milk allergy compared with eHCF alone and amino acid formulas (AAF) in Poland from the perspective of the Polish National Health Fund (Narodowy Fundusz Zdrowia [NFZ]) and parents. Methods Decision modeling was used to estimate the probability of cow’s milk allergic infants developing tolerance to cow’s milk by 18 months. The model also estimated the cost to the NFZ and parents (Polish Zloty [PLN] at 2013–2014 prices) for managing infants over 18 months after starting one of the formulas as well as the relative cost-effectiveness of each of the formulas. Results The probability of developing tolerance to cow’s milk by 18 months was higher among infants who were fed eHCF + LGG (0.82) compared with those fed eHCF alone (0.53) or an AAF (0.22). An infant who is initially managed with eHCF + LGG is expected to consume fewer health care resources than infants managed with the other formulas. Hence, the estimated total health care cost incurred by the NFZ for initially feeding infants with eHCF + LGG (PLN 5,693) was less than that of feeding infants with eHCF alone (PLN 7,749) or an AAF (PLN 24,333). However, the total cost incurred by parents for initially feeding infants with an AAF (PLN 815) was marginally less than that of feeding with eHCF + LGG (PLN 993), which was less than that of feeding with eHCF alone (PLN 1,226). Conclusion Using eHCF + LGG instead of eHCF alone or an AAF for first-line management of newly diagnosed infants with cow’s milk allergy affords a cost-effective use of NFZ-funded resources, since it improves outcome for less cost. Whether eHCF + LGG would be viewed as being cost-effective by parents is dependent on their willingness to pay an additional cost for additional tolerance acquisition to cow’s milk. PMID:27418845

  19. Serum Potassium Levels Inversely Correlate with D-Dimer In Patients with Acute-Onset Atrial Fibrillation

    D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared to subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared with subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. The aim of this study was to investigate correlations between D-dimer and serum potassium in acute-onset AF (AAF). To investigate the potential correlation between the values of serum potassium and D-dimer in patients with AAF, we retrospectively reviewed clinical and laboratory data of all emergency department visits for AAF in 2013. Among 271 consecutive AAF patients with D-dimer assessments, those with hypokalemia (n = 98) had significantly higher D-dimer values than normokalemic patients (139 versus 114 ng/mL, p = 0.004). The rate of patients with D-dimer values exceeding the diagnostic cut-off was higher in the group of patients with hypokalemia than in those with normal serum potassium (26.5% versus 16.2%; p = 0.029). An inverse and highly significant correlation was found between serum potassium and D-dimer (r = −0.21; p < 0.001), even after adjustments for age and sex (beta coefficient −94.8; p = 0.001). The relative risk for a positive D-dimer value attributed to hypokalemia was 1.64 (95% CI, 1.02 to 2.63; p = 0.040). The correlation remained statistically significant in patients free from antihypertensive drugs (r = −0.25; p = 0.018), but not in those taking angiotensin-receptor blockers, angiotensin-converting enzyme inhibitors, or diuretics. The inverse correlation between values of potassium and D-dimer in patients with AAF provides important and complementary information about the thromboembolic risk of these patients

  20. Two-Column Aerosol Project (TCAP) Field Campaign Report

    Berg, Larry K [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)


    This study included the deployment of the Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Mobile Facility (AMF), ARM Mobile Aerosol Observing System (MAOS) and the ARM Aerial Facility (AAF). The study was a collaborative effort involving scientists from DOE national laboratories, NOAA, NASA, and universities. The AAF and MAOS were deployed for two approximately month-long Intensive Operational Periods (IOPs) conducted in June 2012 and February 2013. Seasonal differences in the aerosol chemical and optical properties observed using the AMF, AAF, and MAOS are presented in this report. The total mass loading of aerosol is found to be much greater in the summer than in the winter, with the difference associated with greater amounts of organic aerosol. The mass fraction of organic aerosol is much reduced in the winter, when sulfate is the dominant aerosol type. Surprisingly, very little sea-salt aerosol was observed in the summer. In contrast, much more sea salt aerosol was observed in the winter. The mass loading of black carbon is nearly the same in both seasons. These differences lead to a relative increase in the aerosol light absorption in the winter and an associated decrease in observed single-scattering albedo. Measurements of aerosol mixing state were made using a single-particle mass spectrometer, which showed that the majority of the summertime aerosol consisted of organic compounds mixed with various amounts of sulfate. A number of other findings are also summarized in the report, including: impact of aerosol layers aloft on the column aerosol optical depth; documentation of the aerosol properties at the AMF; differences in the aerosol properties associated with both columns, which are not systematic but reflect the complicated meteorological and chemical processes that impact aerosol as it is advected away from North America; and new instruments and data-processing techniques for measuring both aerosol and

  1. EST Table: CK501008 [KAIKOcDNA[Archive

    Full Text Available CK501008 rswbb0_012284.y1 10/09/29 67 %/146 aa ref|XP_001601952.1| PREDICTED: similar t o GA10597 ... 8 63 %/152 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 46 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  2. EST Table: FS784965 [KAIKOcDNA[Archive

    Full Text Available FS784965 E_FL_fcaL_49E14_R_0 10/09/28 74 %/136 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 8 68 %/138 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 36 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  3. EST Table: FS744692 [KAIKOcDNA[Archive

    Full Text Available FS744692 E_FL_bmmt_29D04_R_0 10/09/28 73 %/156 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 8 67 %/158 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 56 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  4. EST Table: FS778556 [KAIKOcDNA[Archive

    Full Text Available FS778556 E_FL_fcaL_28A11_R_0 10/09/28 75 %/102 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 8 72 %/102 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 02 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  5. EST Table: FS893042 [KAIKOcDNA[Archive

    Full Text Available FS893042 E_FL_ftes_10B11_R_0 10/09/28 70 %/180 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 9 63 %/174 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 71 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  6. EST Table: FS786479 [KAIKOcDNA[Archive

    Full Text Available FS786479 E_FL_fcaL_18F24_R_0 10/09/28 72 %/112 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 8 71 %/108 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 09 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  7. EST Table: CK487158 [KAIKOcDNA[Archive

    Full Text Available CK487158 rswab0_004240.y1 10/09/29 72 %/215 aa ref|XP_001601952.1| PREDICTED: similar t o GA10597 ... 8 62 %/218 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 45 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  8. EST Table: FS903542 [KAIKOcDNA[Archive

    Full Text Available FS903542 E_FL_ftes_51G04_R_0 10/09/28 74 %/152 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 9 67 %/154 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 52 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  9. EST Table: FS775869 [KAIKOcDNA[Archive

    Full Text Available FS775869 E_FL_fcaL_09G18_R_0 10/09/28 73 %/141 aa dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pis ... 8 67 %/143 aa C15F1.6#CE20509#WBGene00000198#locus:art - 1#status:Confirmed#UniProt:Q9N5Y2#protein_id:AAF3 ... 41 aa gi|91092236|ref|XP_971180.1| PREDICTED: similar t o synaptic glycoprotein SC2 [Tribolium castaneum] ...

  10. NCBI nr-aa BLAST: CBRC-TGUT-12-0017 [SEVENS

    Full Text Available CBRC-TGUT-12-0017 ref|NP_067690.1| hyperpolarization-activated, cyclic nucleotide-g...ated K+ 4 [Rattus norvegicus] sp|Q9JKA7|HCN4_RAT Potassium/sodium hyperpolarization-activated cyclic nucleot...ide-gated channel 4 gb|AAF62176.1|AF247453_1 hyperpolarization-activated, cyclic nucleotide-gated potassium 4 [Rattus norvegicus] gb|EDL95687.1| hyperpolarization-activated, cyclic nucleotide-gated K+ 4 [Rattus norvegicus] NP_067690.1 0.002 26% ...

  11. Anticuerpos antiprotrombina y resistencia adquirida a la proteína C activada en el síndrome antifosfolipídico

    Muñoz Rodríguez, Francisco José


    El síndrome antifosfolipídico (SAF) se caracteriza clínicamente por la aparición de fenómenos trombóticos recurrentes, complicaciones obstétricas, tales como abortos o pérdidas fetales recurrentes, y trombocitopenia. Inmunológicamente se define por la presencia de los anticuerpos antifosfolipídicos (AAF), un grupo heterogéneo de autoanticuerpos que reconocen complejos constituidos por fosfolípidos de membrana y proteínas plasmáticas que actúan como cofactores. Los mejor conocidos y que ayudan...

  12. Radical proposal for the treatment of malignant astrocytoma

    The traditional treatment for anaplastic astrocytoma (AAF) and glioblastoma multiforme (GBM) leads to local relapse. The recurring element is assumed to be previously radioresistant, reorganizing hypoxic cells that require up to three times the traditional photon irradiation dose for inactivation. We are proposing to coagulate the original lesion with high-dose precision brachytherapy, immediately followed by resection to save the patient from secondary effects of the necrotic region. The treatment then continues with adjuvant external beam radiation therapy to the local surrounding brain and concomitant chemotherapy. The approach inverts the traditional regimen. It has the virtue of being precise, avoiding secondary effects of the necrotic tumor, and satisfying accepted radiobiological principles

  13. Síndrome de Asperger y autismo de alto funcionamiento: comorbilidad con trastornos de ansiedad y del estado de ánimo

    Paula Pérez, Isabel, 1970-; Martos, Juan (Martos Pérez)


    Introducción. La comorbilidad entre el síndrome de Asperger (SA) y los trastornos del estado de ánimo y de ansiedad parece ser altamente significativa. Por ello, se presenta una revisión de la bibliografía científica más actual que aporte evidencias empíricas a tal hipótesis con el objetivo de plantear una prospectiva de investigación. Desarrollo. La valoración y el diagnóstico del funcionamiento psicosocial analizado en personas con SA o autismo de alto funcionamiento (AAF) confirman una pro...

  14. Analysis at the sequence level of mutations induced by the ultimate carcinogen N-acetoxy-N-2-acetylaminofluorene

    Fuchs, Robert P. P.; Schwartz, Nicole; Daune, Michel P.


    The covalent binding of an ultimate carcinogen to the DNA bases or phosphate groups creates a premutational lesion that in vivo is processed by the repair, replication and recombination enzymes, and eventually may be converted into a mutation. Being interested in the way that an initial premutational event is converted into a stable heritable mutation, we have sequenced stable mutations in a gene that has formed covalent adducts in vitro with N-acetoxy-N-2-acetylaminofluorene (N-AcO-AAF, a mo...


    S. A. Egorova; M. A. Makarova; L. A. Kaftyreva


    Abstract. Strains of Klebsiella pneumonia isolated from faces were studied to detect virulence factors of “classical” enteric pathogens causing acute diarrhea (Shigella, Salmonella, diarreagenic Escherichia coli). We haven’t detect in Klebsiella the genes encode different virulence factors: the abilities to adherence (sfa, afa, aaf/1, eae), invasion (ipaH, ial), production of heat-lable toxins (elt, LT II), heat-stable toxins (st1, st2) and Shiga toxins (stx1, stx2). Klebsiella spp. is well-k...

  16. 旋毛虫肌幼虫cDNA文库的免疫筛选及初步分析%Immunoscreening and Analysis of Muscle Larvae cDNA Library of Trichinella spiralis

    付宝权; 原丽红; 张亚兰; 吴秀萍; 李莲瑞; 卢强; 刘明远; 陈启军; P.Boireau


    用旋毛虫感染猪血清对旋毛虫肌幼虫cDNA文库进行了免疫筛选,从1.6×105个重组噬茵体中筛选出21个阳性克隆.阳性克隆的测序结果表明:有9个克隆为未曾报道过的新基因;有9个克隆不含有开放阅读框架(ORF),与旋毛虫线粒体DNA同源,编码核糖体大亚基RNA;3个克隆为旋毛虫已知基因,其中克隆MI12,34与Serine protease inhibitor[Trichinella spiralis](AAF63473)同源性为99%,克隆MI42与Hypothetical OFR 17.20[Trichinella spiralis](AAB48489)同源性为99%,与21 kDExcretory/secretory protein[Trichinellapseudospiralis](AAF79206)同源性为90%,这为进一步研究基因重组抗原奠定了基础.

  17. Alcohol attributable hospitalisations and costs in Ireland, 2000-2004.

    Martin, J


    The aim of this study was to calculate the number and costs of hospital bed-days due to alcohol use in Ireland over the five year period 2000 to 2004. Age and sex specific Irish alcohol-attributable-fractions (AAFs) were developed by combining international risk estimates with Irish consumption data where available; where not available international AAFs were used. These were applied to national datasets to count the number and costs of bed-days wholly caused and prevented by alcohol and that proportion of bed-days that were partially caused and prevented by alcohol. Between 2000 and 2004, alcohol was estimated to have caused 3,428,973 (10.3%) and prevented 529,239 (1.6%) of hospital bed-days, giving a net number of bed-days due to alcohol of 2,899,734 (8.7%). Over this period the hospital inpatient costs attributed to the negative effects of alcohol were 953,126,381 euros, the costs attributed to hospitalisations prevented were 147,968,164 euros; giving net costs of alcohol-attributed bed-days of 805,158,217 euros. Chronic conditions accounted for 3,262,408 (95%) hospital bed-days due to the harmful effects of alcohol. Conditions not wholly due to alcohol accounted for 2,297,412 (67%) hospital bed-days due to the harmful effects of alcohol. The negative impacts of alcohol were greater than previously thought and spread across the whole population.

  18. A selective tropism of transfused oval cells for liver

    Jian-Zhi Chen; Hai Hong; Jin Xiang; Ling Xue; Guo-Qiang Zhao


    AIM: To explore the biological behaviors of hepatic oval cells after transfused into the circulation of experimental animals.METHODS: Oval cells from male SD rat were transfused into the circulation of a female rat which were treated by a 2-AAF/CCl4 program, through caudal vein. Sex-determining gene sry which located on Y chromosome was examined by PCR and in situ hybridization technique in liver, kidney and spleen of the experimental animals, respectively.RESULTS: The results of the cell-transplant experiment showed that the srygene was detectable only in the liver but not in spleen and kidney of the experimental rats, and no signals could be detected in the control animals. It can be also morphologically proved that some exogenous cells had migrated into the parenchyma of the liver and settled there.CONCLUSION: The result means that there are exogenous cells located in the liver of the experimental animal and the localization is specific to the liver. This indicates that some "signal molecules" must exist in the circulation of the rats treated by 2-AAF/CCl4. These "signal molecules" might play an important role in specific localization and differentiation of transfused oval cells.

  19. Distribution of Murine Tissue Specific γ-Glutamyltransferase: Comparison of six monoclonal antibody applications in Enzyme linked immunosorbent assay, radioimmunoassay, immunohistochemistry, and autoradiography

    γ-Glutamyltransferase (GGT: E.C. is a glycoprotein enzyme which is involved in glutathione metabolism and amino acid transport through the plasma membrane. It is distributed widely in several organs including liver and kidney. Several isozymes of GGT have been reported and some of the isozymes may be associated with hepatocarcinogenesis. We have produced six monoclnal antibodies (mAbs) against GGT purified from the liver of 2-acetamidofluorene (AAF) treated rats. All of the six mAbs were obtained by immunizing mice with liver GGT. Six hybridomas which produced anti-GGT Abs were extensively subcloned and injected into the peritoneal cavity of BALB/c mice to obtain large quantities of Abs. These mAbs were purified from ascites by ammonium sulfate precipitation and protein A sepharose CL-4B column chromatography. Using these mAbs we performed enzyme-linked immunosorbent assay (ELISA), radioimmvnoassay (RIA), immunohistochemistry (IHC), and autoradiography (ARG) to study the distribution of GGT isozyme in tissue. The results indicate that GGT-mAb 1 is specific for the AAF treated liver GGT, GGT-mAb 5 for the normal liver GGT, and GGT-mAb 6 for the normal kidney GGT. These mAbs may be used to evaluate the distribution of GGT isozymes in different tissues.

  20. Encoding of temporal information by timing, rate, and place in cat auditory cortex.

    Kazuo Imaizumi

    Full Text Available A central goal in auditory neuroscience is to understand the neural coding of species-specific communication and human speech sounds. Low-rate repetitive sounds are elemental features of communication sounds, and core auditory cortical regions have been implicated in processing these information-bearing elements. Repetitive sounds could be encoded by at least three neural response properties: 1 the event-locked spike-timing precision, 2 the mean firing rate, and 3 the interspike interval (ISI. To determine how well these response aspects capture information about the repetition rate stimulus, we measured local group responses of cortical neurons in cat anterior auditory field (AAF to click trains and calculated their mutual information based on these different codes. ISIs of the multiunit responses carried substantially higher information about low repetition rates than either spike-timing precision or firing rate. Combining firing rate and ISI codes was synergistic and captured modestly more repetition information. Spatial distribution analyses showed distinct local clustering properties for each encoding scheme for repetition information indicative of a place code. Diversity in local processing emphasis and distribution of different repetition rate codes across AAF may give rise to concurrent feed-forward processing streams that contribute differently to higher-order sound analysis.

  1. Genotoxic potency in Drosophila melanogaster of selected aromatic amines and polycyclic aromatic hydrocarbons as assayed in the DNA repair test.

    Fujikawa, K; Fort, F L; Samejima, K; Sakamoto, Y


    Drosophila melanogaster stock consisting of meiotic recombination deficient (Rec-) double mutant mei-9a mei-41D5 males and Rec+ females was exposed at the larval stage to an aromatic amine or a polycyclic aromatic hydrocarbon. After emergence as adult flies, the males and the females were scored separately. When the treatment caused a dose-dependent reduction in the male to female ratio from the control level; the experiment was repeated with a larval stock consisting of Rec+ males and Rec+ females under comparable conditions. A preferential killing effect upon Rec- larvae was taken as evidence of DNA damaging effect of the test compound. Among 16 compounds tested, 1-AP, B(a)P, 2-AF, DAF, 4-AAF, 2-AAF, 1-AA, 2-AA, DMA, B(a)A and DMBA were registered as positive; Py and 3-MC were weakly positive; and B(e)P, Fluo and Ant were negative. The selective killing effects of the compounds in each of the pyrene, fluorene and anthracene series varied drastically as a function of structure in a way similar to that reported for the genotoxicity in Drosophila and the carcinogenicity in rodents. The Drosophila DNA repair assay will serve as a simple adjunct to the already available means for studying the genotoxic potency of aromatic amines and polycyclic aromatic hydrocarbons. PMID:7694108

  2. Comparison of different initiation protocols in the resistant hepatocyte model

    Several models in rat liver have been developed to study multistage carcinogenesis, including the Solt-Farber resistant hepatocyte model. In this model, initiation consists of either a necrogenic dose of a hepatocarcinogen or a non-necrogenic dose in conjunction with partial hepatectomy (PH). As an alternative to PH, we investigated two different procedures: fasting for 96 h followed by refeeding, or the use of one-day-old neonates. Male Fisher 344 rats were injected p.o. with diethylnitrosamine (DEN) (0, 20, or 100 mg/kg) 24 h after refeeding or PH (controls received DEN alone with no proliferative stimulus). For the neonatal group, male and female Fisher 344 rats were treated with DEN (0 or 20 mg/kg, i.p.) at one day of age. All initiated animals were treated at the same age (11 weeks) with the following selection agents: three daily doses of 2-acetylaminofluorene (AAF) (30 mg/kg), followed by a single dose of carbon tetrachloride (2 ml/kg), followed by three additional daily treatments of AAF (30 mg/kg). Rats were euthanized 2 weeks after the last AAF injection. The PH, neonatal male, and neonatal female groups receiving DEN developed more γ-glutamyl transpeptidase (GGT)-positive foci per cubic centimeter and foci per liver as compared to untreated rats receiving the same proliferative stimulus, whereas the fasting/refeeding group and the group receiving no proliferative stimulus did not. All DEN-treated groups receiving one of the proliferative stimuli had more foci per cubic centimeter than the DEN-treated group receiving no proliferative stimulus. The volume fractions of GGT-positive foci in the PH/DEN and neonatal male/DEN groups were higher than those of both the DEN-treated group receiving no proliferative stimulus and the groups receiving the same proliferative stimulus without DEN. In neonatal females-receiving DEN, the volume fraction was not different from either neonatal females not receiving DEN or DEN-treated rats receiving no proliferative

  3. Remarkable heterogeneity displayed by oval cells in rat and mouse models of stem cell-mediated liver regeneration

    Jelnes, Peter; Santoni-Rugiu, Eric; Rasmussen, Morten;


    The experimental protocols used in the investigation of stem cell-mediated liver regeneration in rodents are characterized by activation of the hepatic stem cell compartment in the canals of Hering followed by transit amplification of oval cells and their subsequent differentiation along hepatic...... the molecular phenotypes of oval cells in several of the most commonly used protocols of stem cell-mediated liver regeneration-namely, treatment with 2-acetylaminofluorene and partial (70%) hepatectomy (AAF/PHx); a choline-deficient, ethionine-supplemented (CDE) diet; a 3,5-diethoxycarbonyl-1...... results delineate remarkable phenotypic discrepancies exhibited by oval cells in stem cell-mediated liver regeneration between rats and mice and underline the importance of careful extrapolation between individual species....

  4. Audiometria de altas frequências no diagnóstico complementar em audiologia: uma revisão da literatura nacional High-frequency audiometry in audiological complementary diagnosis: a revision of the national literature

    Karlin Fabianne Klagenberg


    Full Text Available A audiometria de altas frequências (AAF é um exame audiológico importante na detecção precoce de perdas auditivas por lesões na base do ducto coclear. Nos últimos anos, a sua utilização foi facilitada pelo fato de os audiômetros comercializados passarem a incorporar frequências superiores a 8 kHz. Porém, existem diferenças relacionadas aos equipamentos utilizados, às metodologias empregadas e/ou aos resultados e interpretação. Assim, o objetivo deste artigo foi analisar a produção científica nacional sobre a aplicação clínica com AAF, para compreender sua utilização atual. Foram pesquisados textos publicados e indexados nas bases de dados LILACS, SciELO e Medline, num período de tempo de dez anos, utilizando como descritor "audiometria de altas frequências/high-frequency audiometry". Encontraram-se 24 artigos científicos nacionais utilizando AAF, cuja população avaliada, em sua maioria, apresentava de 18 a 50 anos de idade; 13 dos estudos determinaram os limiares utilizando como referência decibel nível de audição (dBNA; alguns estudos realizaram a comparação dos limiares auditivos tonais entre grupos para definir a normalidade; os autores relataram diferenças significativas nos limiares auditivos de altas frequências entre as idades. A AAF é utilizada na clínica audiológica para identificação precoce de alterações auditivas e no acompanhamento da audição de sujeitos expostos a drogas ototóxicas e/ou agentes otoagressores.High-frequency audiometry (HFA is an important audiological test for early detection of hearing losses caused by leasions in the base of the cochlear duct. In recent years, its use was facilitated because audiometers began to identify frequencies higher than 8 kHz. However, there are differences related to the equipment used, the methodologies followed, and/or to the results and their interpretation. Therefore, the aim of this study was to analyze the national scientific production

  5. Differences in detection of DNA adducts in the 32P-postlabelling assay after either 1-butanol extraction or nuclease P1 treatment.

    Gallagher, J E; Jackson, M A; George, M H; Lewtas, J; Robertson, I G


    The use of nuclease P1 treatment and 1-butanol extraction to increase the sensitivity of the 32P-postlabelling assay for DNA adducts have been compared. Although similar results were obtained with the two methods for standard adducts formed with benzo[a]pyrene diol epoxide I (BPDE-I), nuclease P1 treatment resulted in a significant reduction in detection of major adducts from 1-amino-6-nitropyrene (1-amino-6-NP), 1-amino-8-nitropyrene (1-amino-8-NP), 2-aminofluorene (2-AF), 2-naphthylamine (2-NA) and 4-aminobiphenyl (4-ABP) modified DNAs, but not following the 32P-postlabelling analysis of 2-acetylaminofluorene (2-AAF) modified DNA. These results suggest that, at least initially, both modifications of the 32P-postlabelling assay should be used for the detection of unknown adducts or for adducts derived from nitroaromatics and aromatic amines. PMID:2540901

  6. OLYMPEX Counterflow Spectrometer and Impactor Field Campaign Report

    Poellot, Michael [Univ. of North Dakota, Grand Forks, ND (United States)


    The U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s ARM Aerial Facility (AAF) Counterflow Spectrometer and Impactor (CSI) probe was flown on the University of North Dakota Cessna Citation research aircraft during the Olympic Mountain Experiment (OLYMPEX). The field campaign took place from November 12 through December 19, 2015, over the Olympic Mountains and coastal waters of Washington State as part of a National Aeronautics and Space Administration (NASA) Global Precipitation Measurement (GPM) validation campaign. The CSI was added to the Citation instrument suite to support the NASA Aerosol-Cloud Ecosystem (ACE) satellite program and flights of the NASA Lockheed Earth Resources (ER-2) aircraft. ACE funded extra ER-2 flights to focus on clouds that are weakly precipitating, which are also of interest to the DOE Atmospheric System Research (ASR) program.

  7. Serum Potassium Levels Inversely Correlate with D-Dimer In Patients with Acute-Onset Atrial Fibrillation.

    Cervellin, Gianfranco; Bonfanti, Laura; Picanza, Alessandra; Lippi, Giuseppe


    Background: D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared to subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. Objective: D-dimer values are frequently increased in patients with atrial fibrillation (AF) compared with subjects in sinus rhythm. Hypokalemia plays a role in several cardiovascular diseases, but little is known about the association with AF. The aim of this study was to investigate correlations between D-dimer and serum potassium in acute-onset AF (AAF). Methods: To investigate the potential correlation between the values of serum potassium and D-dimer in patients with AAF, we retrospectively reviewed clinical and laboratory data of all emergency department visits for AAF in 2013. Results: Among 271 consecutive AAF patients with D-dimer assessments, those with hypokalemia (n = 98) had significantly higher D-dimer values than normokalemic patients (139 versus 114 ng/mL, p = 0.004). The rate of patients with D-dimer values exceeding the diagnostic cut-off was higher in the group of patients with hypokalemia than in those with normal serum potassium (26.5% versus 16.2%; p = 0.029). An inverse and highly significant correlation was found between serum potassium and D-dimer (r = -0.21; p investigar a correlação entre os níveis séricos de D-dímero e potássio na FA aguda (FAA). Métodos: Para investigar a existência de uma potencial correlação entre os níveis séricos de potássio e D-dímero em pacientes com FAA, realizamos uma revisão retrospectiva de dados clínicos e laboratoriais relacionados a todas as visitas ao departamento de emergência devido à FAA, no ano de 2013. Resultados: Entre os 271 pacientes com FAA, aqueles com hipopotassemia (n = 98) mostraram aumento significativo nos níveis de D-dímero, quando comparados com pacientes com concentrações normais de potássio (139 versus 114 ng/mL, p = 0

  8. Aespoe Hard Rock Laboratory. Prototype Repository. Sensors data report (Period 010917-091201) Report No: 22

    Goudarzi, Reza; Johannesson, Lars-Erik (Clay Technology AB, Lund (Sweden))


    The Prototype Repository Test consists of two sections. The installation of the first Section of Prototype Repository was made during summer and autumn 2001 and Section 2 was installed in spring and summer 2003. This report presents data from measurements in the Prototype Repository during the period 010917-091201. The report is organized so that the actual measured results are shown in Appendix 1-10, where Appendix 8 deals with measurements of canister displacements (by AITEMIN), Appendix 9 deals with geo-electric measurements in the backfill (by GRS), Appendix 10 deals with stress and strain measurement in the rock (by AaF) and Appendix 11 deals with measurement of water pressure in the rock (by VBB/VIAK). The main report and Appendix 1-7 deal with the rest of the measurements.

  9. Prototype Repository - Sensor data report (period 100917-110101) Report no 24

    Goudarzi, Reza [Clay Technology AB, Lund (Sweden)


    The Prototype Repository Test consists of two sections. The installation of the first Section of Prototype Repository was made during summer and autumn 2001 and Section 2 was installed in spring and summer 2003. At the end of November 2010 stared the dismantling of the outer section. This report presents data from measurements in the Prototype Repository during the period 2001-09-17-2011-01-01. The report is organized so that the actual measured results are shown in Appendix 1-10, where Appendix 8 deals with measurements of canister displacements (by AITEMIN), Appendix 9 deals with geo-electric measurements in the backfill (by GRS), Appendix 10 deals with stress and strain measurement in the rock (by AaF) and Appendix 11 deals with measurement of water pressure in the rock (by VBB/VIAK). The main report and Appendix 1-7 deal with the rest of the measurements.


    S. A. Egorova


    Full Text Available Abstract. Strains of Klebsiella pneumonia isolated from faces were studied to detect virulence factors of “classical” enteric pathogens causing acute diarrhea (Shigella, Salmonella, diarreagenic Escherichia coli. We haven’t detect in Klebsiella the genes encode different virulence factors: the abilities to adherence (sfa, afa, aaf/1, eae, invasion (ipaH, ial, production of heat-lable toxins (elt, LT II, heat-stable toxins (st1, st2 and Shiga toxins (stx1, stx2. Klebsiella spp. is well-known pathogen of the opportunistic infections of urinary tract, blood, wound, respiratory tract. But this bacteria hasn’t virulence factors of diarreagenic Enterobacteriaceae and can’t cause acute diarrhea and other gut pathology.

  11. Main: 2AAK [RPSD[Archive

    Full Text Available 2AAK シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Ubiquitin-Conjugating Enzyme (E2) J.Biol.Chem. V. 267 15116 1992 Ubiquitin Conjugation, Ligase SWS:UBC1_ARATH,P25865|EMBL; M62721; AAA...32903.1; -.|EMBL; L19351; AAA32897.1; -.|EMBL; AC012188; AAF43940.1; -.|EMBL; Z27262; CAA...81773.1; -.|PIR; S43781; S43781.|PDB; 2AAK; X-ray; @=1-152.|InterPro; IPR000608; UBQ_conjuga...ion, Resolution: 2.40 Angstrom, R-Factor: 0.221, R-Free: 0.287 Length: 152 AA, Molecular weight: 17281 Da MS

  12. Prototype Repository - Sensor data report (period 100917-110101) Report no 24

    The Prototype Repository Test consists of two sections. The installation of the first Section of Prototype Repository was made during summer and autumn 2001 and Section 2 was installed in spring and summer 2003. At the end of November 2010 stared the dismantling of the outer section. This report presents data from measurements in the Prototype Repository during the period 2001-09-17-2011-01-01. The report is organized so that the actual measured results are shown in Appendix 1-10, where Appendix 8 deals with measurements of canister displacements (by AITEMIN), Appendix 9 deals with geo-electric measurements in the backfill (by GRS), Appendix 10 deals with stress and strain measurement in the rock (by AaF) and Appendix 11 deals with measurement of water pressure in the rock (by VBB/VIAK). The main report and Appendix 1-7 deal with the rest of the measurements

  13. Precipitation and Hydrology Experiment Counter-Flow Spectrometer and Impactor Field Campaign Report

    Poellot, Michael [University of North Dakota


    The U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Aerial Facility (ARM AAF) counter-flow spectrometer and impactor (CSI) probe was flown on the University of North Dakota Cessna Citation research aircraft during the Integrated Precipitation and Hydrology Experiment (IPHEX). The field campaign took place during May and June of 2014 over North Carolina and its coastal waters as part of a National Aeronautics and Space Administration (NASA) Global Precipitation Measurement validation campaign. The CSI was added to the Citation instrument suite to support the involvement of Jay Mace through the NASA Advanced Composition Explorer (ACE) satellite program and flights of the NASA ER-2 aircraft, which is a civilian version of the Air Force’s U2-S reconnaissance platform. The ACE program funded extra ER-2 flights to focus on clouds that are weakly precipitating, which are also of interest to the Atmospheric System Research program sponsored by DOE.

  14. Deoxyribonucleic acid sequence mapping on metaphase chromosomes by immunoelectron microscopy

    Nucleic acid sequences can be localized on chromosomes in the electron microscope after hybridization with a biotinylated DNA probe followed by detection with a primary antibiotin antibody and a secondary antibody coupled to colloidal gold. Hybridization probes can also be labelled with alternative ligands such as N-acetoxy-2-acetylaminofluorene (AAF), Dinitrophenyl-dUTP and Digoxigenin-dUTP. Multiple labelling is possible if these differently modified DNA probes are used in conjunction with colloidal gold preparations of varying particle sizes. A substantial signal amplification can be achieved by incubating preparations with successive cycles of primary antibiotin antibody followed by a biotinylated secondary antibody. Detection is with Streptavidin-gold, and in the case of highly and moderately repeated sequences, the signal is visible in the light microscope. Detailed protocols are given for EM in-situ hybridization to whole mount metaphase chromosomes and include instructions necessary to perform multiple sequence localization and signal amplification

  15. Dicty_cDB: Contig-U07060-1 [Dicty_cDB

    Full Text Available IHFVLLVK NLLKK*innkynii*y own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U07060-1 (Contig-U07060-1...) S1: 12 (24.3 bits) S2: 15 (30.2 bits) dna update 2008.11.11 Homology vs DNA Query= Contig-U07060-1 (Contig...ce *** SEQUENCING IN PROGRESS *** f... 36 9.0 4 ( AC157641 ) Rhinolophus ferrumequinum clone VMRC7...-215A14, WOR... 34 9.2 5 ( ED374959 ) AUAC-aaf81g10.b1 Ascaris suum whole genome shotgu... 38 9.6 2 ( EJ272106 ) 1095353020898 Glo...1: 11 (21.8 bits) S2: 22 (44.1 bits) protein update 2009. 6.23 Homology vs Protein Query= Contig-U07060-1 (C

  16. Clinical and echocardiographic features of aorto-atrial fistulas

    Ananthasubramaniam Karthik


    Full Text Available Abstract Aorto-atrial fistulas (AAF are rare but important pathophysiologic conditions of the aorta and have varied presentations such as acute pulmonary edema, chronic heart failure and incidental detection of the fistula. A variety of mechanisms such as aortic dissection, endocarditis with pseudoaneurysm formation, post surgical scenarios or trauma may precipitate the fistula formation. With increasing survival of patients, particularly following complex aortic reconstructive surgeries and redo valve surgeries, recognition of this complication, its clinical features and echocardiographic diagnosis is important. Since physical exam in this condition may be misleading, echocardiography serves as the cornerstone for diagnosis. The case below illustrates aorto-left atrial fistula formation following redo aortic valve surgery with slowly progressive symptoms of heart failure. A brief review of the existing literature of this entity is presented including emphasis on echocardiographic diagnosis and treatment.

  17. Altered expression of cytochrome P450 and possible correlation with preneoplastic changes in early stage of rat hepatocarcinogenesis

    Lin-lin LIU; Li-kun GONG; Xin-ming QI; Yan CAI; Hui WANG; Xiong-fei WU; Ying XIAO; Jin REN


    Aim: Correlation of cytochrome P450 (CYPs) with preneoplastic changes in the early stage of hepatocarcinogenesis is still unclear. To detect the expression of carcinogen-metabolizing related microsomal P450 enzymes, namely the CYP1A1,CYP1A2, CYP2B 1/2, CYP2E1, and CYP3A, we performed the medium-term bioassay of Ito's model in Sprague-Dawley rats. Methods: The amount and activity of CYP were assessed by biochemical and immunohistochemical methods in week 8.The correlation between CYP expression and microsomal oxidative stress was investigated by comparing the generation of microsomal lipid peroxidation in the presence or absence of specific CYP inhibitor. Results: In the DEN-2-AAF and 2-AAF alone groups, the expression of CYP1A1 and CYP2E1 were up-regulated and the expression of CYP2B 1/2 and CYP1A2 were quite the contrary. Strong staining of CYP2E1 and CYP2B1/2 was found around the centrolobular vein and weak staining in the altered hepatic foci revealed by immunohistochemical procedure.There was no significant change in the activity of CYP3A among the 4 groups.Altered hepatic tissue bore more microsomal NADPH (nicotinamide adenine dimucleotide phosphate,reduced form)-dependent lipid peroxidation than normal tissue. And the difference among the 4 groups disappeared when CYP2E1 was inhibited. More microsomal lipid peroxidation was generated when incubated with CYP1A inhibitor α-naphthoflavone. Conclusion: CYP altered their expression levels and these alterations can play important roles in the alteration of cell redox status of preneoplastic tissue in the early stage of hepatocarcinogenesis.

  18. Proton NMR study of water permeability of hepatocyte membrane

    It is known that Nuclear Magnetic Resonance (NMR) relaxation methods may provide useful information regarding the permeability of the cell membrane. In the case of erythrocyte membrane, the NMR relaxation methods put in evidence the permeability changes due to different diseases or to chronic internal irradiation. The aim of this work was to investigate the water transport across the normal and oncological stressed hepatocyte membrane and to evaluate in which extend the T2 - NMR may reveal permeability changes due to the oncological factor. Isolated hepatocytes were obtained from Wistar male rat liver using a two phase perfusion technique with collagenase. The oncogenic stress was induced by acute administration of 2 - acetaminofluorene (2-AAF), 20 mg per body weight, twice in 48 hours before liver extraction. The cell viability after isolation was assessed by trypan blue exclusion. The NMR measurements were carried out on hepatocytes suspension doped with a relaxation agent (8 mM Mn Cl2). The transversal relaxation functions were determined for temperatures within the range 7 - 40 deg. C, using the standard CPMG pulse sequence. For all investigated temperatures the relaxation curves have a biexponential behavior corresponding to the water exchange between inner (A) and outer (B) cell compartments. The apparent relaxation times, T2A, T2B were obtained from experimental data via Singular Value Decomposition fitting and were used to determine experimentally the mean lifetime value of water molecules inside the liver cells. Since T may be directly related to the permeability of the membrane by P = (V/A)/T, it results that the oncogenic stress induces an increase of membrane water permeability accompanied by the change of activation energy. Therefore one may conclude that the acute administration of 2 - AAF induces conformation changes of the membrane structure which significantly affects the water transport process across the membrane

  19. Two novel EHEC/EAEC hybrid strains isolated from human infections.

    Rita Prager

    Full Text Available The so far highest number of life-threatening hemolytic uremic syndrome was associated with a food-borne outbreak in 2011 in Germany which was caused by an enterohemorrhagic Escherichia coli (EHEC of the rare serotype O104:H4. Most importantly, the outbreak strain harbored genes characteristic of both EHEC and enteroaggregative E. coli (EAEC. Such strains have been described seldom but due to the combination of virulence genes show a high pathogenicity potential. To evaluate the importance of EHEC/EAEC hybrid strains in human disease, we analyzed the EHEC strain collection of the German National Reference Centre for Salmonella and other Bacterial Enteric Pathogens (NRC. After exclusion of O104:H4 EHEC/EAEC strains, out of about 2400 EHEC strains sent to NRC between 2008 and 2012, two strains exhibited both EHEC and EAEC marker genes, specifically were stx2 and aatA positive. Like the 2011 outbreak strain, one of the novel EHEC/EAEC harbored the Shiga toxin gene type stx2a. The strain was isolated from a patient with bloody diarrhea in 2010, was serotyped as O59:H-, belonged to MLST ST1136, and exhibited genes for type IV aggregative adherence fimbriae (AAF. The second strain was isolated from a patient with diarrhea in 2012, harbored stx2b, was typed as Orough:H-, and belonged to MLST ST26. Although the strain conferred the aggregative adherence phenotype, no known AAF genes corresponding to fimbrial types I to V were detected. In summary, EHEC/EAEC hybrid strains are currently rarely isolated from human disease cases in Germany and two novel EHEC/EAEC of rare serovars/MLST sequence types were characterized.

  20. Intra- and inter-laboratory validation of an innovative huFcεRIα-RBL-2H3 degranulation assay for in vitro allergenicity assessment of whey hydrolysates.

    Knipping, Karen; van Roest, Manon; Kruijssen, Laura; Smits, Mieke; Teunis, Marc; Cox, Linda; de Jong, Niels; Simons, Peter J; Boon, Louis; Teshima, Reiko; Gros, Marjan; Kegler, Diane; Garssen, Johan; Knippels, Léon M J; Pieters, Raymond


    Cow's milk-derived whey hydrolysates are milk substitutes for cow's milk allergic infants. Safety assessment of these hydrolysates is crucial. Currently, huFcεRIα-RBL-2H3 cells, sensitized with serum IgE from cow's milk allergic patients, are used to assess in vitro residual allergenicity. However, limited availability and high inter-lot variation of sera impede the standardization of safety testing. Recently, we generated an oligoclonal pool of chimeric human (chu)IgE antibodies against bovine β-lactoglobulin (BLG) as an alternative for human serum. These antibodies demonstrated increased sensitivity, specificity and reproducibility. An inter-laboratory ring trial using our new degranulation assay with different whey-based hydrolysates was performed at four independent laboratories to investigate the robustness and reproducibility. RBL-2H3 cells expressing huFcεRIα were sensitized with our oligoclonal pool of anti-BLG chuIgE antibodies. The cells were subsequently incubated with an amino-acid based formula (AAF), two extensively hydrolyzed formulas (eHF) and three partially hydrolyzed formulas (pHF) to assess the degranulation upon challenge. Results demonstrated a very strong inter-laboratory correlation and the intra- and inter-laboratory variations were acceptable. The AAF and both eHFs showed no degranulation, whereas all pHFs demonstrated degranulation. The study showed that this degranulation assay is robust and reproducible within and between laboratories. This new in vitro degranulation assay seems predictive for allergenicity outcome and might therefore be considered as a relevant substitute for animal models. PMID:26921666

  1. Chemically induced immunotoxicity in a medium-term multiorgan bioassay for carcinogenesis with Wistar rats

    A variety of chemicals can adversely affect the immune system and influence tumor development. The modifying potential of chemical carcinogens on the lymphoid organs and cytokine production of rats submitted to a medium-term initiation-promotion bioassay for carcinogenesis was investigated. Male Wistar rats were sequentially initiated with N-nitrosodiethylamine (DEN), N-methyl-N-nitrosourea (MNU), N-butyl-N-(4hydroxybutyl)nitrosamine (BBN), dihydroxy-di-n-propylnitrosamine (DHPN), and 1,2-dimethylhydrazine (DMH) during 4 weeks. Two initiated groups received phenobarbital (PB) or 2-acetylaminofluorene (2-AAF) for 25 weeks and two noninitiated groups received only PB or 2-AAF. A nontreated group was used as control. Lymphohematopoietic organs, liver, kidneys, lung, intestines, and Zymbal's gland were removed for histological analysis. Interleukin (IL)-2, IL-12, interferon gamma (IFN-γ), tumor necrosis factor alpha (TNF-α), IL-10, and transforming growth factor beta1 (TGF-β1) levels were determined by ELISA in spleen cell culture supernatants. At the fourth week, exposure to the initiating carcinogens resulted in cell depletion of the thymus, spleen and bone marrow, and impairment of IL-2, IL-12, and IFN-γ production. However, at the 30th week, no important alterations were observed both in lymphoid organs and cytokine production in the different groups. The results indicate that the initiating carcinogens used in the present protocol exert toxic effects on the lymphoid organs and affect the production of cytokines at the initiation step of carcinogenesis. This early and reversible depression of the immune surveillance may contribute to the survival of initiated cells facilitating the development of future neoplasia

  2. Hepatic Progenitor Cells Contribute to the Progression of 2-Acetylaminofluorene/Carbon Tetrachloride-Induced Cirrhosis via the Non-Canonical Wnt Pathway.

    Jiamei Chen

    Full Text Available Hepatic progenitor cells (HPCs appear to play an important role in chronic liver injury. In this study, cirrhosis was induced in F-344 rats (n = 32 via subcutaneous injection of 50% carbon tetrachloride (CCl4 twice a week for 8 weeks. Then, 30% CCl4 was administered in conjunction with intragastric 2-acetylaminofluorine (2-AAF for 4 weeks to induce activation of HPCs. WB-F344 cells were used to provide direct evidence for differentiation of HPCs to myofibroblasts. The results showed that after administration of 2-AAF, the hydroxyproline content and the expressions of α-SMA, Col I, Col IV, TGF-β1, CD68, TNF-α, CK19 and OV6 were significantly increased. OV6 and α-SMA were largely co-expressed in fibrous septum and the expressions of Wnt5b, frizzled2, frizzled3 and frizzled6 were markedly increased, while β-catenin expression was not statistically different among the different groups. Consistent with the above results, WB-F344 cells, treated with TGF-β1 in vitro, differentiated into myofibroblasts and α-SMA, Col I, Col IV, Wnt5b and frizzled2 expressions were significantly increased, while β-catenin expression was decreased. After blocking the non-canonical Wnt pathway via WIF-1, the Wnt5b level was down regulated, and α-SMA and F-actin expressions were significantly decreased in the WIF-1-treated cells. In conclusion, these results indicate that HPCs appear to differentiate into myofibroblasts and exhibit a profibrotic effect in progressive cirrhosis via activation of the non-canonical Wnt pathway. Blocking the non-canonical Wnt pathway can inhibit the differentiation of HPCs into myofibroblasts, suggesting that blocking this pathway and changing the fate of differentiated HPCs may be a potential treatment for cirrhosis.

  3. Hepatic Progenitor Cells Contribute to the Progression of 2-Acetylaminofluorene/Carbon Tetrachloride-Induced Cirrhosis via the Non-Canonical Wnt Pathway.

    Chen, Jiamei; Zhang, Xiao; Xu, Ying; Li, Xuewei; Ren, Shuang; Zhou, Yaning; Duan, Yuyou; Zern, Mark; Zhang, Hua; Chen, Gaofeng; Liu, Chenghai; Mu, Yongping; Liu, Ping


    Hepatic progenitor cells (HPCs) appear to play an important role in chronic liver injury. In this study, cirrhosis was induced in F-344 rats (n = 32) via subcutaneous injection of 50% carbon tetrachloride (CCl4) twice a week for 8 weeks. Then, 30% CCl4 was administered in conjunction with intragastric 2-acetylaminofluorine (2-AAF) for 4 weeks to induce activation of HPCs. WB-F344 cells were used to provide direct evidence for differentiation of HPCs to myofibroblasts. The results showed that after administration of 2-AAF, the hydroxyproline content and the expressions of α-SMA, Col I, Col IV, TGF-β1, CD68, TNF-α, CK19 and OV6 were significantly increased. OV6 and α-SMA were largely co-expressed in fibrous septum and the expressions of Wnt5b, frizzled2, frizzled3 and frizzled6 were markedly increased, while β-catenin expression was not statistically different among the different groups. Consistent with the above results, WB-F344 cells, treated with TGF-β1 in vitro, differentiated into myofibroblasts and α-SMA, Col I, Col IV, Wnt5b and frizzled2 expressions were significantly increased, while β-catenin expression was decreased. After blocking the non-canonical Wnt pathway via WIF-1, the Wnt5b level was down regulated, and α-SMA and F-actin expressions were significantly decreased in the WIF-1-treated cells. In conclusion, these results indicate that HPCs appear to differentiate into myofibroblasts and exhibit a profibrotic effect in progressive cirrhosis via activation of the non-canonical Wnt pathway. Blocking the non-canonical Wnt pathway can inhibit the differentiation of HPCs into myofibroblasts, suggesting that blocking this pathway and changing the fate of differentiated HPCs may be a potential treatment for cirrhosis. PMID:26087010

  4. Importance of quantification of local site effects based on wave propagation in seismic microzonation

    S Kumar; J P Narayan


    This paper presents the three most important aspects of seismic microzonation namely prediction of fundamental frequency (F0) of soil deposit, aggravation factor (aggravation factor is simply the extra spectral amplification due to complex 2D site effects over the 1D response of the soil column) and the spatial variability of the ground motion caused by the basin-edge induced Love waves. The predicted F0 of single, double and three-soil-layered models revealed that the available empirical relations to predict the F0 of layered soil deposits are inadequate. We recommend the use of analytical or numerical methods to predict such an important parameter based on wave propagation effects. An increase of amplitude of Love wave, strain level and average aggravation factor (AAF) with increase of impedance contrast was obtained. Based on the trend of rate of decrease of AAF and maximum strain with offset from the basin-edge, we can qualitatively infer that the effects of induced Love wave may reduce to a negligible value after a traveled distance of 6.5–10.0 (where is the wavelength corresponding to the 0 of soil layer). The obtained increase of strain level with the decrease of distance between two receiver points used for the computation of strain reflects that structures having spatial extent smaller than the may suffer damage due to the basin-edge induced surface waves. The fast rate of decrease of strain with the offset from the strong lateral discontinuity (SLD)/basin-edge may be attributed to the dispersive nature of Love wave. We can incorporate the increased spectral amplification due to the induced surface waves in the form of aggravation factor but till date we have no effective way to incorporate the effects of developed strain by induced surface waves in seismic microzonation or in building codes.




    Full Text Available The present study was conducted to prepare oil emulsified (OE infectious bronchitis (IB experimental vaccines. The vaccines were prepared using the vaccinal strain H-120 Infectious Bonchitis virus (IBV. The virus was cultivated in 9-day old embryonated eggs via allantoic cavity route. Allantoic-amniotic fluid (AAF was collected and inactivated with formalin @ 0.12%. Water in oil emulsion was prepared by adding one part of AAF to four parts of mineral oil containing water phase (Tween 80 and oil phase (Span 80 surfactants. Hydrophile lypohile balance (HLB of the emulsion was maintained at 7.0. Two oil emulsified experimental vaccines were prepared. Vaccine-I was prepared without vitamin E and Vaccine-II with vitamin E (300 mg/ml. A total of 120 day-old broiler breeder chickens were divided into 4 groups, A, B, C, and D, each having 30 birds. At the age of 21 days, experimental Vaccine-I, experimental vaccine-II and commercial IB killed (H-120 vaccine were inoculated @ 0.5 ml in the birds of groups A, B and C, respectively. Group D was maintained as nonvaccinated control. Efficacy of the vaccines was evaluated on the basis of humoral immune response (haemagglutination inhibition antibody titres against IB in the four groups. The seven weeks cumulative mean antibody titres (CMT of each group were calculated. The highest CMT was observed in group B (130, followed by group C (69, group A (58 and group D (17. Statistical analysis showed that haemagglutination inhibition (HI antibody titres in group B (vaccine- II were significantly higher than those of groups A, B and C (P< 0.05.

  6. Allergic proctocolitis refractory to maternal hypoallergenic diet in exclusively breast-fed infants: a clinical observation

    Frediani Simone


    Full Text Available Abstract Background Allergic proctocolitis (APC in exclusively breast-fed infants is caused by food proteins, deriving from maternal diet, transferred through lactation. In most cases a maternal cow milk-free diet leads to a prompt resolution of rectal bleeding, while in some patients a multiple food allergy can occur. The aim of this study was to assess whether the atopy patch test (APT could be helpful to identify this subgroup of patients requiring to discontinue breast-feeding due to polisensitization. Additionally, we assessed the efficacy of an amino acid-based formula (AAF when multiple food allergy is suspected. amino acid-based formula Methods We have prospectively enrolled 14 exclusively breast-fed infants with APC refractory to maternal allergen avoidance. The diagnosis was confirmed by endoscopy with biopsies. Skin prick tests and serum specific IgE for common foods, together with APTs for common foods plus breast milk, were performed. After a 1 month therapy of an AAF all patients underwent a follow-up rectosigmoidoscopy. Results Prick tests and serum specific IgE were negative. APTs were positive in 100% infants, with a multiple positivity in 50%. Sensitization was found for breast milk in 100%, cow's milk (50%, soy (28%, egg (21%, rice (14%, wheat (7%. Follow-up rectosigmoidoscopy confirmed the remission of APC in all infants. Conclusions These data suggest that APT might become a useful tool to identify subgroups of infants with multiple gastrointestinal food allergy involving a delayed immunogenic mechanism, with the aim to avoid unnecessary maternal dietary restrictions before discontinuing breast-feeding.

  7. An investigation of the diversity of strains of enteroaggregative Escherichia coli isolated from cases associated with a large multi-pathogen foodborne outbreak in the UK.

    Timothy J Dallman

    Full Text Available Following a large outbreak of foodborne gastrointestinal (GI disease, a multiplex PCR approach was used retrospectively to investigate faecal specimens from 88 of the 413 reported cases. Gene targets from a range of bacterial GI pathogens were detected, including Salmonella species, Shigella species and Shiga toxin-producing Escherichia coli, with the majority (75% of faecal specimens being PCR positive for aggR associated with the Enteroaggregative E. coli (EAEC group. The 20 isolates of EAEC recovered from the outbreak specimens exhibited a range of serotypes, the most frequent being O104:H4 and O131:H27. None of the EAEC isolates had the Shiga toxin (stx genes. Multilocus sequence typing and single nucleotide polymorphism analysis of the core genome confirmed the diverse phylogeny of the strains. The analysis also revealed a close phylogenetic relationship between the EAEC O104:H4 strains in this outbreak and the strain of E. coli O104:H4 associated with a large outbreak of haemolytic ureamic syndrome in Germany in 2011. Further analysis of the EAEC plasmids, encoding the key enteroaggregative virulence genes, showed diversity with respect to FIB/FII type, gene content and genomic architecture. Known EAEC virulence genes, such as aggR, aat and aap, were present in all but one of the strains. A variety of fimbrial genes were observed, including genes encoding all five known fimbrial types, AAF/1 to AAF/V. The AAI operon was present in its entirety in 15 of the EAEC strains, absent in three and present, but incomplete, in two isolates. EAEC is known to be a diverse pathotype and this study demonstrates that a high level of diversity in strains recovered from cases associated with a single outbreak. Although the EAEC in this study did not carry the stx genes, this outbreak provides further evidence of the pathogenic potential of the EAEC O104:H4 serotype.

  8. Effect of Oenanthe Javanica Extract on Antioxidant Enzyme in the Rat Liver

    Choong-Hyun Lee; Joon-Ha Park; Jeong-Hwi Cho; In-Hye Kim; Ji-Hyeon Ahn; Jae-Chul Lee; Bai Hui Chen


    Background:Oenanthe javanica (O.javanica) has been known to have high antioxidant properties via scavenging reactive oxygen species.We examined the effect of O.javanica extract (OJE) on antioxidant enzymes in the rat liver.Methods:We examined the effect of the OJE on copper,zinc-superoxide dismutase (SOD1),manganese superoxide dismutase (SOD2),catalase (CAT),and glutathione peroxidase (GPx) in the rat liver using immunohistochemistry and western blot analysis.Sprague-Dawley rats were randomly assigned to three groups;(1) normal diet fed group (normal-group),(2) diet containing ascorbic acid (AA)-fed group (AA-group) as a positive control,(3) diet containing OJE-fed group (OJE-group).Results:In this study,no histopathological finding in the rat liver was found in all the experimental groups.Numbers of SOD1,SOD2,CAT,and GPx immunoreactive cells and their protein levels were significantly increased in the AA-fed group compared with those in the normal-group.On the other hand,in the OJE-group,numbers of SOD1,SOD2,CAT,and GPx immunoreactive cells in the liver were significantly increased by about 190%,478%,685%,and 346%,respectively,compared with those in the AA-group.In addition,protein levels of SOD 1,SOD2,CAT,and GPx in the OJE-group were also significantly much higher than those in the AA-group.Conclusion:OJE significantly increased expressions of SOD 1 and SOD2,CAT,and GPx in the liver cells of the rat,and these suggests that significant enhancements of endogenous enzymatic antioxidants by OJE might be a legitimate strategy for decreasing oxidative stresses in the liver.

  9. Knowledge About Sounds-Context-Specific Meaning Differently Activates Cortical Hemispheres, Auditory Cortical Fields, and Layers in House Mice.

    Geissler, Diana B; Schmidt, H Sabine; Ehret, Günter


    Activation of the auditory cortex (AC) by a given sound pattern is plastic, depending, in largely unknown ways, on the physiological state and the behavioral context of the receiving animal and on the receiver's experience with the sounds. Such plasticity can be inferred when house mouse mothers respond maternally to pup ultrasounds right after parturition and naïve females have to learn to respond. Here we use c-FOS immunocytochemistry to quantify highly activated neurons in the AC fields and layers of seven groups of mothers and naïve females who have different knowledge about and are differently motivated to respond to acoustic models of pup ultrasounds of different behavioral significance. Profiles of FOS-positive cells in the AC primary fields (AI, AAF), the ultrasonic field (UF), the secondary field (AII), and the dorsoposterior field (DP) suggest that activation reflects in AI, AAF, and UF the integration of sound properties with animal state-dependent factors, in the higher-order field AII the news value of a given sound in the behavioral context, and in the higher-order field DP the level of maternal motivation and, by left-hemisphere activation advantage, the recognition of the meaning of sounds in the given context. Anesthesia reduced activation in all fields, especially in cortical layers 2/3. Thus, plasticity in the AC is field-specific preparing different output of AC fields in the process of perception, recognition and responding to communication sounds. Further, the activation profiles of the auditory cortical fields suggest the differentiation between brains hormonally primed to know (mothers) and brains which acquired knowledge via implicit learning (naïve females). In this way, auditory cortical activation discriminates between instinctive (mothers) and learned (naïve females) cognition. PMID:27013959

  10. Knowledge about Sounds – Context-Specific Meaning Differently Activates Cortical Hemispheres, Auditory Cortical Fields and Layers in House Mice

    Diana B. Geissler


    Full Text Available Activation of the auditory cortex (AC by a given sound pattern is plastic, depending, in largely unknown ways, on the physiological state and the behavioral context of the receiving animal and on the receiver's experience with the sounds. Such plasticity can be inferred when house mouse mothers respond maternally to pup ultrasounds right after parturition and naïve females have to learn to respond. Here we use c-FOS immunocytochemistry to quantify highly activated neurons in the AC fields and layers of seven groups of mothers and naïve females who have different knowledge about and are differently motivated to respond to acoustic models of pup ultrasounds of different behavioral significance. Profiles of FOS-positive cells in the AC primary fields (AI, AAF, the ultrasonic field (UF, the secondary field (AII, and the dorsoposterior field (DP suggest that activation reflects in AI, AAF, and UF the integration of sound properties with animal state-dependent factors, in the higher-order field AII the news value of a given sound in the behavioral context, and in the higher-order field DP the level of maternal motivation and, by left-hemisphere activation advantage, the recognition of the meaning of sounds in the given context. Anesthesia reduced activation in all fields, especially in cortical layers 2/3. Thus, plasticity in the AC is field-specific preparing different output of AC fields in the process of perception, recognition and responding to communication sounds. Further, the activation profiles of the auditory cortical fields suggest the differentiation between brains hormonally primed to know (mothers and brains which acquired knowledge via implicit learning (naïve females. In this way, auditory cortical activation discriminates between instinctive (mothers and learned (naïve females cognition.

  11. Fluctuation phenomena for dissipative processes in 19 F + 27 Al system

    Non-statistical fluctuations in the excitation functions (EF) of dissipative heavy ion collisions (DHIC) were rather unexpected, the cross sections being always obtained on a 'coarse cell' of total kinetic energy and center of mass angle (θcm). Since the experimental fluctuations in the EF for DHIC have been evidenced, the time evolution of dinuclear system (DNS) with different mass asymmetries and total mass ≤108 has been investigated only by statistical analysis. Although many theoretical interpretations of excitation function fluctuations ground their assumptions on the observed large angular correlation, the experimental angular correlation data are rather scarce. We already reported preliminary results concerning angular correlation for DHIC in the 19 F + 27 Al interaction. In the present work the angular correlation analysis was realized for Elab = 116.75 - 129.75 MeV with a 2 angle binning in the angular distributions and total kinetic energy loss (TKEL) windows of 20±2.5, 30±2.5 and 40±2.5 MeV. Pronounced oscillations in the angular distributions, at some incident energies, were observed. These oscillations are nicely evidenced in the autocorrelation angular functions (AAF) as determined for fragments with atomic number Z = 8 at an incident energy 124.75 MeV. A decreasing number of the oscillations with increasing TKEL value could be observed. The AAFs were calculated using for the average cross section the value obtained from the fit of the angular distributions with formula: sigma/dθcm ∝ [exp(-θcm/ω·τ) + exp(-(2π-θcm)/ω·τ)], where ω and τ are the angular velocity and lifetime of DNS, respectively. The moving Gaussian procedure was used for calculating the angular cross correlation coefficients C(θ,θ') for the energy averaged cross section . The results are presented. Large values for C(θ,θ') with an oscillating pattern were obtained for all studied fragments (Z = 6-8, 10). An increasing trend of C(θ,θ') values with TKEL could be

  12. Relative cost-effectiveness of an extensively hydrolyzed casein formula containing the probiotic Lactobacillus rhamnosus GG in managing infants with cow's milk allergy in Italy

    Guest JF


    Full Text Available Julian F Guest,1,2 Monica Panca,1 Olga Ovcinnikova,1 Rita Nocerino3 1CATALYST Health Economics Consultants, Northwood, Middlesex, UK; 2Faculty of Life Sciences and Medicine, King's College, London, UK; 3Department of Translational Medical Science, Pediatric Section, University of Naples 'Federico II', Naples, Italy Objective: To estimate the cost-effectiveness of using an extensively hydrolyzed casein formula (eHCF containing the probiotic Lactobacillus rhamnosus GG, (eHCF + LGG; Nutramigen LGG as first-line management for cow's milk allergy (CMA compared with eHCF alone, soy-based formulae (SBF, hydrolyzed rice formulae (HRF, and amino acid formulae (AAF in Italy, from the perspective of the Italian National Health Service (INHS and parents. Methods: Decision modeling was used to estimate the probability of infants developing tolerance to cow's milk by 18 months, based on an observational study dataset. The model also estimated the cost (at 2012/2013 prices of health care resource use funded by the INHS and formulae paid for by parents over 18 months after starting a formula, as well as the relative cost-effectiveness of each of the formulae. Results: The probability of developing tolerance to cow's milk by 18 months was higher among infants with either IgE-mediated or non-IgE-mediated allergy who were fed eHCF + LGG compared to those fed one of the other formulae. The total health care cost of initially feeding infants with eHCF + LGG was less than that of feeding infants with one of the other formulae. Hence, eHCF + LGG affords the greatest value for money to both the INHS and parents of infants with either IgE-mediated or non-IgE-mediated CMA. Conclusion: Using eHCF + LGG instead of eHCF, SBF, HRF, or an AAF for first-line management of newly diagnosed infants with CMA in Italy affords a cost-effective use of publicly funded resources, and is cost-effective from the parents' perspective, since it improves outcome for less cost. A randomized

  13. RACORO long-term, systematic aircraft observations of boundary layer clouds

    Vogelmann, A.M.; McFarquhar, G.; Ogren, J.; Turner, D. D.; Comstock, J. M.; Feingold, G.; Long, C. N.; Jonsson, H. H.; Bucholtz, A.; Collins, D. R.; Diskin, G.; Gerber, H.; Lawson, R. P.; Woods, R. K.; Hubbe, J.; Tomlinson, J.; Schmid, B.


    Our knowledge of boundary layer cloud processes is insufficient to resolve pressing scientific problems. Boundary layer clouds often have liquid-water paths (LWPs) less than 100 gm{sup 2}, which are defined here as being 'thin' Clouds with Low Optical Water Depths (CLOWD). This type of cloud is common globally, and the Earth's radiative energy balance is particularly sensitive to small changes in their optical properties. However, it is difficult to retrieve accurately their cloud properties via remote sensing because they are tenuous and often occur in partly cloudy skies. This interferes with our ability to obtain the routine, long-term statistics needed to improve their representation in climate models. To address this problem, in-situ data are needed to investigate cloud processes and to evaluate and refine existing retrieval algorithms. Coordinated by the ARM Aerial Facility (AAF), the Routine AAF CLOWD Optical Radiative Observations (RACORO) field campaign conducted long-term, systematic flights in boundary layer, liquid-water clouds over the ARM Southern Great Plains (SGP) site between 22 January and 30 June 2009. This was the first time that a long-term aircraft campaign was undertaken for systematic in-situ sampling of cloud properties. Using the CIRPAS Twin Otter aircraft equipped with a comprehensive set of instruments to measure solar and thermal radiation, cloud microphysics, aerosol properties and atmospheric state, the RACORO team logged an unprecedented 59 flights and 259 research hours above the SGP site. Data gathered during the RACORO campaign will provide researchers with a statistically relevant data set of boundary-layer cloud and aerosol properties for future study. These data can be used to validate retrieval algorithms and support process studies and model simulations of boundary layer clouds and, in particular, CLOWD-type clouds. In addition to cloud observations, complementary clear-sky flight patterns were conducted to map

  14. Lack of effect of furfural on unscheduled DNA synthesis in the in vivo rat and mouse hepatocyte DNA repair assays and in precision-cut human liver slices.

    Lake, B G; Edwards, A J; Price, R J; Phillips, B J; Renwick, A B; Beamand, J A; Adams, T B


    The ability of furfural to induce unscheduled DNA synthesis (UDS) in hepatocytes of male and female B6C3F(1) mice and male F344 rats after in vivo administration and in vitro in precision-cut human liver slices has been studied. Preliminary toxicity studies established the maximum tolerated dose (MTD) of furfural to be 320 and 50 mg/kg in the mouse and rat, respectively. Furfural was dosed by gavage at levels of 0 (control), 50, 175 and 320 mg/kg to male and female mice and 0, 5, 16.7 and 50 mg/kg to male rats. Hepatocytes were isolated by liver perfusion either 2-4 h or 12-16 h after treatment, cultured in medium containing [3H]thymidine for 4 h and assessed for UDS by grain counting of autoradiographs. Furfural treatment did not produce any statistically significant increase or any dose-related effects on UDS in mouse and rat hepatocytes either 2-4 h or 12-16 h after dosing. In contrast, UDS was markedly induced in mice and rats 2-4 h after treatment with 20 mg/kg dimethylnitrosamine and 12-16 h after treatment of mice and rats with 200 mg/kg o-aminoazotoluene and 50 mg/kg 2-acetylaminofluorene (2-AAF), respectively. Precision-cut human liver slices from four donors were cultured for 24 h in medium containing [3H]thymidine and 0-10 mM furfural. Small increases in the net grain count (i.e. nuclear grain count less mean cytoplasmic grain count) observed with 2-10 mM furfural were not due to any increase in the nuclear grain count. Rather, it was the result of concentration-dependent decreases in the mean cytoplasmic grain counts and to a lesser extent in nuclear grain counts, due to furfural-induced cytotoxicity. In contrast, marked increases in UDS (both net grain and nuclear grain counts) were observed in human liver slices treated with 0.02 and 0.05 mM 2-AAF, 0.002 and 0.02 mM aflatoxin B(1) and 0.005 and 0.05 mM 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine. This study demonstrates that furfural does not induce UDS in the hepatocytes of male and female B6C3F

  15. Lability of the pAA Virulence Plasmid in Escherichia coli O104:H4: Implications for Virulence in Humans.

    Wenlan Zhang

    Full Text Available Escherichia coli O104:H4 that caused the large German outbreak in 2011 is a highly virulent hybrid of enterohemorrhagic (EHEC and enteroaggregative (EAEC E. coli. The strain displays "stacked-brick" aggregative adherence to human intestinal epithelial cells mediated by aggregative adherence fimbriae I (AAF/I encoded on the pAA plasmid. The AAF/I-mediated augmented intestinal adherence might facilitate systemic absorption of Shiga toxin, the major virulence factor of EHEC, presumably enhancing virulence of the outbreak strain. However, the stability of pAA in the outbreak strain is unknown. We therefore tested outbreak isolates for pAA, monitored pAA loss during infection, and determined the impact of pAA loss on adherence and clinical outcome of infection.E. coli O104:H4 outbreak isolates from 170 patients (128 with hemolytic uremic syndrome [HUS] and 42 with diarrhea without HUS were tested for pAA using polymerase chain reaction and plasmid profiling. pAA-harboring bacteria in stool samples were quantified using colony blot hybridization, and adherence to HCT-8 cells was determined. Isolates from 12 (7.1% patients lacked pAA. Analyses of sequential stool samples demonstrated that the percentages of pAA-positive populations in the initial stools were significantly higher than those in the follow-up stools collected two to eight days later in disease (P≤0.01. This indicates a rapid loss of pAA during infections of humans. The pAA loss was associated with loss of the aggregative adherence phenotype and significantly reduced correlation with HUS (P  = 0.001.The pAA plasmid can be lost by E. coli O104:H4 outbreak strain in the human gut in the course of disease. pAA loss might attenuate virulence and diminish the ability to cause HUS. The pAA instability has clinical, diagnostic, epidemiologic, and evolutionary implications.

  16. In Silico Modeling of Gastrointestinal Drug Absorption: Predictive Performance of Three Physiologically Based Absorption Models.

    Sjögren, Erik; Thörn, Helena; Tannergren, Christer


    Gastrointestinal (GI) drug absorption is a complex process determined by formulation, physicochemical and biopharmaceutical factors, and GI physiology. Physiologically based in silico absorption models have emerged as a widely used and promising supplement to traditional in vitro assays and preclinical in vivo studies. However, there remains a lack of comparative studies between different models. The aim of this study was to explore the strengths and limitations of the in silico absorption models Simcyp 13.1, GastroPlus 8.0, and GI-Sim 4.1, with respect to their performance in predicting human intestinal drug absorption. This was achieved by adopting an a priori modeling approach and using well-defined input data for 12 drugs associated with incomplete GI absorption and related challenges in predicting the extent of absorption. This approach better mimics the real situation during formulation development where predictive in silico models would be beneficial. Plasma concentration-time profiles for 44 oral drug administrations were calculated by convolution of model-predicted absorption-time profiles and reported pharmacokinetic parameters. Model performance was evaluated by comparing the predicted plasma concentration-time profiles, Cmax, tmax, and exposure (AUC) with observations from clinical studies. The overall prediction accuracies for AUC, given as the absolute average fold error (AAFE) values, were 2.2, 1.6, and 1.3 for Simcyp, GastroPlus, and GI-Sim, respectively. The corresponding AAFE values for Cmax were 2.2, 1.6, and 1.3, respectively, and those for tmax were 1.7, 1.5, and 1.4, respectively. Simcyp was associated with underprediction of AUC and Cmax; the accuracy decreased with decreasing predicted fabs. A tendency for underprediction was also observed for GastroPlus, but there was no correlation with predicted fabs. There were no obvious trends for over- or underprediction for GI-Sim. The models performed similarly in capturing dependencies on dose and

  17. Evaluation of hydro-alcoholic extract of Eclipta alba for its multidrug resistance reversal potential: an in vitro study.

    Chaudhary, Harshita; Jena, Prasant Kumar; Seshadri, Sriram


    The development of multidrug resistance (MDR) causes problems in the chemotherapy of human cancer. The present study was designed to evaluate and establish the role of Eclipta alba as MDR reversal agent using multidrug resistant hepatocellular carcinoma cell line (DR-HepG2). To develop DR-HepG2, hepatocellular carcinoma cell line (HepG2) was transfected with 2-Acetylaminofluorene (AAF) and Aflatoxin B1 (AFB). Cytotoxic effects of the Eclipta alba hydroalcoholic extract (EAE) and standard anti-ancer drug Doxorubicin (DOX) were determined in DR-HepG2 and the parental cells HepG2 using MTT assay. The expression level of MDR1 gene and P-glycoprotein (P-gp) level was analyzed by RT-PCR and western blotting. From the present investigation, it was found that EAE (10 and 20 μg/ml) could significantly inhibit cell proliferation in DR-HepG2 whereas DOX (0.5 μg/ml) could not because of enhancement effect of MDR1/P-gp. This study demonstrated for the first time the antiproliferative activities of EAE in multidrug resistant DR-HepG2 cells. The findings revealed that Eclipta alba components are effective inhibitors of MDR1/P-gp. PMID:23859045

  18. Oenanthe javanica extract increases immunoreactivities of antioxidant enzymes in the rat kidney

    Hyun-Jin Tae; Joon Ha Park; Jeong-Hwi Cho; In Hye Kim; Ji Hyeon Ahn; Jae Chul Lee; Jong-Dai Kim


    Background Oenanthe javanica is an aquatic perennial herb originated from East Asia.Nowadays,the effects of Oenanthe javanica have been proven in various disease models.Studies regarding the antioxidant effect of Oenanthe javanica in the kidney are still unclear.Methods This study was therefore performed to investigate the effect of the Oenanthe javanica extract (OJE) in the rat kidney using immunohistochemistry for antioxidant enzymes,copper,zinc-superoxide dismutase (SOD1),manganese superoxide dismutase (SOD2),catalase (CAT) and glutathione peroxidase (GPx).Sprague-Dawley rats were randomly assigned to three groups:(1) normal diet fed-group (normal-group),(2) diet containing ascorbic acid (AA)-fed group (AA-group) as a positive control,(3) diet containing OJE-fed group (OJE-group).AA and OJE were supplied during 28 days.Results The side-effects were not observed in all the groups.Immunoreactivities of SOD1,SOD2,CAT and GPx were easily detected in the distal tubules of the kidney,and their immunoreactivities in the AA-and OJE-groups were increased to about 1.4-1.5 times and 2 times,respectively,compared with those in the normal-group.Conclusion OJE significantly increased expressions of SOD1 & 2,CAT and GPx immunoreactivities in the distal tubules of the rat kidney,and this finding suggests that significant enhancements of endogenous enzymatic antioxidants by OJE treatment may be a legitimate strategy for decreasing oxidative stresses in the kidney.

  19. STIL2 in India - Pilot study 2012



    Sweden and India have a bilateral agreement regarding energy issues and during the spring of 2011 a number of projects were launched by the Swedish Energy Agency. One of them was the implementation of STIL2 in India. The STIL2 in India report prepared by AaF consultant for the Swedish Energy Agency aims to launch a project 'Implementation of STIL2 in India' under BEE-STEM cooperation. BEE stands for the Indian Bureau of Energy Efficiency and STEM stands for the Swedish Energy Agency. The report presents the energy use in a specific building category on national level in India. The STIL2 project as such does not render any quantifiable energy savings, rather a baseline of the energy use with objective and harmonised data output. Reference values constitute a prerequisite for quantifying change over time and full scale STIL2 implementation provides a strong set of reference values. Since the data is presented on national level it allows to show estimated and calculated energy saving potentials for the whole building stock. These results can be used to support energy efficiency, monitor progress and as a base for policy development. This is the first project of several within the BEE-STEM cooperation.

  20. Dracocephalum: Novel Anticancer Plant Acting on Liver Cancer Cell Mitochondria

    Mojtaba Talari


    Full Text Available Dracocephalum kotschyi Boiss. (Labiatae is a native Iranian medicinal plant which has been used in combination with Peganum harmala L. as a remedy for many forms of human cancer especially leukemia and gastrointestinal malignancies. Hepatocellular carcinoma (HCC is the third leading cause of cancer-related death worldwide. In this investigation HCC was induced by a single intraperitoneal injection of diethylnitrosamine (DEN in corn oil at 200 mg/kg body weight to rats. Two weeks after DEN administration, cancer development was promoted with dietary 2-acetylaminofluorene (2-AAF (0.02%, w/w for 2 weeks. Serum alpha-fetoprotein (AFP concentration, serum alanine transaminase (ALT, aspartate transaminase (AST, and alkaline phosphatase (ALP activities were also determined for confirmation of hepatocellular carcinoma induction. Then rat hepatocytes were isolated with collagen perfusion technique and tumoral hepatocytes were sorted by flow cytometry. Finally isolated mitochondria obtained from both tumoral and nontumoral hepatocytes were used for any probable toxic effect of Dracocephalum kotschyi ethanolic extract. Our results showed that D. kotschyi extract (250 µg/mL induced reactive oxygen species (ROS formation, mitochondrial membrane permeabilization (MMP, and mitochondrial swelling and cytochrome c release only in tumoral but not nontumoral hepatocyte. These findings propose Dracocephalum kotschyi as a promising candidate for future anticancer research.

  1. Inhibition of liver carcinogenesis in Wistar rats by consumption of an aqueous extract from leaves of Ardisia compressa.

    González de Mejía, E; Ramírez-Mares, M V; Arce-Popoca, E; Wallig, M; Villa-Treviño, S


    This study evaluates the chemopreventive effect of an aqueous extract of dried leaves of Ardisia compressa against liver cancer. A rat liver assay that mimics progressive forms of human disease was used as a carcinogenesis model. Forty-five male Wistar rats (180-200 g body weight) were injected intraperitoneally on day 1 with a single dose (100 mg/kg) of diethylnitrosamine (DEN), and also received via gavage 20 mg/kg acetylaminofluorene (2-AAF), on days 7, 8 and 9. The rats were randomly divided into four groups (n=15). Control groups (Group 1 and Group 2) had free access to water. Group 3 received 0.5% (w/v) of A. compressa tea for 10 days before treatment and during the study as the sole source of fluid until the rats were killed. A fourth group of 15 rats received no carcinogen or promoter but did receive 0.5%, (w/v) of A. compressa tea. All animals had 70% partial hepatectomy at day 10. The incidences of hepatocellular foci, nodules and carcinoma were significantly smaller in Group 3 than in Group 2 (P<0.01). A. compressa tea consumption alone (Group 4) did not induce the development of foci, nodules or carcinomas (P<0.01). The striking observation of this study was that consumption of A. compressa tea resulted in complete inhibition of the chemically-induced hepatocarcinogenesis in Wistar rats. PMID:14871594

  2. The cat's meow: A high-field fMRI assessment of cortical activity in response to vocalizations and complex auditory stimuli.

    Hall, Amee J; Butler, Blake E; Lomber, Stephen G


    Sensory systems are typically constructed in a hierarchical fashion such that lower level subcortical and cortical areas process basic stimulus features, while higher level areas reassemble these features into object-level representations. A number of anatomical pathway tracing studies have suggested that the auditory cortical hierarchy of the cat extends from a core region, consisting of the primary auditory cortex (A1) and the anterior auditory field (AAF), to higher level auditory fields that are located ventrally. Unfortunately, limitations on electrophysiological examination of these higher level fields have resulted in an incomplete understanding of the functional organization of the auditory cortex. Thus, the current study uses functional MRI in conjunction with a variety of simple and complex auditory stimuli to provide the first comprehensive examination of function across the entire cortical hierarchy. Auditory cortex function is shown to be largely lateralized to the left hemisphere, and is concentrated bilaterally in fields surrounding the posterior ectosylvian sulcus. The use of narrowband noise stimuli enables the visualization of tonotopic gradients in the posterior auditory field (PAF) and ventral posterior auditory field (VPAF) that have previously been unverifiable using fMRI and pure tones. Furthermore, auditory fields that are inaccessible to more invasive techniques, such as the insular (IN) and temporal (T) cortices, are shown to be selectively responsive to vocalizations. Collectively, these data provide a much needed functional correlate for anatomical examinations of the hierarchy of cortical structures within the cat auditory cortex. PMID:26658927

  3. Joint sub-carrier pairing and resource allocation for cognitive networks with adaptive relaying

    Soury, H.


    Relayed transmission in a cognitive radio (CR) environment could be used to increase the coverage and capacity of communication system that benefits already from the efficient management of the spectrum developed by CR. Furthermore, there are many types of cooperative communications, including decode-and-forward (DAF) and amplify-and-forward (AAF). In this paper, these techniques are combined in an adaptive mode to benefit from its forwarding advantages; this mode is called adaptive relaying protocol (ARP). Moreover, this work focuses on the joint power allocation in a cognitive radio system in a cooperative mode that operates ARP in multi-carrier mode. The multi-carrier scenario is used in an orthogonal frequency division multiplexing (OFDM) mode, and the problem is formulated to maximize the end-to-end rate by searching the best power allocation at the transmitters. This work includes, besides the ARP model, a sub-carrier pairing strategy that allows the relays to switch to the best sub-carrier pairs to increase the throughput. The optimization problem is formulated and solved under the interference and power budget constraints using the sub-gradient algorithm. The simulation results confirm the efficiency of the proposed adaptive relaying protocol in comparison to other relaying techniques. The results show also the consequence of the choice of the pairing strategy. 2013 Stolojescu-Crisan and Isar; licensee Springer.

  4. Relationships of Entrainment Rate with Dynamical and Thermodynamic Properties in Shallow Convection

    Lu, C.; Liu, Y.; Zhang, G. J.; Wu, X.; Endo, S.; Cao, L.; Li, Y.; Guo, X.


    This work examines the relationships of entrainment rate to vertical velocity, buoyancy, turbulent dissipation rate by applying stepwise principal component regression to observational data from shallow cumulus clouds collected during the Routine AAF [Atmospheric Radiation Measurement (ARM) Aerial Facility] Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) field campaign over the ARM Southern Great Plains (SGP) site near Lamont, Oklahoma. The cumulus clouds during the RACORO campaign simulated using a large eddy simulation (LES) model are also examined with the same approach. The analysis shows that combination of multiple variables can better represent entrainment rate in both the observations and LES than the single-variable fitting equations and the three commonly used parameterizations. A new parameterization is thus presented that relates entrainment rate to vertical velocity, buoyancy and dissipation rate; the effects of treating clouds as ensembles and humid shells surrounding cumulus clouds on the new parameterization are discussed. Physical mechanisms underlying the relationships of entrainment rate to vertical velocity, buoyancy and dissipation rate are also explored. Furthermore, the effects of relative humidity in the entrained dry air on the above relationships are discussed; a possible physical mechanism for the effects is explored.

  5. Biomass Burning Observation Project (BBOP) Final Campaign Report

    Kleinman, LI [Brookhaven National Lab. (BNL), Upton, NY (United States); Sedlacek, A. J. [Brookhaven National Lab. (BNL), Upton, NY (United States)


    The Biomass Burning Observation Project (BBOP) was conducted to obtain a better understanding of how aerosols generated from biomass fires affect the atmosphere and climate. It is estimated that 40% of carbonaceous aerosol produced originates from biomass burning—enough to affect regional and global climate. Several biomass-burning studies have focused on tropical climates; however, few campaigns have been conducted within the United States, where millions of acres are burned each year, trending to higher values and greater climate impacts because of droughts in the West. Using the Atmospheric Radiation Measurement (ARM) Aerial Facility (AAF), the BBOP deployed the Gulfstream-1 (G-1) aircraft over smoke plumes from active wildfire and agricultural burns to help identify the impact of these events and how impacts evolve with time. BBOP was one of very few studies that targeted the near-field time evolution of aerosols and aimed to obtain a process-level understanding of the large changes that occur within a few hours of atmospheric processing.

  6. Investigating the spectral characteristic and humification degree of dissolved organic matter in saline-alkali soil using spectroscopic techniques

    Li, Qiang; Guo, Xujing; Chen, Lu; Li, Yunzhen; Yuan, Donghai; Dai, Benlin; Wang, Sisi


    Soil samples were collected from the areas surrounding Wuliangsuhai Lake in China. Dissolved organic matter (DOM) was extracted from the samples and characterized by fluorescence and UV-Vis spectra. Spectral properties and humification degree of DOM were studied. The results indicated that both humic- and protein-like fluorophores were present in the DOM spectra, and the former was the dominant component. The analysis of humification (HIX) and r (A, C) indices revealed that the maximum humification degree in three agricultural soils (AAF, ASC, and ASW) was presented in the second soil layer (20‒40 cm). However, the humification degree of the two Halophytes soils (SSE and GKF) decreased with increasing depth. One index, I344/270, showed that humification degree increased gradually with an increasing proportion of humic-like acid. There was a significant positive correlation between humification degree (HIX) and aromaticity (SUVA254), indicating that a higher aromaticity corresponded to a higher humification degree. Land use was an important factor responsible for the major difference of cation exchange capacity (CEC) in different soils, which led to a higher CEC value in the second soil layer for the three agricultural soils. CEC values and humification degree had the same trend for all five soils. The correlation analysis showed that there was a significant positive correlation between HIX and CEC, and a negative correlation between the r (A, C) index and CEC, indicating that humification degree increases gradually with increasing CEC values.

  7. Integration of XRootD into the cloud infrastructure for ALICE data analysis

    Kompaniets, Mikhail; Shadura, Oksana; Svirin, Pavlo; Yurchenko, Volodymyr; Zarochentsev, Andrey


    Cloud technologies allow easy load balancing between different tasks and projects. From the viewpoint of the data analysis in the ALICE experiment, cloud allows to deploy software using Cern Virtual Machine (CernVM) and CernVM File System (CVMFS), to run different (including outdated) versions of software for long term data preservation and to dynamically allocate resources for different computing activities, e.g. grid site, ALICE Analysis Facility (AAF) and possible usage for local projects or other LHC experiments. We present a cloud solution for Tier-3 sites based on OpenStack and Ceph distributed storage with an integrated XRootD based storage element (SE). One of the key features of the solution is based on idea that Ceph has been used as a backend for Cinder Block Storage service for OpenStack, and in the same time as a storage backend for XRootD, with redundancy and availability of data preserved by Ceph settings. For faster and easier OpenStack deployment was applied the Packstack solution, which is based on the Puppet configuration management system. Ceph installation and configuration operations are structured and converted to Puppet manifests describing node configurations and integrated into Packstack. This solution can be easily deployed, maintained and used even in small groups with limited computing resources and small organizations, which usually have lack of IT support. The proposed infrastructure has been tested on two different clouds (SPbSU & BITP) and integrates successfully with the ALICE data analysis model.

  8. Detection and Cloning of a Gene Involved in Zwitermicin A Synthesis from Plant Growth Promoting Rhizobacteria of Bacillus sp CR64

    Aris Tri Wahyudi


    Full Text Available Utilization of soil bacteria as biocontrol agent is becoming popular due to its valuable and effective mechanisms to suppress plant pathogenic microbes. We have previously isolated Bacillus sp, designated as Bacillus sp CR64, which exhibited effective plant growth promoting and antifungal activities. In this study, CR64 was examined in inhibiting the growth of Rhizoctonia solani, the causing agent of root rot disease. Partial sequence analysis of 16S rRNA gene revealed that this isolate similar with Bacillus cereus (94%. Furthermore, a gene designated zmaR was detected by means of specific amplification of DNA fragment approximately 950 bp. This fragment was then cloned onto pCRII-TOPO (3.9 kb and sequenced using DNA sequencer ABI PRISM 310. Sequence analysis revealed that it had highest homology with the ZmaR protein (89% identity; 90% similarity of B. thuringiensis serovar kurstaki (AAF82729.2. Alignment analysis with other ZmaR sequences from other antibiotic-producing Bacilli exhibited an almost fully conserved region within ZmaR sequences.Key words : PGPR, Bacillus sp CR64, Zwitermicin A, Cloning, Antifungal.

  9. Final Report of Research Conducted For DE-AI02-08ER64546

    Patrick Minnis


    Research was conducted for 3-4 years to use ARM data to validate satellite cloud retrievals and help the development of improved techniques for remotely sensing clouds and radiative fluxes from space to complement the ARM surface measurement program. This final report summarizes the results and publications during the last 2 years of the studies. Since our last report covering the 2009 period, we published four papers that were accepted during the previous reporting period and revised and published a fifth one. Our efforts to intercalibrate selected channels on several polar orbiting and geostationary satellite imagers, which are funded in part by ASR, resulted in methods that were accepted as part of the international Global Space-based Intercalibration System (GSICS) calibration algorithms. We developed a new empirical method for correcting the spectral differences between comparable channels on various imagers that will be used to correct the calibrations of the satellite data used for ARM. We documented our cloud retrievals for the VAMOS Ocean-Cloud-Atmosphere-Land Study Regional Experiment (VOCALS-Rex; ARM participated with an AAF contribution) in context of the entire experiment. We used our VOCALS satellite data along with the aircraft measurements to better understand the relationships between aerosols and liquid water path in marine stratus clouds. We continued or efforts to validate and improve the satellite cloud retrievals for ARM and using ARM data to validate retrievals for other purposes.

  10. Density functional study of the structural and energetic properties of Cu12A (A=Fe, Co, Ni) clusters

    Started from the non-compact low symmetric ground-state geometry of Cu13 and four types 13- atom high-symmetric (Ih, Oh, D5h, D3h) close-packed structures, by replacing a doping atom in the un-equivalent position, the structural and energetic properties of the mixed Cu12A(A=Fe, Co, Ni) clusters are systematically studied by using the density-functional theory. Our results show that: For Cu12A(A= Fe, Co) clusters, each prefers to the Ih-replacing geometry as the ground-state structure, and with replacing the central atom to form a high-symmetric structure, but for CU12Ni, its ground-state structure is a non-compact low symmetric one similar to that of Cu13. The stability sequences of those structures from replacing the unequivalent positions of the ground-state geometry of Cu13 are nearly same for all these doping atoms (Fe, Co and Ni), and the center-replacing doping structures are all superior to the surface- replacing doping structures when replacing the four high-symmetric structures (Fe and Co are all stronger than Ni). There is no obvious isomerism for the ground-state of all these doping clusters. (authors)

  11. Hepatic non-parenchymal cells and extracellular matrix participate in oval cell-mediated liver regeneration

    Wei Zhang; Xiao-Ping Chen; Wan-Guang Zhang; Feng Zhang; Shuai Xiang; Han-Hua Dong; Lei Zhang


    AIM: To elucidate the interaction between nonparenchymal cells, extracellular matrix and oval cells during the restituting process of liver injury induced by partial hepatectomy (PH). METHODS: We examined the localization of oval cells, non-parenchymal cells, and the extracellular matrix components using immunohistochemical and double immunofluorescent analysis during the proliferation and differentiation of oval cells in N-2-acetylaminofluorene (2-AAF)/PH rat model. RESULTS: By day 2 after PH, small oval cells began to proliferate around the portal area. Most of stellate cells and laminin were present along the hepatic sinusoids in the periportal area. Kupffer cells and fibronectin markedly increased in the whole hepatic lobule. From day 4 to 9, oval cells spread further into hepatic parenchyma, closely associated with stellate cells, fibronectin and laminin. Kupffer cells admixed with oval cells by day 6 and then decreased in the periportal zone. From day 12 to 15, most of hepatic stellate cells (HSCs), laminin and fibronectin located around the small hepatocyte nodus, and minority of them appeared in the nodus. Kupffer cells were mainly limited in the pericentral sinusoids. After day 18, the normal liver lobule structures began to recover.CONCLUSION: Local hepatic microenvironment may participate in the oval cell-mediated liver regeneration through the cell-cell and cell-matrix interactions.

  12. ARM-ACME V: ARM Airborne Carbon Measurements V on the North Slope of Alaska Field Campaign Report

    Biraud, Sebastien C [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)


    Atmospheric temperatures are warming faster in the Arctic than predicted by climate models. The impact of this warming on permafrost degradation is not well understood, but it is projected to increase carbon decomposition and greenhouse gas production (CO2 and/or CH4) by arctic ecosystems. Airborne observations of atmospheric trace gases, aerosols and cloud properties in North Slopes of Alaska (NSA) are improving our understanding of global climate, with the goal of reducing the uncertainty in global and regional climate simulations and projections. From June 1 through September 15, 2015, AAF deployed the G1 research aircraft and flew over the North Slope of Alaska (38 flights, 140 science flight hours), with occasional vertical profiling over Prudhoe Bay, Oliktok point, Barrow, Atqasuk, Ivotuk, and Toolik Lake. The aircraft payload included Picarro and Los Gatos Research (LGR) analyzers for continuous measurements of CO2, CH4, H2O, and CO and N2O mixing ratios, and a 12-flask sampler for analysis of carbon cycle gases (CO2, CO, CH4, N2O, 13CO2, and trace hydrocarbon species). The aircraft payload also include measurements of aerosol properties (number size distribution, total number concentration, absorption, and scattering), cloud properties (droplet and ice size information), atmospheric thermodynamic state, and solar/infrared radiation.

  13. Joint Subcarrier Pairing and Resource Allocation for Cognitive Network and Adaptive Relaying Strategy

    Soury, Hamza


    Recent measurements show that the spectrum is under-utilized by licensed users in wireless communication. Cognitive radio (CR) has been proposed as a suitable solution to manage the inefficient usage of the spectrum and increase coverage area of wireless networks. The concept is based on allowing a group of secondary users (SUs) to share the unused radio spectrum originally owned by the primary user (PUs). The operation of CR should not cause harmful interference to the PUs. In the other hand, relayed transmission increases the coverage and achievable capacity of communication systems and in particular in CR systems. In fact there are many types of cooperative communications, however the two main ones are decode-and-forward (DAF) and amplify-and-forward (AAF). Adaptive relaying scheme is a relaying technique by which the benefits of the amplifying or decode and forward techniques can be achieved by switching the forwarding technique according to the quality of the signal. In this dissertation, we investigate the power allocation for an adaptive relaying protocol (ARP) scheme in cognitive system by maximizing the end-to-end rate and searching the best carriers pairing distribution. The optimization problem is under the interference and power budget constraints. The simulation results confirm the efficiency of the proposed adaptive relaying protocol in comparison to other relaying techniques, and the consequence of the choice of the pairing strategy.

  14. Integration of XRootD into the cloud infrastructure for ALICE data analysis

    Kompaniets, Mikhail; Svirin, Pavlo; Yurchenko, Volodymyr; Zarochentsev, Andrey


    Cloud technologies allow easy load balancing between different tasks and projects. From the viewpoint of the data analysis in the ALICE experiment, cloud allows to deploy software using Cern Virtual Machine (CernVM) and CernVM File System (CVMFS), to run different (including outdated) versions of software for long term data preservation and to dynamically allocate resources for different computing activities, e.g. grid site, ALICE Analysis Facility (AAF) and possible usage for local projects or other LHC experiments.We present a cloud solution for Tier-3 sites based on OpenStack and Ceph distributed storage with an integrated XRootD based storage element (SE). One of the key features of the solution is based on idea that Ceph has been used as a backend for Cinder Block Storage service for OpenStack, and in the same time as a storage backend for XRootD, with redundancy and availability of data preserved by Ceph settings. For faster and easier OpenStack deployment was applied the Packstack solution, which is ba...

  15. Evolução dos homicídios e indicadores de segurança pública no Município de São Paulo entre 1996 a 2008: um estudo ecológico de séries temporais Homicide and public security indicator trends in the city of São Paulo between 1996 and 2008: a time-series ecological study

    Maria Fernanda Tourinho Peres


    Full Text Available OBJETIVO: analisar a associação entre homicídios e indicadores de segurança pública no MSP entre 1996 e 2008, após controle para taxa de desemprego e proporção de jovens na população. METODOLOGIA: estudo ecológico de série temporal, tendo como unidade de análise o Município de São Paulo (MSP, entre 1996 e 2008. Variável dependente: óbitos por homicídio; variáveis independentes principais: taxa de aprisionamento-encarceramento (TAE, o acesso a armas de fogo (AAF, e a atividade policial (ATP. A análise dos dados foi realizada com o software Stata.IC 10.0. Modelos de regressão binomial negativa simples e multivariados foram construídos. RESULTADOS: A análise univariada demonstrou associação entre óbitos por homicídio e TAE e entre óbitos e ATP. O AAF não se mostrou associado à redução no número de óbitos por homicídios (p > 0,05. Após ajuste houve perda da significância na associação com ambos indicadores de Segurança Pública. CONCLUSÕES: No MSP o papel das ações de segurança pública perdem importância como fatores explicativos para a redução nos níveis de homicídios após controle para taxa de desemprego e redução na proporção de jovens. Os resultados reforçam a importância dos fatores socioeconômicos e demográficos para a mudança no cenário da segurança em São Paulo.The scope of this paper was to analyze the association between homicides and public security indicators in São Paulo between 1996 and 2008, after monitoring the unemployment rate and the proportion of youths in the population. A time-series ecological study for 1996 and 2008 was conducted with São Paulo as the unit of analysis. Dependent variable: number of deaths by homicide per year. Main independent variables: arrest-incarceration rate, access to firearms, police activity. Data analysis was conducted using Stata.IC 10.0 software. Simple and multivariate negative binomial regression models were created. Deaths by

  16. Reproductive Incompatibility Involving Senegalese Aedes aegypti (L) Is Associated with Chromosome Rearrangements

    Dickson, Laura B.; Sharakhova, Maria V.; Timoshevskiy, Vladimir A.; Fleming, Karen L.; Caspary, Alex; Sylla, Massamba; Black, William C.


    Aedes aegypti, the primary vector of dengue, yellow fever and Zika flaviviruses, consists of at least two subspecies. Aedes aegypti (Aaa) is light in color, has pale scales on the first abdominal tergite, oviposits in artificial containers, and preferentially feeds on humans. Aedes aegypti formosus (Aaf), has a dark cuticle, is restricted to sub-Saharan Africa, has no pale scales on the first abdominal tergite and frequently oviposits in natural containers. Scale patterns correlate with cuticle color in East Africa but not in Senegal, West Africa where black cuticle mosquitoes display a continuum of scaling patterns and breed domestically indoors. An earlier laboratory study did not indicate any pre- or postzygotic barriers to gene flow between Aaa and Aaf in East Africa. However, similar attempts to construct F1 intercross families between Aaa laboratory strains and Senegal Ae. aegypti (SenAae) failed due to poor F1 oviposition and low F2 egg-to-adult survival. Insemination and assortative mating experiments failed to identify prezygotic mating barriers. Backcrosses were performed to test for postzygotic isolation patterns consistent with Haldane’s rule modified for species, like Aedes, that have an autosomal sex determining locus (SDL). Egg-pupal survival was predicted to be low in females mated to hybrid F1 males but average when a male mates with a hybrid F1 female. Survival was in fact significantly reduced when females mated to hybrid males but egg-pupal survival was significantly increased when males were mated to hybrid F1 females. These observations are therefore inconclusive with regards to Haldane’s rule. Basic cytogenetic analyses and Fluorescent In Situ Hybridization (FISH) experiments were performed to compare SenAae strains with the IB12 strain of Aaa that was used for genome sequencing and physical mapping. Some SenAae strains had longer chromosomes than IB12 and significantly different centromeric indices on chromosomes 1 and 3. DAPI staining

  17. Arctic Black Carbon Loading and Profile Using the Single-Particle Soot Photometer (SP2) Field Campaign Report

    Sedlacek, Arthur J [Brookhaven National Lab. (BNL), Upton, NY (United States)


    s deployment within the Arctic Circle during the summer of 2015 (Deadhorse, Alaska [70° 12' 20" N, 148° 30' 42" W]), the truly unique opportunity presented itself to acquire profile data on BC loading at little additional cost. Since the SP2 is a particle-resolved measurement, the resulting data set provides refractory black carbon (rBC) mass loadings, size and mass distributions, and rBC-containing particle mixing state, all of which are expected to readily find value in the modeling community. As part of the ACME-V ( campaign, CO, CO2, and CH4 were also measured, providing the unique opportunity for carbon closure. We will also work closely with modelers who require such data and expect this collaboration will lead directly to a better understanding of the climate impacts of BC in the Arctic. The primary measurement objective was to acquire airborne data on the vertical and spatial distributions of refractory black carbon (rBC) loading, size and mass distribution, and particle mixing state. The primary scientific objective was to provide a targeted data set of rBC particle distributions to better understand and constrain the impact of black carbon radiative forcing in the cryosphere. The SP2-based data set during this campaign is available in the DOE-ARM archive (

  18. Reproductive Incompatibility Involving Senegalese Aedes aegypti (L) Is Associated with Chromosome Rearrangements.

    Dickson, Laura B; Sharakhova, Maria V; Timoshevskiy, Vladimir A; Fleming, Karen L; Caspary, Alex; Sylla, Massamba; Black, William C


    Aedes aegypti, the primary vector of dengue, yellow fever and Zika flaviviruses, consists of at least two subspecies. Aedes aegypti (Aaa) is light in color, has pale scales on the first abdominal tergite, oviposits in artificial containers, and preferentially feeds on humans. Aedes aegypti formosus (Aaf), has a dark cuticle, is restricted to sub-Saharan Africa, has no pale scales on the first abdominal tergite and frequently oviposits in natural containers. Scale patterns correlate with cuticle color in East Africa but not in Senegal, West Africa where black cuticle mosquitoes display a continuum of scaling patterns and breed domestically indoors. An earlier laboratory study did not indicate any pre- or postzygotic barriers to gene flow between Aaa and Aaf in East Africa. However, similar attempts to construct F1 intercross families between Aaa laboratory strains and Senegal Ae. aegypti (SenAae) failed due to poor F1 oviposition and low F2 egg-to-adult survival. Insemination and assortative mating experiments failed to identify prezygotic mating barriers. Backcrosses were performed to test for postzygotic isolation patterns consistent with Haldane's rule modified for species, like Aedes, that have an autosomal sex determining locus (SDL). Egg-pupal survival was predicted to be low in females mated to hybrid F1 males but average when a male mates with a hybrid F1 female. Survival was in fact significantly reduced when females mated to hybrid males but egg-pupal survival was significantly increased when males were mated to hybrid F1 females. These observations are therefore inconclusive with regards to Haldane's rule. Basic cytogenetic analyses and Fluorescent In Situ Hybridization (FISH) experiments were performed to compare SenAae strains with the IB12 strain of Aaa that was used for genome sequencing and physical mapping. Some SenAae strains had longer chromosomes than IB12 and significantly different centromeric indices on chromosomes 1 and 3. DAPI staining was

  19. The Shocking Truth about Cepheids: The Secret X-ray Lives of Classical Cepheids: Origin of Pulsed FUV and X-Ray Emissions of delta Cep and beta Dor

    Ruby, John; Engle, Scott G.; Guinan, Edward F.


    The Cepheid variable stars (delta Cep) and (beta Dor) have shown FUV spectral emission features from hot (10,000- 300,000 K) plasma that correlate with the phasing of their pulsations.(see Engle et al. 2014). These FUV spectral emissions that include NV 1240, OI 1305,C II 1335A, Si IV 1400A, and He II 1640 show peaks prior to the maximum optical brightness (during the "piston" phase of the pulsation that is observed to be in phase with the stellar pulsations, but the observed X-ray emission occurs near minimum light (near 0.4-0.5P) during the maximum radius and coolest phase of the star. Cepheid stars are an integral part of the cosmic distance ladder, due to their Period-Luminosity relationship (the Leavitt Law). Understanding the dynamics of Cepheid stars, especially with respect to FUV and X-ray emissions, is necessary to be confident in assertions derived from the cosmic distance ladder, including establishing the Hubble Constant to more accurate values.Presented here is a possible explanation for the pulsation period-related observed UV and X-ray emissions of these Cepheids. Using stellar interior and atmosphere models, conditions found in the ionization zone and outer atmosphere of these stars may be conducive to shocks being formed that are capable of temperatures great enough to produce x-ray emission. The mechanics of these shocks and their propagation in the atmosphere of the stars can potentially explain both the apparent pulsation-phased peaks for the FUV, as well as the pulsation-phase dependent (currently unexplained) X-ray emissions.This research was supported by NASA Grants: HST grant HST-GO-13019-A, XMM-Newton grant NNX14AAF12G, andChandra Grant GO-15202X. We are very thankful for this support.

  20. Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) Science Plan

    Fast, JD [Pacific Northwest National Laboratory; Berg, LK [Pacific Northwest National Laboratory


    Cumulus convection is an important component in the atmospheric radiation budget and hydrologic cycle over the Southern Great Plains and over many regions of the world, particularly during the summertime growing season when intense turbulence induced by surface radiation couples the land surface to clouds. Current convective cloud parameterizations contain uncertainties resulting in part from insufficient coincident data that couples cloud macrophysical and microphysical properties to inhomogeneities in boundary layer and aerosol properties. The Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) campaign is designed to provide a detailed set of measurements that are needed to obtain a more complete understanding of the life cycle of shallow clouds by coupling cloud macrophysical and microphysical properties to land surface properties, ecosystems, and aerosols. HI-SCALE consists of 2, 4-week intensive observational periods, one in the spring and the other in the late summer, to take advantage of different stages and distribution of “greenness” for various types of vegetation in the vicinity of the Atmospheric Radiation and Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site as well as aerosol properties that vary during the growing season. Most of the proposed instrumentation will be deployed on the ARM Aerial Facility (AAF) Gulfstream 1 (G-1) aircraft, including those that measure atmospheric turbulence, cloud water content and drop size distributions, aerosol precursor gases, aerosol chemical composition and size distributions, and cloud condensation nuclei concentrations. Routine ARM aerosol measurements made at the surface will be supplemented with aerosol microphysical properties measurements. The G-1 aircraft will complete transects over the SGP Central Facility at multiple altitudes within the boundary layer, within clouds, and above clouds.

  1. Development of a Bi-Disciplinary Course in Forensic Science

    Stacey L. Raimondi


    Full Text Available Forensic science programs and courses have traditionally been housed within chemistry departments at the college/university level, largely because the pioneers of the field were chemists who applied technology that was more chemical than biological in nature. However, with the development of such areas of study as DNA analysis, anatomical studies, and forensic entomology, it is becoming more and more important for forensic science students to have a strong biological background as well as a chemical background. Furthermore, while biology students are typically required to have extensive chemistry training as part of their major, the converse is not true for chemistry students. Therefore, it is possible that a student interested in forensic science could complete a major in chemistry and never have taken a biology class, leaving them woefully under-prepared for any type of masters program or career in forensic science immediately following graduation. Indeed, an examination of available positions in forensic science shows a large number of positions for DNA analysts for which the typical chemistry student would not be prepared without extensive biology training ( Furthermore, positions for medical examiners or pathologists require extensive training in biology in addition to the continued medical training and residency programs. Therefore, it seems imperative that introductory forensic science courses adapt to these needs and be taught with a more bi-disciplinary approach in order to educate students on the whole field rather than one aspect. To that end, a new bi-disciplinary Forensic Science course was developed at Elmhurst College. This course was team-taught by a biology and a chemistry professor so that students would obtain a thorough understanding of the field and techniques used by both biologists and chemists. A description of this new version of a forensic science course follows, focusing on the addition of biology

  2. Determining Best Estimates and Uncertainties in Cloud Microphysical Parameters from ARM Field Data: Implications for Models, Retrieval Schemes and Aerosol-Cloud-Radiation Interactions

    McFarquhar, Greg [Univ. of Illinois, Urbana, IL (United States)


    We proposed to analyze in-situ cloud data collected during ARM/ASR field campaigns to create databases of cloud microphysical properties and their uncertainties as needed for the development of improved cloud parameterizations for models and remote sensing retrievals, and for evaluation of model simulations and retrievals. In particular, we proposed to analyze data collected over the Southern Great Plains (SGP) during the Mid-latitude Continental Convective Clouds Experiment (MC3E), the Storm Peak Laboratory Cloud Property Validation Experiment (STORMVEX), the Small Particles in Cirrus (SPARTICUS) Experiment and the Routine AAF Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) field campaign, over the North Slope of Alaska during the Indirect and Semi-Direct Aerosol Campaign (ISDAC) and the Mixed-Phase Arctic Cloud Experiment (M-PACE), and over the Tropical Western Pacific (TWP) during The Tropical Warm Pool International Cloud Experiment (TWP-ICE), to meet the following 3 objectives; derive statistical databases of single ice particle properties (aspect ratio AR, dominant habit, mass, projected area) and distributions of ice crystals (size distributions SDs, mass-dimension m-D, area-dimension A-D relations, mass-weighted fall speeds, single-scattering properties, total concentrations N, ice mass contents IWC), complete with uncertainty estimates; assess processes by which aerosols modulate cloud properties in arctic stratus and mid-latitude cumuli, and quantify aerosol’s influence in context of varying meteorological and surface conditions; and determine how ice cloud microphysical, single-scattering and fall-out properties and contributions of small ice crystals to such properties vary according to location, environment, surface, meteorological and aerosol conditions, and develop parameterizations of such effects.In this report we describe the accomplishments that we made on all 3 research objectives.

  3. Embryonic turkey liver: activities of biotransformation enzymes and activation of DNA-reactive carcinogens

    Perrone, Carmen E.; Duan, Jian Dong; Jeffrey, Alan M.; Williams, Gary M. [New York Medical College, Department of Pathology, Valhalla (United States); Ahr, Hans-Juergen; Schmidt, Ulrich [Bayer AG, Institute of Toxicology, Wuppertal (Germany); Enzmann, Harald H. [Federal Institute for Drugs and Medical Devices, Bonn (Germany)


    Avian embryos are a potential alternative model for chemical toxicity and carcinogenicity research. Because the toxic and carcinogenic effects of some chemicals depend on bioactivation, activities of biotransformation enzymes and formation of DNA adducts in embryonic turkey liver were examined. Biochemical analyses of 22-day in ovoturkey liver post-mitochondrial fractions revealed activities of the biotransformation enzymes 7-ethoxycoumarin de-ethylase (ECOD), 7-ethoxyresorufin de-ethylase (EROD), aldrin epoxidase (ALD), epoxide hydrolase (EH), glutathione S-transferase (GST), and UDP-glucuronyltransferase (GLUT). Following the administration of phenobarbital (24 mg/egg) on day 21, enzyme activities of ECOD, EROD, ALD, EH and GLUT, but not of GST, were increased by two-fold or higher levels by day 22. In contrast, acute administration of 3-methylcholanthrene (5 mg/egg) induced only ECOD and EROD activities. Bioactivation of structurally diverse pro-carcinogens was also examined using {sup 32}P-postlabeling for DNA adducts. In ovoexposure of turkey embryos on day 20 of gestation to 2-acetylaminofluorene (AAF), 4,4'-methylenebis(2-chloroaniline) (MOCA), benzo[a]pyrene (BaP), and 2-amino-3,8-dimethylimidazo[4,5-f]quinoxaline (MeIQx) resulted in the formation of DNA adducts in livers collected by day 21. Some of the DNA adducts had {sup 32}P-postlabeling chromatographic migration patterns similar to DNA adducts found in livers from Fischer F344 rats exposed to the same pro-carcinogens. We conclude that 21-day embryonic turkey liver is capable of chemical biotransformation and activation of genotoxic carcinogens to form DNA adducts. Thus, turkey embryos could be utilized to investigate potential chemical toxicity and carcinogenicity. (orig.)

  4. Discovery of Point Mutations in the Voltage-Gated Sodium Channel from African Aedes aegypti Populations: Potential Phylogenetic Reasons for Gene Introgression

    Muranami, Yuto; Kawashima, Emiko; Osei, Joseph H. N.; Sakyi, Kojo Yirenkyi; Dadzie, Samuel; de Souza, Dziedzom K.; Appawu, Maxwell; Ohta, Nobuo; Minakawa, Noboru


    Background Yellow fever is endemic in some countries in Africa, and Aedes aegpyti is one of the most important vectors implicated in the outbreak. The mapping of the nation-wide distribution and the detection of insecticide resistance of vector mosquitoes will provide the beneficial information for forecasting of dengue and yellow fever outbreaks and effective control measures. Methodology/Principal Findings High resistance to DDT was observed in all mosquito colonies collected in Ghana. The resistance and the possible existence of resistance or tolerance to permethrin were suspected in some colonies. High frequencies of point mutations at the voltage-gated sodium channel (F1534C) and one heterozygote of the other mutation (V1016I) were detected, and this is the first detection on the African continent. The frequency of F1534C allele and the ratio of F1534C homozygotes in Ae. aegypti aegypti (Aaa) were significantly higher than those in Ae. aegypti formosus (Aaf). We could detect the two types of introns between exon 20 and 21, and the F1534C mutations were strongly linked with one type of intron, which was commonly found in South East Asian and South and Central American countries, suggesting the possibility that this mutation was introduced from other continents or convergently selected after the introgression of Aaa genes from the above area. Conclusions/Significance The worldwide eradication programs in 1940s and 1950s might have caused high selection pressure on the mosquito populations and expanded the distribution of insecticide-resistant Ae. aegypti populations. Selection of the F1534C point mutation could be hypothesized to have taken place during this period. The selection of the resistant population of Ae. aegypti with the point mutation of F1534C, and the worldwide transportation of vector mosquitoes in accordance with human activity such as trading of used tires, might result in the widespread distribution of F1534C point mutation in tropical countries

  5. Analysis of catalytic properties of tripeptidyl peptidase I (TTP-I), a serine carboxyl lysosomal protease, and its detection in tissue extracts using selective FRET peptide substrate.

    Kondo, Marcia Y; Gouvea, Iuri E; Okamoto, Débora N; Santos, Jorge A N; Souccar, Caden; Oda, Kohei; Juliano, Luiz; Juliano, Maria A


    Tripeptidyl peptidase I (TPP-I), also named ceroid lipofuscinosis 2 protease (CLN2p), is a serine carboxyl lysosomal protease involved in neurodegenerative diseases, and has both tripeptidyl amino- and endo- peptidase activities under different pH conditions. We developed fluorescence resonance energy transfer (FRET) peptides using tryptophan (W) as the fluorophore to study TPP-I hydrolytic properties based on previous detailed substrate specificity study (Tian Y. et al., J. Biol. Chem. 2006, 281:6559-72). Tripeptidyl amino peptidase activity is enhanced by the presence of amino acids in the prime side and the peptide NH2-RWFFIQ-EDDnp is so far the best substrate described for TPP-I. The hydrolytic parameters of this peptide and its analogues indicated that the S4 subsite of TPP-I is occluded and there is an electrostatic interaction of the positively charged substrate N-terminus amino group and a negative locus in the region of the enzyme active site. KCl activated TPP-I in contrast to the inhibition by Ca(2+) and NaCl. Solvent kinetic isotope effects (SKIEs) show the importance of the free N-terminus amino group of the substrates, whose absence results in a more complex solvent-dependent enzyme: substrate interaction and catalytic process. Like pure TPP-I, rat spleen and kidney homogenates cleaved NH2-RWFFIQ-EDDnp only at FF bond and is not inhibited by pepstatin, E-64, EDTA or PMSF. The selectivity of NH2-RWFFIQ-EDDnp to TPP-I was also demonstrated by the 400 times higher kcat/KM compared to generally used substrate, NH2-AAF-MCA and by its resistance to hydrolysis by cathepsin D that is present in high levels in kidneys. PMID:26775801

  6. Avian influenza virus (H5N1; effects of physico-chemical factors on its survival

    Hameed Sajid


    Full Text Available Abstract Present study was performed to determine the effects of physical and chemical agents on infective potential of highly pathogenic avian influenza (HPAI H5N1 (local strain virus recently isolated in Pakistan during 2006 outbreak. H5N1 virus having titer 108.3 ELD50/ml was mixed with sterilized peptone water to get final dilution of 4HA units and then exposed to physical (temperature, pH and ultraviolet light and chemical (formalin, phenol crystals, iodine crystals, CID 20, virkon®-S, zeptin 10%, KEPCIDE 300, KEPCIDE 400, lifebuoy, surf excel and caustic soda agents. Harvested amnio-allantoic fluid (AAF from embryonated chicken eggs inoculated with H5N1 treated virus (0.2 ml/egg was subjected to haemagglutination (HA and haemagglutination inhibition (HI tests. H5N1 virus lost infectivity after 30 min at 56°C, after 1 day at 28°C but remained viable for more than 100 days at 4°C. Acidic pH (1, 3 and basic pH (11, 13 were virucidal after 6 h contact time; however virus retained infectivity at pH 5 (18 h, 7 and 9 (more than 24 h. UV light was proved ineffectual in inactivating virus completely even after 60 min. Soap (lifebuoy®, detergent (surf excel® and alkali (caustic soda destroyed infectivity after 5 min at 0.1, 0.2 and 0.3% dilution. All commercially available disinfectants inactivated virus at recommended concentrations. Results of present study would be helpful in implementing bio-security measures at farms/hatcheries levels in the wake of avian influenza virus (AIV outbreak.

  7. Evaluation of long-term surface-retrieved cloud droplet number concentration with in situ aircraft observations

    Lim, Kyo-Sun Sunny; Riihimaki, Laura; Comstock, Jennifer M.; Schmid, Beat; Sivaraman, Chitra; Shi, Yan; McFarquhar, Greg M.


    A new operational retrieval of cloud droplet number concentration (ND) at cloud base has been produced from surface remote sensors at the Atmospheric Radiation Measurement (ARM) Southern Great Plains site for 13 years from January 1998 to January 2011. The retrieval is based on surface radiometer measurements of cloud optical depth from the multifilter rotating shadow band radiometer and liquid water path from the microwave radiometer (MWR). It is only applicable for single-layered overcast warm (stratus or stratocumulus) clouds. Evaluation with in situ aircraft measurements during the extended-term aircraft field campaign, Routine ARM Aerial Facility (AAF) Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO), shows that the retrieved ND robustly reproduces the primary mode of the in situ measured probability density function (PDF) but produces too wide a distribution, primarily caused by frequent high cloud droplet number concentration. Our analysis shows that the error in the MWR retrievals at low liquid water paths is one possible reason for this deficiency. Modification through the diagnosed liquid water path from the coordinate solution improves not only the PDF of the retrieved ND but also the relationship between the cloud droplet number concentration and cloud droplet effective radius. Consideration of entrainment effects rather than assuming an adiabatic cloud improves the values of the ND retrieval by reducing the magnitude of cloud droplet number concentration. Aircraft measurements and retrieval comparisons suggest that retrieving the vertical distribution of cloud droplet number concentration and effective radius is feasible with an improvement of the parameter representing the mixing effects between environment and clouds and with a better understanding of the effect of mixing degree on cloud properties.

  8. Evalution of long-term surface-retrieved cloud-droplet number concentration with in situ aircraft observations

    Lim, Kyo-Sun; Riihimaki, Laura D.; Comstock, Jennifer M.; Schmid, Beat; Sivaraman, Chitra; Shi, Yan; McFarquhar, Greg


    A new cloud-droplet number concentration (NDROP) value added product (VAP) has been produced at the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) site for the 13 years from January 1998 to January 2011. The retrieval is based on surface radiometer measurements of cloud optical depth from the multi-filter rotating shadow-band radiometer (MFRSR) and liquid water path from the microwave radiometer (MWR). It is only applicable for single-layered warm clouds. Validation with in situ aircraft measurements during the extended-term aircraft field campaign, Routine ARM Aerial Facility (AAF) CLOWD Optical Radiative Observations (RACORO), shows that the NDROP VAP robustly reproduces the primary mode of the in situ measured probability density function (PDF), but produces a too wide distribution, primarily caused by frequent high cloud-droplet number concentration. Our analysis shows that the error in the MWR retrievals at low liquid water paths is one possible reason for this deficiency. Modification through the diagnosed liquid water path from the coordinate solution improves not only the PDF of the NDROP VAP but also the relationship between the cloud-droplet number concentration and cloud-droplet effective radius. Consideration of entrainment effects rather than assuming an adiabatic cloud improves the values of the NDROP retrieval by reducing the magnitude of cloud-droplet number concentration. Aircraft measurements and retrieval comparisons suggest that retrieving the vertical distribution of cloud-droplet number concentration and effective radius is feasible with an improvement of the parameter representing the mixing effects between environment and clouds and with a better understanding of the effect of mixing degree on cloud properties.

  9. ACAPEX – Ship-Based Ice Nuclei Collections Field Campaign Report

    DeMott, Paul J [Colorado State Univ., Fort Collins, CO (United States); Hill, Thomas CJ [Colorado State Univ., Fort Collins, CO (United States)


    Measurements were sought to evaluate a hypotheses that sea-spray-sourced ice-nucleating particles (INPs) are of biological origin and represent a distinctly different INP population in comparison to long-range-transported desert or urban and regional land-sourced INP, and that the layering of marine within other aerosol layers feeding orographic storms over the mountains of California and the Western United States thereby leads to common and quantifiable scenarios that influence precipitation over the region. Aerosol collections on the National Oceanic and Atmospheric Administration (NOAA) research vessel (RV) Ronald H. Brown, for subsequent processing of INP immersion freezing activation temperature spectra and composition analyses, added a valuable measurement component to the ARM Cloud Aerosol Precipitation Experiment (ACAPEX) and related CalWater2 (NOAA) studies for use in parameterizing and modeling the impacts of marine boundary layer and other aerosols on climate and radiation via aerosol indirect effects on mixed-phase clouds. Twenty-five nominally 24-hour collections were made and have been processed for immersion freezing INP number concentrations versus temperature in the mixed-phase cloud temperature regime from -10 to -27°C. The similarity of INP number concentrations compared to typical marine boundary layer values attributed to sea-spray aerosols was noted. Nevertheless, variability of INP concentrations of up to 50 times was noted at individual temperatures over the course of the study. A particular analysis possible with this data set is to examine INP budgets over oceans inside versus outside of atmospheric river conditions. These INP measurements supplemented multiple airborne INP measurements on the ARM Aerial Facility (AAF), and others on the ground during ACAPEX and CalWater2, to provide extensive spatial and temporal analyses of INP immersion freezing spectra during winter storm periods. Future analyses will use thermal sensitivity to

  10. Content of arsenic, selenium, mercury in the coal, food, clay and drinking water on the Zhaotong fluorosis area, eastern Yunnan Province

    Luo Kun-li; Li Hui-jie; Chen Tong-bin (and others) [Chinese Academy of Sciences, Beijing (China). Institute of Geographic Sciences and Natural Resources Research


    About 160 samples of coal, corn, capsicum and drinking water were collected from the endemic fluorosis area of Zhenxiong and Weixin County, Zhaotong City of Yunnan Province, to determine the arsenic (As), selenium (Se) and mercury (Hg) content by AAF-800. The study found that the As content in the main coal seam from the Late Permian coal mines in Zhaotong City is 8.84 mg/kg and some civil coal can reach 89.09 mg/kg. The Se and Hg in the coal samples of Late Permian is lower, but Se and Hg are more concentrated in the pyritic coal balls and the pyritic gangue of the coal seam. The As content in corn and capsicum dried by coal-burning is more than 0.7 mg/kg, the natural standard amount of arsenic content permitted in food by China. The Se and Hg content in corn dried by coal-burning is lower than the natural standard of Se and Hg content in food in China but the Se and Hg content of capsicum dried by coal-burning exceeds the amount permitted by the natural standard for food in China. Clay, used as an additive for the coal-burning process and as a binder in making briquettes, contains a high content of As, generally more than 16 mg/kg. However, the Se and Hg content of clay itself are low. The As, Se and Hg content of drinking water are lower than the natural standard of As, Se and Hg content in the drinking water. So, there is high-As content coal and high-As content dried corn and capsicum in the endemic fluorosis area of Zhaotong City of Yunnan Province. The high As content of the dried corn and capsicum might have originated from the high arsenic content of burnt coal and clay. 30 refs., 4 tabs.

  11. The effects of water rock interaction and the human activities on the occurrence of hexavalent chromium in waters. The case study of the Psachna basin, Central Euboea, Greece.

    Vasileiou, Eleni; Perraki, Maria; Stamatis, George; Gartzos, Efthimios


    High concentrations of heavy metals, particularly of the toxic hexavalent chromium, are recorded in surface and ground waters in many areas, and constitute one of the most severe environmental problems nowadays. The natural genesis of chromium is associated with the geological environment (peridotites and serpentintites). Chromium is structured in many minerals, mainly in spinel (e.g. chromite), in silicate minerals such as phyllosilicate serpentine minerals, chlorite, talc and chain-silicate minerals of pyroxene and amphibole group. Chromium is found in two forms in soils, waters and rocks, the hexavalent and the trivalent one. The relation between Cr(III) and Cr(VI) strongly depends on pH and oxidative properties of the area; however, in most cases, Cr(III) is the dominating variant. The natural oxidation of trivalent to hexavalent chromium can be achieved by manganese oxides, H2O2, O2 gas and oxy-hydroxides of trivalent iron. Anthropogenic factors may also cause the process of chromium's oxidation. In the Psachna basin, Central Euboea, Greece, high concentrations of hexavalent chromium were recently measured in spring- and drill- waters. In this work, we study the effect of the geological environment and of the anthropogenic activities on the water quality with emphasis on chromium. A detailed geochemical, petrological and mineralogical study of rocks and soils was carried out by means of optical microscopy, XRF, XRD and SEM/EDS. Ground and surface water samples were physically characterized and hydrochemically studied by means of ICP and AAF. Combined result evaluation indicates a natural source for the trivalent chromium in waters, attributed to the alteration of Cr-bearing minerals of the ultramafic rocks. However the oxidation of trivalent to hexavalent chromium results from anthropogenic activities, mainly from intensive agricultural activities and the extensive use of fertilizers and pesticides causing nitrate pollution in groundwater. It has been shown

  12. Results of Atrial Fibrillation Ablation in Patients With or Without a History of Atrial Flutter

    Lu chunshan; Liu Xingpeng; Dong Jianzeng; Ma Changsheng


    Objectives There are two kind of atrial flutter during circumferential ablation for atrial fibrillation (AF): new onset left atrial flutter (LAFL), with a history of atrial flutter (AFL). What is the relationship of AFL and AF? Whether there are some differences in clinical course and mechanism between the new onset LAFL and the with a history of AFL remained unclear. The aim of this study was to assess the impacts of circumferential ablation on the occurrence of arrhythmias in follow-up in 2 groups:( 1 ) patients with a history of AFL and AF, and (2)patients with new onset LAFL. Methods Data from 465 patients who had circumferential pulmonary vein ablation (CPVA) or segmental pulmonary vein ablation (SPVA) were analyzed. Patients with a history of AFL ablation and patients who had concomitant AFL ablation were included from analysis. Forty-one patients constituted the history of AFL group (group 1, aged 57±13 years, 7 females) and twenty-eight patients constituted the new onset LAFL group (group 2, aged 55±12 years, 6 females). bipolar recordings were obtained from the tricuspid annulus, coronary sinus,interatrial septum and left atrium. Target sites were identified by early, fragmented or double potentials and by concealed entrainment. Linear lesions were created between target sites and nearby anatomical barriers (1) typical atrial flutter (cycle length, 242±39 ms). cavotricuspid isthmus ablation was performed.(2) new onset LAFL (cycle length, 282±153 ms). 20 episodes of AAFs were documented in 20/28 (71.4%)patients. Target sites were identified around pulmonary veins (n=10), gap in linear lesion (n=7), left atrial roof lines (1 case). For those cases the ablation line between PV and mitral annulus was performed.Patients in Group 2 had larger left atria, higher incidence of AFL pre-CPVA, and lower ejection fraction. Results There was no significant difference in post-CPVA AF recurrence between Groups 1 and 2, but AFL incidence after CPVA was higher in Group

  13. Anthranilic acid-containing cyclic tetrapeptides: at the crossroads of conformational rigidity and synthetic accessibility.

    Xin, Dongyue; Burgess, Kevin


    Each amino acid in a peptide contributes three atom units to main-chains, hence natural cyclic peptides can be 9, 12, 15, …. i.e. 3n membered-rings, where n is the number of amino acids. Cyclic peptides that are 9 or 12-membered ring compounds tend to be hard to prepare because of strain, while their one amino acid homologs (15-membered cyclic pentapeptides) are not conformationally homogeneous unless constrained by strategically placed proline or d-amino acid residues. We hypothesized that replacing one genetically encoded amino acid in a cyclic tetrapeptide with a rigid β-amino acid would render peptidomimetic designs that rest at a useful crossroads between synthetic accessibility and conformational rigidity. Thus this research explored non-proline containing 13-membered ring peptides 1 featuring one anthranilic acid (Anth) residue. Twelve cyclic peptides of this type were prepared, and in doing so the viability of both solution- and solid-phase methods was demonstrated. The library produced contained a complete set of four diastereoisomers of the sequence 1aaf (i.e. cyclo-AlaAlaPheAnth). Without exception, these four diastereoisomers each adopted one predominant conformation in solution; basically these conformations feature amide N-H vectors puckering above and below the equatorial plane, and approximately oriented their N-H[combining low line] atoms towards the polar axis. Moreover, the shapes of these conformers varied in a logical and predictable way (NOE, temperature coefficient, D/H exchange, circular dichroism). Comparisons were made of the side-chain orientations presented by compounds 1aaa in solution with ideal secondary structures and protein-protein interaction interfaces. Various 1aaa stereoisomers in solution present side-chains in similar orientations to regular and inverse γ-turns, and to the most common β-turns (types I and II). Consistent with this, compounds 1aaa have a tendency to mimic various turns and bends at protein

  14. Bacterial-epithelial contact is a key determinant of host innate immune responses to enteropathogenic and enteroaggregative Escherichia coli.

    Lindsey A Edwards

    Full Text Available BACKGROUND: Enteropathogenic (EPEC and Enteroaggregative (EAEC E. coli have similar, but distinct clinical symptoms and modes of pathogenesis. Nevertheless when they infect the gastrointestinal tract, it is thought that their flagellin causes IL-8 release leading to neutrophil recruitment and gastroenteritis. However, this may not be the whole story as the effect of bacterial adherence to IEC innate response(s remains unclear. Therefore, we have characterized which bacterial motifs contribute to the innate epithelial response to EPEC and EAEC, using a range of EPEC and EAEC isogenic mutant strains. METHODOLOGY: Caco-2 and HEp-2 cell lines were exposed to prototypical EPEC strain E2348/69 or EAEC strain O42, in addition to a range of isogenic mutant strains. E69 [LPS, non-motile, non-adherent, type three secretion system (TTSS negative, signalling negative] or O42 [non-motile, non-adherent]. IL-8 and CCL20 protein secretion was measured. Bacterial surface structures were assessed by negative staining Transmission Electron Microscopy. The Fluorescent-actin staining test was carried out to determine bacterial adherence. RESULTS: Previous studies have reported a balance between the host pro-inflammatory response and microbial suppression of this response. In our system an overall balance towards the host pro-inflammatory response is seen with the E69 WT and to a greater extent O42 WT, which is in fit with clinical symptoms. On removal of the external EPEC structures flagella, LPS, BFP, EspA and EspC; and EAEC flagella and AAF, the host inflammatory response is reduced. However, removal of E69 lymphostatin increases the host inflammatory response suggesting involvement in the bacterial mediated anti-inflammatory response. CONCLUSION: Epithelial responses were due to combinations of bacterial agonists, with host-bacterial contact a key determinant of these innate responses. Host epithelial recognition was offset by the microbe's ability to down

  15. Guideline for inspection of plant concerning creep below the limit temperature; Stoed vid besiktning av anlaeggningar avseende krypning under graenstemperaturen

    Storesund, Jan; Bjurstroem, Henrik; Weilin Zang; Andersson-Frejd, Ulf


    In an earlier report from Vaermeforsk, Inspecta and AaF mapped the extent of the problem of creep damage in several components of steam systems in power plants, which systems operate at temperatures below the lower limit for creep. Recommendations were issued regarding inspection of components where creep damage may occur. The authorities have issued a new regulation, AFS 2005:3 regarding inspection of pressure vessels, extending the requirement for inspection against creep fracture down to 350 deg C. This extensive inspection and testing is though considered as costly by the plants. A simplified inspection routine has been requested so that status regarding creep in exposed components may be determined at a more reasonable cost. In the present follow-up project, the goal was to provide a more comprehensive basis for the recommendations on methods for identifying exposed components. This has included: Collecting information from the replica tests that have been carried out during 2006 and 2007 as a complement to the documentation in the earlier project; Verifying the usability of analyses of elastic stresses; Additional simulations with FEM with the purpose of identifying critical geometries of components and positions. Information has been gathered from 11 replica inspections during the last two years. Creep damage has been observed in every case. In two of them, micro and macro cracks were observed. Eight of the remaining nine had significant occurrences of creep cavities. Damage has occurred also below 450 deg C, which was hitherto unknown. Excessive temperatures may have occurred in one of the two cases; defects and high system stresses are the probable causes of the other case. Positions where the most severe creep damage was observed were not the same as those with the highest stresses in the elastic stresses analysis. Therefore, components which are prone to damage according to experience, e.g. T-joints, should also be tested, even if the utilisation is

  16. Hygroscopic slaking of lime with steam or humid air. New energy effective lime slaking technology in kraft pulping; Hygroskopisk slaeckning av kalk med aanga eller fuktig luft. Ny energieffektiv teknik foer slaeckning av mesakalk i sulfatmassaindustrin

    Lundqvist, Roland


    Lime stone is widely used in chemical recovery for regeneration of white liquor in kraft pulping. Slaked (hydrated) lime is used to convert (causticize) sodium carbonate into sodium hydroxide, whereby lime mud (calcium carbonate) precipitates from the solution. Lime mud is dried and reburned in a lime kiln, where burned lime (calcium oxide) is formed. The circle is closed when lime is slaked (hydrated) in green liquor in an exotherm reaction. Problems with traditional slaking method is that heat is recovered at low temperatures. With the method described in this report there is potential to increase heat recovery in the causticizing plant. The forecasted method means that lime is slaked with steam or humid air, for example combined with a lime mud drier and a lime kiln. The task has included slaking of burned lime with steam or humid hot air, on purpose to test a specific machine equipment in pilote scale, and to investigate temperatures and hydratization rates able to reach. Also the lime slaked with steam/humid air should be compared with burned lime slaked in green liquor when green liquor is causticized, and to investigate the dewatering properties of formed lime mud. The target group is pulp and paper industry using the kraft process. The tests have been performed at SMA Svenska Mineral AB plant (lime burning) at Sandarne Sweden in years 2004-2005. Project owner has been the Swedish company Torkapparater AB, and the project is performed inside the 'Vaermeforsk Program for Pulp and Paper Industry 2004-2005'. Other partners, besides SMA Svenska Mineral AB, has been Stora Enso Skoghalls Bruk, Carnot AB, AaF Process AB and KTH Energiprocesser. Hydrated lime of varying slaking rates has been produced at temperatures up to 270 deg C. Caustizicing being performed show that dewatering properties of lime mud formed is quite up to the standard of lime mud from burned lime slaked in green liquor. The apprehension, that the hygroscopic slaked lime should result

  17. 真鲷天然抗性相关巨噬蛋白全长cDNA的克隆与序列分析%Cloning and sequence analysis of Nramp cDNA from Pagrus major

    徐美瑜; 陈松林; 沙珍霞; 季相山


    Natural resistance associated macrophage protein (Nmmp) is an innate resistance protein to intracellular parasites, which is expressed plentifully in macrophage ceils. Nramp has been studied in mouse, human, cattle, rainbow trout and channel catfish.However, tittle was known about the structure of Pagrus major Nramp. In order to get the complete sequence of Pagrus major Nramp, a pair of primer is designed according to a 200bp known sequence of Pagrus major Nramp cDNA. By the use of SMART RACE, the full Nramp of Pagrus major cDNA about 5 000 bp was obtained, including about 200 bp 5' terminal region (UTR),complete encoding region and 3' terminal region. There were 3 ployA signals, which showed many possibilities of cutting at 3' terminal region. The character of Pagrus major Nramp nucleotide sequence and deduced amino acid sequence are analyzed. 12 putative transmembrane(TM) regions, a consensus transport motif (CTM), a predicted protein kinase C phosphroylation site and three predicted N-link glycosylation sites are indicated in its deduced amino acid sequence. The ‘consense transport motif' CTM is located etween TM8 and TM9. Furthermore, a protein kinase C phosphroylation site and three N-link glycosylation sites were predicted. The lignment of amino acid sequences between Pagrus major Nramp cDNA and several animals is analyzed and the deduced amino acid equence of Pagrus major Nrarnp had 77.8%, 83.0%, 82.3%, 80.0%, 81.1%, 60.4%, 70.3%, 58.5%, 69.5% identity ith rainbow trout α(AAD20721), rainbow trout β(AAD20722), channel catfish(AF400108), fathead minnow (AAF01778),common carp (CABal96), mouse 1 ( AAA39838 ), mouse 2 ( AAC42051 ), human 1 ( D50403 ), human 2 ( NP - 0(106(18 ),respectively. The alignment reveals high conservation in TM and CTM regions. Analysis result makes us get familiar with the structure nd character of fish Nramp, furthermore, offers some infonnat/on for the enhancement of immunity of fish and genetic amelioration on fish breeding.

  18. Genotoxicity screening via the γH2AX by flow assay.

    Smart, D J; Ahmedi, K P; Harvey, J S; Lynch, A M


    The measurement of serine139-phosphorylated histone H2AX (γH2AX) provides a biomarker of DNA double-strand breaks (DSBs) and may identify potential genotoxic activity. In order to evaluate a flow cytometry assay for γH2AX detection (hereafter termed the γH2AX by flow assay), 6 prototypical (3 pro- and 3 proximate) genotoxins, i.e. dimethylbenz[a]anthracene (DMBA), 2-acetylaminofluorene (2-AAF), benzo[a]pyrene (B[a]P), methyl methane sulphonate (MMS), methyl nitrosourea (MNU) and 4-nitroquinoline oxide (4NQO), were selected to define assay evaluation criteria. In addition, 3 non-genotoxic cytotoxins (phthalic anhydride, n-butyl chloride and hexachloroethane) were included to investigate the influence of cytotoxicity on assay performance. At similar cytotoxicity levels (relative cell counts; RCC 75-40%) all prototypical genotoxins induced marked concentration-dependent increases in γH2AX compared with the non-genotoxins. As a result, assay evaluation criteria for a positive effect were defined as >1.5-fold γH2AX @ RCC >25%. Twenty five additional chemicals with diverse structures and genotoxic activity were selected to evaluate the γH2AX by flow assay. Results were compared with Ames bacterial and in vitro mammalian genotoxicity tests (mouse lymphoma assay and/or chromosome aberration assay). γH2AX by flow assay results were highly predictive of Ames (sensitivity 100%; specificity 67%; concordance 82%) and in vitro mammalian genotoxicity tests (sensitivity 91%; specificity 89%; concordance 91%) and provide additional evidence that γH2AX is a biomarker of potential genotoxic activity, underpinned mechanistically by the cellular response to DSBs. Discordant findings were predominately attributed to differences in specificity for some mammalian cell genotoxins that are Ames non-mutagens or for "biologically-irrelevant" positives in the mammalian tests. Simple anilines were classified as genotoxic following rat liver S9-mediated bioactivation, however, effects on

  19. Process and machinery description of equipment for deposition of canisters in medium-long deposition holes

    canisters in horizontal holes. It is recommended that in the continued work: Canister and bentonite buffer are deposited in a hole at the same time, as a package. Methods leading to minimal movement in the hole are preferred. Methods that in AAF-Industriteknik's assessment could be developed are those using a metallic sleeve gliding on a gangway in the hole. The sleeve is reused. As a second method one could develop a method using a loading laddle

  20. Selective Toxicity of Persian Gulf Sea Cucumber (Holothuria parva and Sponge (Haliclona oculata Methanolic Extracts on Liver Mitochondria Isolated from an Animal Model of Hepatocellular Carcinoma



    Full Text Available Background Natural products isolated from marine environments are well known for their pharmacodynamic potential in diverse disease treatments, such as for cancer or inflammatory conditions. Sea cucumbers are marine animals of the phylum Echinoderm and the class Holothuroidea, with leathery skin and gelatinous bodies. Sponges are important components of Persian Gulf animal communities, and the marine sponges of the genus Haliclona have been known to display broad-spectrum biological activity. Many studies have shown that sea cucumbers and sponges contain antioxidants and anti-cancer compounds. Objectives This study was designed to determine the selective toxicity of Persian Gulf sea cucumber (Holothuria parva and sponge (Haliclona oculata methanolic extracts on liver mitochondria isolated from an animal model of hepatocellular carcinoma, as part of a national project that hopes to identify novel potential anticancer candidates among Iranian Persian Gulf flora and fauna. Materials and Methods To induce hepatocarcinogenesis, rats were given diethylnitrosamine (DEN injections (200 mg/kg i.p. by a single dose, and then the cancer was promoted with 2-acetylaminofluorene (2-AAF (0.02 w/w for two weeks. Histopathological evaluations were performed, and levels of liver injury markers and a specific liver cancer marker (alpha-fetoprotein, were determined for confirmation of hepatocellular carcinoma induction. Finally, mitochondria were isolated from cancerous and non-cancerous hepatocytes. Results Our results showed that H. parva methanolic extracts (250, 500, and 1000 µg/mL and H. oculata methanolic extracts (200, 400, and 800 µg/mL increased reactive oxygen species (ROS formation, mitochondrial membrane potential (MMP, mitochondrial swelling, and cytochrome c release in the mitochondria obtained from cancerous hepatocytes, but not in mitochondria obtained from non-cancerous liver hepatocytes. These extracts also induced caspase-3 activation, which is

  1. Mitsuda's reactions: induced by BCG in the normal Rhesus ("Macacca mulatta"

    M. J. Pereira Filho


    the repetition of the tests, even though the intensity of the reaction always remains the same. This precocious reaction (Fernandez type occurs both shortly and long time after the application of the BCG. Its precocity depends not of the antigen only because the first Mitsuda's reaction after the BCG application occurs after some time and seems not influenced by the control lepromin test effected on the Rhesus before the BCG. 5 On the control group, the animals which received a.a.f. bacilli suspensions (Mycobacterium sp.; M. avium, and M. smegmatis, did not show reverseals of the Mitsuda's reaction. Two Rhesus, however, which received dead BCG (120ºC autoclave 1 hour, one intradermically (0.006 g and the other orally (1.2 g, did both present reversals of the Mitsuda's reaction, with weak positivity (+. In all animals of the control-group, the allergic reactions were found negative. 6 Strong local inflammatory reactions were observed in the Rhesus that had received living BCG by intradermal via, and in the one submitted to multipunctures, there occurred the formation of a large caseous abcess. 7 The allergic tuberculinic and infratuberculinic reactions appeared dissociated from the Mitsuda's reactions: sometimes they are more precocious, occurring before of the lepromin test; on other occasions they disappear, when the Mitsuda's reactions still persist; and finally, they may be absent, when the latter occur, especially after the oral application of the BCG. 8 In Rhesus which received BCG by testicular and peritonela via, in the infratuberculinic test (0.1 ml of total BCG extract, besides the classic answer, which occurs between 48 and 96 hours, one could observe a delayed answer (15 to 20 days, represented by a non-erythematous nodule, which persists for 11-14 days.

  2. Airborne hygrometer calibration inter-comparison against a metrological water vapour standard

    Smorgon, Denis; Boese, Norbert; Ebert, Volker


    Water vapour is the most important atmospheric greenhouse gas, which causes a major feedback to warming and other changes in the climate system. Knowledge of the distribution of water vapour and its climate induced changes is especially important in the upper troposphere and lower stratosphere (UT/LS) where vapour plays a critical role in atmospheric radiative balance, cirrus cloud formation, and photochemistry. But, our understanding of water in the UT/LS is limited by significant uncertainties in current UT/LS water measurements. One of the most comprehensive inter-comparison campaigns for airborne hygrometers, termed AQUAVIT (AV1) [1], took place in 2007 at the AIDA chamber at the Karlsruhe Institute of Technology (KIT) in Germany. AV1 was a well-defined, referred, blind inter-comparison of 22 airborne field instruments from 17 international research groups. One major metrological deficit of AV1, however, was, that no traceable reference instrument participated in the inter-comparison experiments and that the calibration procedures of the participating instruments were not monitored or interrogated. Consequently a follow-up inter-comparison was organized in April 2013, which for the first time also provides a traceable link to the international humidity scale. This AQUAVIT2 (AV2) campaign (details see: was again located at KIT/AIDA and organised by an international organizing committee including KIT, PTB, FZJ and others. Generally AV2 is divided in two parallel comparisons: 1) AV2-A uses the AIDA chamber for a simultaneous comparison of all instruments (incl. sampling and in-situ instruments) over a broad range of conditions characteristic for the UT/LS; 2) AV2-B, about which this paper is reporting, is a sequential comparison of selected hygrometers and (when possible) their reference calibration infrastructures by means of a chilled mirror hygrometer traced back to the primary National humidity standard

  3. Overview of the Ocean Bottom Seismology Component of the Cascadia Initiative (Invited)

    Toomey, D. R.; Allen, R. M.; Collins, J. A.; Dziak, R. P.; Hooft, E. E.; Livelybrooks, D.; McGuire, J. J.; Schwartz, S. Y.; Tolstoy, M.; Trehu, A. M.; Wilcock, W. S.


    We report on the experimental progress of the ocean bottom seismology component of the Cascadia Initiative (CI). The CI is an onshore/offshore seismic and geodetic experiment that takes advantage of an Amphibious Array Facility (AAF) to study questions ranging from megathrust earthquakes to volcanic arc structure to the formation, deformation and hydration of the Juan de Fuca and Gorda plates. This diverse set of objectives are all components of understanding the overall subduction zone system and require an array that provides high quality data that crosses the shoreline and encompasses relevant plate boundaries. In October 2010, an open community workshop was convened in Portland, Oregon that produced a series of recommendations to maximize the scientific return of the CI and to develop deployment plans for the offshore component of the experiment. The NSF Cascadia Initiative Workshop Report1 presents the scientific objectives of the CI, the resources involved and the community-defined ocean bottom seismometer (OBS) deployment plan. There are several noteworthy aspects of the CI: The CI is the first to utilize a new generation of OBSs that are designed to withstand trawling by fisheries, thus allowing the collection of seismic data in the shallow water that overlies much of the Cascadia megathrust. The CI is a plate-scale experiment that provides a unique opportunity to study the structure and dynamics of an entire oceanic plate, from its birth at a spreading center to its subduction beneath a continental plate. Together with the land stations that are part of the amphibious array and other land networks, the OBSs will provide coverage at a density comparable to the Transportable Array of Earthscope from the volcanic arc out to the Pacific-Juan de Fuca spreading center segments. The CI is a community experiment that provides open access to all data via the IRIS Data Management Center, thus ensuring that the scientific return from the investment of resources is

  4. Incidence of tinnitus in mp3 player users Incidência de zumbido em usuários de estéreos pessoais

    Ricardo Rodrigues Figueiredo


    Full Text Available Exposure to loud noise is one of the main causes of tinnitus. AIM: To analyze the incidence of tinnitus in mp3 player users and non-users. MATERIAL AND METHOD: One hundred subjects aged from 15 to 30 years were enrolled, 54 of them were regular mp3 player users and 46 were not. Patients with continuous tinnitus for at least 6 months completed the Tinnitus Handicap Inventory (THI and were tested with high frequency audiometry and transient-evoked otoacoustic emissions (TAOE. STUDY DESIGN: A cross-sectional cohort study. RESULTS: The incidence of tinnitus in non-users was about 8 %; in mp3 player users it was about 28 %, a statistically significant difference. Hearing thresholds at 8kHz were significantly higher in tinnitus patients that used mp3 portable players.TAOE were reduced at 2 kHz in the users group. No statistically significant difference was found in the THI scores between the two groups. CONCLUSION: Tinnitus was more frequent in teenagers and young adults who regularly listen to mp3 music in players. Moreover, the incidence of tinnitus among mp3 player users was associated with higher hearing thresholds at 8 kHz and lower TOAE at 2 kHz.Uma das principais causas de zumbido é a exposição a ruído. OBJETIVO: Comparar a incidência de zumbido entre usuários e não usuários de estéreos pessoais. MATERIAL E MÉTODO: Cem indivíduos entre 15 e 30 anos foram recrutados, 54 deles usuários regulares de estéreos pessoais e 46 não-usuários. Pacientes com zumbido preencheram a versão validada para o português brasileiro do Tinnitus Handicap Inventory (THI. Todos foram submetidos à audiometria de altas frequências (AAF e otoemissões acústicas transientes (OEAT. DESENHO CIENTÍFICO: Estudo de coorte contemporânea com corte transversal. RESULTADOS: A incidência de zumbido entre os usuários de estéreos pessoais foi significativamente maior (aproximadamente 28% x 8%. Os limiares auditivos em 8 kHz foram maiores nos portadores de

  5. Aespoe Hard Rock Laboratory. Sensor Data Report No 23

    Goudarzi, Reza; Johannesson, Lars-Erik (Clay Technology AB (Sweden))


    The Prototype Repository Test consists of two sections. The installation of the first Section of Prototype Repository was made during summer and autumn 2001 and Section 2 was installed in spring and summer 2003. This report presents data from measurements in the Prototype Repository during the period 20010917-20100601. The report is organized so that the actual measured results are shown in Appendix 1-10, where Appendix 8 deals with measurements of canister displacements (by AITEMIN), Appendix 9 deals with geo-electric measurements in the backfill (by GRS), Appendix 10 deals with stress and strain measurement in the rock (by AaF) and Appendix 11 deals with measurement of water pressure in the rock (by VBB/VIAK). The main report and Appendix 1-7 deal with the rest of the measurements. Section 1. The following measurements are made in the bentonite in each of the two instrumented deposition holes in Section 1 (1 and 3): Temperature is measured in 32 points, total pressure in 27 points, pore water pressure in 14 points and relative humidity in 37 points. Temperature is also measured by all relative humidity gauges. Every measuring point is related to a local coordinate system in the deposition hole. The following measurements are made in the backfill in Section 1. Temperature is measured in 20 points, total pressure in 18 points, pore water pressure in 23 points and relative humidity in 45 points. Temperature is also measured by all relative humidity gauges. Furthermore, water content is measured by an electric chain in one section. Every measuring point is related to a local coordinate system in the tunnel. The following measurements are made on the surface of the canisters in Section 1: Temperature is measured every meter along two fiber optic cables. Furthermore, displacements of the canister in hole 3 are measured with 6 gauges. The following measurements are made in the rock in Section 1: Temperature is measured in 37 points in boreholes in the floor. Water