WorldWideScience

Sample records for 8-mop mas uva

  1. Effect of 8-MOP plus UVA treatment on survival and repair of plasmid pBR322; Efecto del tratamiento con 8-MOP mas UVA en la supervivencia y reparacion de pBR322

    Bauluz, C.; Vidania, R. de

    1991-07-01

    We have studied the lethality produced in pBR322 DNA after PUVA treatment (8-MOP+UVA). As recipients, we used a collection of E. coli strains differing in their repair capacities and analysed the involvement of several DNA repair pathways in the removal of plasmid lesions. We have also studied the effect of UVA radiation alone, in order to determine more precisely the effect attributable only to psoralen molecules. Results showed a strong lethal effect derived from PUVA treatment; however, some plasmid recovery was achieved in bacterial hosts proficient in Excision repair and SOS repair. Another repair pathway, only detectable at high density of lesions, appeared to be relevant for the removal of 8-MOP:DNA adducts.(Author) 11 refs.

  2. Effect of 8-MOP plus UVA treatment on survival and repair of plasmid pBR322

    We have studied the lethality produced in pBR322 DNA after PUVA treatment (8-MOP+UVA). As recipients, we used a collection of E. coli strains differing in their repair capacities and analysed the involvement of several DNA repair pathways in the removal of plasmid lesions. We have also studied the effect of UVA radiation alone, in order to determine more precisely the effect attributable only to psoralen molecules. Results showed a strong lethal effect derived from PUVA treatment; however, some plasmid recovery was achieved in bacterial hosts proficient in Excision repair and SOS repair. Another repair pathway, only detectable at high density of lesions, appeared to be relevant for the removal of 8-MOP:DNA adducts.(Author) 11 refs

  3. An action spectrum for lethal photosensitization of Candida albicans by 8-MOP after low-dose broad-band UV-A irradiation; an action spectrum for 8-MOP 4',5'-monoadducts

    An action spectrum was obtained for lethal photosensitization of Candida albicans that had been pre-irradiated with a sub-lethal low dose of broad-band UV-A after incubation with 8-methoxypsoralen and then washed to remove any non-photobound 8-methoxypsoralen. The resultant spectrum with a peak in the 320-335 nm region was similar to that obtained by a conventional method (single irradiation only) and also to the absorption spectrum of the 4',5'-monoadduct. These data support the hypothesis that the chromophore for lethal photosensitization by 8-methoxypsoralen is the 8-methoxypsoralen/DNA 4',5'-monoadduct rather than 8-methoxypsoralen itself. (author)

  4. A comparison of systemic photochemotherapy with 8-methoxypsoralen (8-MOP and with trimethylpsoralen (TMP in vitiligo

    Mhaske Vandana

    1998-01-01

    Full Text Available Oral 8-MOP and TMP were compared in the PUVA therapy for vitiligo. Group A (25 cases was initiated on 0.3 mg/kg of 8-MOP with 1/2 Joule/cm2 of UVA and weekly increments of 1/2 Joule/ cm2 and Group B was started on 0.6 mg/kg of TMP with 1 Joule/cm2 of UVA and weekly increments of 1 Joule/cm2. Therapy was given thrice a week. Repigmentation was evaluated by using a 0-6 scale. At the end of 60 sittings, on acceptable cosmetic response was seen over the face, neck and upper extremities in both groups, while trunk and lower extremities showed lesser response. 8-MOP gave earlier response, needing a lower cumulative UVA dose i.e. 75 J/cm2 as compared to TMP i.e. 106 J/cm2. Phototoxicity was seen more often with 8-MOP. In conclusion, in Indians, 8-MOP is the drug of choice in PUVA therapy of vitiligo provided precautions against phototoxicity are adequate.

  5. Zingiber officinale (ginger) used to prevent 8-Mop associated nausea.

    Meyer, K; Schwartz, J; Crater, D; Keyes, B

    1995-08-01

    Patients undergoing photopheresis are required to ingest the drug 8-MOP as part of their treatment. This drug causes nausea as a side effect. Ginger taken prior to 8-MOP may substantially reduce this side effect. This study compared patients' nausea when taking 8-MOP with and without ginger. PMID:7646942

  6. Effect of 8-MOP plus treatment on survival and repair of plasmid pBR322

    We have studied the lethality produced in pBR322 DNA after PUVA treatment (8-MOP+UVA). As recipients, we used a collection of E. coli strains differing in their repair capacities and analysed the involvement of several DNA repair pathways in the removal of plasmid lesions. We have also studied the effect of UVA radiation alone, in order to determine more precisely the effect attributable only to psoralen molecules. Results showed a strong lethal effect derived from PUVA treatment; however, some plasmid recovery was achieved in bacterial hosts proficient in Excision repair and SOS repair. another repair pathway, only detectable at high density of lesions, appeared to be relevant for the removal of 8-MOP:DNA adducts. (author)

  7. Influence of 8 MOP and monochromatic or polychromatic UV light on phagocytosis of neutrophil granulocytes

    The inhibition of granulocyte phagocytosis by 8-MOP and monochromatic or polychromatic UV light was investigated. After application of 8-MOP and UV there was an additional inactivation compared with UV alone, as expected from studies on other cell species. This additional inhibition of phagocytosis was found to be increasing with 8-MOP level. The action spectra of granulocyte inactivation by 8-MOP and UV involves the investigated UVB range (until 300 nm). A marked inactivation of granulocytes was seen after erythemogenic fluences only. Therefore it is assumed that inactivation of granulocytes by direct UV action does not play an essential role in UV therapy in vivo. (author)

  8. The immunological effect of 8-methoxypsoralen and UVA treatment on murine T-cell leukemia

    8-Methoxyproralen (8-MOP) plus long-wavelength UV radiation (UVA, 320-400 nm) have been used to treat various diseases such as cutaneous T-cell lymphoma, systemic scleroderma, rheumatoid arthritis and rejection of heart transplants. However, the immunological mechanism of this treatment remains unknown. In this report, we investigated the effect of 8-MOP/UVA on the modulation of the immunogenicity of a T-cell leukemia cell line (RL ''male'' 1 cells). The results demonstrated that the stimulator function of the in vitro 8-MOP/UVA-treated RL ''male'' 1 cells was enhanced in both RL ''male'' 1-specific allogeneic and syngeneic immune responses. Furthermore, the enhancement of the immunogenicity of the 8-MOP/UVA-treated RL ''male'' 1 cells was found to be strongly associated with the increase of intercellular adhesion molecule-1 expression on these 8-MOP/UVA-treated tumor cells. Therefore, our findings suggested that the alteration of the expression of the immune-related cell surface molecules might be an important effect of 8-MOP/UVA treatment on the elevation of the immunogenicity of the 8-MOP/UVA-treated tumor cells. (Author)

  9. 8-MOP PUVA for psoriasis: a comparison of a minimal phototoxic dose-based regimen with a skin-type approach

    Two ultraviolet A (UVA) regimens for oral 8-methoxypsoralen (8-MOP) photochemotherapy (PUVA) for moderate/severe chronic plaque psoriasis using a half-body study technique were compared. Each patient received both regimens. A higher-dose regimen based on minimal phototoxic dose (MPD) with percentage incremental increases was given to one-half of the body. The other half received a lower dose regimen based on skin type with fixed incremental UVA increases. Patients were treated twice weekly. Symmetrical plaques were scored to determine the rate of resolution with each regimen. In addition, the number of treatments, cumulative UVA dose and number of days in treatment to achieve overall clearance were recorded. Patients were reviewed monthly for one year to record remission data. Thirty-three patients completed the study. Both regimens were effective and well tolerated. With the MPD-based approach, number of exposures was significantly less for patients with skin types I and II but not III. Although the cumulative UVA dose was higher with the MPD regimen for all skin types studied, the reduced number of exposures required for clearance for skin types I and II but not III, combined with the security of individualized MPD testing, has practical attractions. MPD testing also identified five patients who required an increased psoralen dose and six patients who required a reduction of the initial UVA dose with the skin type regimen. Forty-two percent were still clear 1 year after treatment and there was no significant difference in the number of days in remission between the regimens for those whose psoriasis had recurred. The reduction in the number of exposures required for clearance with the MPD-based regimen may be safer and more cost effective in the long term. (author)

  10. The genotoxicity of UVA irradiation in Drosophila melanogaster and the synergistic action of 8-methoxypsoralen and UVA.

    Negishi, T; Tanabe, F; Hayatsu, H

    1992-08-01

    To study the genotoxicity of near-ultraviolet light (UVA) on a whole body, Drosophila melanogaster larvae were irradiated with UVA and the emerging flies were examined for the mutant wing spot formation. The genotoxicity of UVA was also assayed with the in vivo DNA-repair test using males with repair-deficiency at the mei-9 and mei-41 locus and the matching repair-proficient females. Third-instar larvae were placed in a plastic Petri dish, which was covered with soft glass, and irradiated with black light at 4-5 W/m2. This irradiation resulted in an increase in mutant wing-hair spots. After a 15 h irradiation (approximately 240 kJ/m2), the mutant clone frequencies found in the adult flies (spots/wing) were: 1.68 for the small single spots, 0.38 for the large single spots and 0.11 for the twin spots, while at zero time they were 0.68, 0.06 and 0.02 respectively. On the other hand, the UVA irradiation was negative in the in vivo DNA-repair test, indicating that the UVA-induced DNA lesion may not be subject to repair by the mei-9 and mei-41 functions. The presence of 8-methoxypsoralen (8-MOP) during the irradiation remarkably enhanced somatic mutations, and showed a strong DNA-damaging effect in the repair test. For example, a 15 h UVA irradiation with 26.7 microM 8-MOP resulted in a 14-fold increase in the number of twin spots per wing as compared with the frequency obtained on treatment with UVA alone. Treatment of the larvae with 8-MOP alone gave no mutant clones or DNA damage. A high frequency in twin spot formation was also observed in this UVA + 8-MOP treatment, indicating that extensive chromosomal recombinations took place in the somatic cells. PMID:1499094

  11. Distribution of 3H-8-MOP and its metabolites in rat organs after a single oral administration

    Wulf, H.C.; Andreasen, M.P.

    1981-04-01

    Concentrations of 3H-8-methoxypsoralen (MOP), its lipid- and water soluble metabolites and tritiated water have been measured in rat serum, liver, kidney, and skin, using liquid scintillation, thin-layer chromatography and other techniques. Radioactivity in whole blood, plasma, ovary, adrenals, and pancreas has also been measured. The radioactivty has been measured up to 1 week after medication, while 3H-8-MOP and metabolite concentrations have been measured from 10 min to 24 h after medication with a single dose of 1 mg 3H-8-MOP in solution/kg bodyweight. Maximum 8-MOP concentrations were seen from 10 to 30 min after dosing. The concentrations in microgram/kg 10 min, 2 h, and 24 h after medication were as follows: serum--686, 57, 2.1; liver--489, 45, 3.3; kidney--1708, 139, 4.3; and skin--55, 16, 3.8. The concentrations of water soluble metabolites were very high in the liver and only slightly lower in the kidney. The concentrations of these metabolites might accumulate after doses repeated 4 times a week. 3H-8-MOP and its metabolites would not show similar accumulation. Most of the radioactivity present after 1 week is due to trititated water.

  12. Puva therapy for psoriasis comparison of oral and bath water delivery of 8-MOP

    Sridhar K

    1992-01-01

    Full Text Available Exposure to UVA following oral psoralens for the treatment of psoriasis is associated with systemic side effects which are absent if bath water delivery of psoralens is practiced. We have compared the relative therapeutic effectiveness of these 2 modes of drug delivery in skin types IV and V. To date all such studies have been done only in skin types I, II and III. Bath PUVA although relatively expensive is an effective and acceptable mode of drug delivery.

  13. 8-MOP的光敏反应对DNA特定位置的致损伤作用%Photosensitive reaction of 8-MOP induce objective DNA damage

    熊鸿燕; 王思雄; 胡小兵; 徐斌; 陈惠孙

    2001-01-01

    目的:探讨末端标记8-甲氧基补骨脂素(8-MOP)的三螺旋结构寡核苷酸(TFO)对鸭乙肝病毒(DHBV)-DNA X/C区一目标基因的特异结合及定位损伤作用.材料方法:在一定条件下,将人工合成的3'末端标记有8-MOP的TFO与目标双链基因片断反应,用电泳转移杂交印迹和PCR法观察设计的复合物(TFo-P)对目标基因的结合以及在长波紫外线(UVA)的照射下8-MOP所致DNA交联及引起的PCR扩增阻止效应.结果:所设计合成的TFO-P能与细胞外DHBV-DNA的目标基因双链直接结合,随TFO-P含量的增加,TFO-P与目标双链形成的三聚体分子的产量明显增加;TFO-P与目标基因的反应物经一定剂量的320~380nmUVA照射后,目标序列的PCR扩增出现阻断现象.结论TFO-P能直接与目标DNA特异结合,形成三聚体产物,在UVA的进一步作用下,TFO-P能在目标序列的设定位置发生光敏反应,使DNA形成共价交联结构.

  14. Mutation spectrum produced on PBR322 by 8-Methoxypsoralen plus UV-A light

    The mutagenic effect of 8-MOP+UVA (PUVA treatment) on pBR322 has been analysed by determining the frequency of mutation in the tet gene and identifying the type and position of the mutations produced inside a 276 pb-fragment (Bam-H1-SalI) of the same gene. pBR322 DNA was irradiated with UVA light in the presence of increasing concentrations of 8-Methoxypsoralen (8-MOP). The number of psoralen adducts formed in pBR322 upon that treatment ranged from 0 to 10.7 adducts per plasmid molecule. Modified DNA samples were used to transform several strains of E. Coli (differing in their repair capacities), both in constitutive conditions and after sos pre-induction by 254 nm-irradiation of cells. Mutation frequencies in the tet gene showed to increase in the wild type and uvrA strains along with the number of psoralen adducts per plasmid molecule; higher mutation frequencies were found in cells that had been previously irradiated to induce the SOS expression. Mutant plasmids were isolated from ApRTcS colonies and sequenced by the method of Maxam and Gilbert. Mutations appeared to be unique in most of the cases and were always punctual, i.e. affecting only to one base pair. The relative positions of the mutations showed a high frequency of coincidence among the sequenced fragments, indicating the existence of several DNA regions with high probability to mutated ('hot spots'). (author)

  15. The PARP inhibitor PJ-34 sensitizes cells to UVA-induced phototoxicity by a PARP independent mechanism.

    Lakatos, Petra; Hegedűs, Csaba; Salazar Ayestarán, Nerea; Juarranz, Ángeles; Kövér, Katalin E; Szabó, Éva; Virág, László

    2016-08-01

    A combination of a photosensitizer with light of matching wavelength is a common treatment modality in various diseases including psoriasis, atopic dermatitis and tumors. DNA damage and production of reactive oxygen intermediates may impact pathological cellular functions and viability. Here we set out to investigate the role of the nuclear DNA nick sensor enzyme poly(ADP-ribose) polymerase 1 in photochemical treatment (PCT)-induced tumor cell killing. We found that silencing PARP-1 or inhibition of its enzymatic activity with Veliparib had no significant effect on the viability of A431 cells exposed to 8-methoxypsoralen (8-MOP) and UVA (2.5J/cm(2)) indicating that PARP-1 is not likely to be a key player in either cell survival or cell death of PCT-exposed cells. Interestingly, however, another commonly used PARP inhibitor PJ-34 proved to be a photosensitizer with potency equal to 8-MOP. Irradiation of PJ-34 with UVA caused changes both in the UV absorption and in the 1H NMR spectra of the compound with the latter suggesting UVA-induced formation of tautomeric forms of the compound. Characterization of the photosensitizing effect revealed that PJ-34+UVA triggers overproduction of reactive oxygen species, induces DNA damage, activation of caspase 3 and caspase 8 and internucleosomal DNA fragmentation. Cell death in this model could not be prevented by antioxidants (ascorbic acid, trolox, glutathione, gallotannin or cell permeable superoxide dismutase or catalase) but could be suppressed by inhibitors of caspase-3 and -8. In conclusion, PJ-34 is a photosensitizer and PJ-34+UVA causes DNA damage and caspase-mediated cell death independently of PARP-1 inhibition. PMID:27427773

  16. Effects of 8-methoxypsoralen plus 365nm UVA light on Candida albicans cells

    Candida (C.) albicans cells were exposed to 8-Methoxypsoralen (8-MOP) concentrations of 1.0 μg/ml and 10.0 μg/ml medium and irradiated with 365 nm light. The amount of energy emitted was 4.8J/cm2. Two divergent types of cell damage occured concerning yeast cell cytoplasm and cell wall. Two hours after exposure cytoplasmic changes involving mitochondria, which showed irregularities in shape, blurred appearance or loss of mitochondrial cristae and outer membrane were seen. The number of vacuoles was increased. The cytoplasm showed large electron transparent areas, the cytoplasmic membrane disappeared in some areas completely. Nucleus and nuclear envelope usually remained intact in early stages. 24h after exposure conspicuous cell wall alterations were observed in addition to cytoplasmic changes. Newly produced cell wall material formed ball-like protrusions or was adherent sickle-shaped to the cell wall. The investigations strongly suggest that the results found after 8-MOP-UVA treatment of C. albicans cells can not be interpreted in the sense of a general cytotoxic effect. Apparently it takes the form of a combination of events involving regressive and progressive alterations. (orig.)

  17. Studies of DNA and chromosome damage in skin fibroblasts and blood lymphocytes from psoriasis patients treated with 8-methoxypsoralen and UVA irradiation

    Exposure of human lymphocytes and skin fibroblasts in vitro to a single, clinically used dose of PUVA, i.e., 0.1 micrograms/ml of 8-methoxypsoralen (8-MOP) plus 0.9-4 J/cm2 of longwave ultraviolet radiation (UVA), lead to the formation of DNA damage as determined by alkaline elution, and to chromosome aberrations and sister chromatid exchanges (SCE). When lymphocyte-enriched plasma was obtained from psoriasis patients 2 h after oral intake of 8-MOP and then UVA irradiated (1.8-3.6 J/cm2) in vitro, an increased frequency of chromosome aberrations and SCE was observed. Normal levels of chromosome aberrations and SCE were found in lymphocytes of psoriasis patients after 3-30 weeks of PUVA treatment in vivo. A small but statistically significant increase in the SCE frequency was observed in the lymphocytes of psoriasis patients treated for 1-6 years with PUVA (mean 18.0 SCE/cell) as compared with before PUVA (mean 15.8, p less than 0.05). Skin fibroblasts of psoriasis patients analyzed 5 years after the start of PUVA treatment showed a normal number of SCE but a high fraction of filter-retained DNA in the alkaline elution assay, suggesting the presence of cross-linked DNA

  18. Main: 1UVA [RPSD[Archive

    Full Text Available 1UVA イネ Rice Oryza sativa L. Nonspecific Lipid-Transfer Protein 1 Precursor Oryza S...4 Da MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLFAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS rice_1UVA.jpg ...

  19. Photopheresis with UV-A light and 8-methoxypsoralen leads to cell death and to release of blebs with anti-inflammatory phenotype in activated and non-activated lymphocytes

    Stadler, K. [Department for Internal Medicine 3, University Hospital Erlangen (Germany); Frey, B. [Department of Radiation Oncology, University Hospital Erlangen, Universitaetsstr. 27, 91054 Erlangen (Germany); Munoz, L.E.; Finzel, S.; Rech, J. [Department for Internal Medicine 3, University Hospital Erlangen (Germany); Fietkau, R. [Department of Radiation Oncology, University Hospital Erlangen, Universitaetsstr. 27, 91054 Erlangen (Germany); Herrmann, M. [Department for Internal Medicine 3, University Hospital Erlangen (Germany); Hueber, A. [Centre for Rheumatic Diseases, University of Glasgow (United Kingdom); Gaipl, U.S., E-mail: udo.gaipl@uk-erlangen.de [Department of Radiation Oncology, University Hospital Erlangen, Universitaetsstr. 27, 91054 Erlangen (Germany)

    2009-08-14

    Background: Extracorporeal photopheresis is a therapy for treatment of autoimmune diseases, cutaneous T-cell lymphoma, organ graft rejection as well as graft-versus-host diseases. The exact mechanism how the combination of 8-methoxypsoralen plus UV-A irradiation (PUVA) acts is still unclear. We investigated the cell death of activated and non-activated lymphocytes after PUVA treatment as well as the rate of released blebs and their antigen composition. Results: In presence of 8-MOP, UV-A light highly significantly increased the cell death of activated lymphocytes. The same was observed to a lesser extent in non-activated cells. Blebs derived from activated lymphocytes after PUVA treatment showed the highest surface exposition of phosphatidylserine. These blebs also displayed a high exposure of the antigens CD5 and CD8 as well as a low exposure of CD28 and CD86. Conclusion: PUVA treatment exerts anti-inflammatory effects by inducing apoptosis and apoptotic cell-derived blebs with immune suppressive surface composition.

  20. Influence of solar UVA on erythemal irradiances.

    Parisi, A V; Turnbull, D J; Kimlin, M G

    2006-06-21

    Many materials in everyday use such as window glass in homes and offices, glass in sunrooms and greenhouses, vehicle glass and some brands of sunscreens act as a barrier to the shorter UVB wavelengths while transmitting some of the longer UVA wavelengths. This paper reports on the erythemal exposures due to the UVA waveband encountered over a 12-month period for a solar zenith angle (SZA) range of 4 degrees to 80 degrees and the resulting times required for an erythemal exposure of one standard erythemal dose (SED) due to the erythemal exposures to the UVA wavelengths. The minimum time for an exposure of one SED due to the UVA wavelengths in winter is approximately double that what it is in summer. The time period of 40 to 60 min was the most frequent length of time for an exposure of one SED with 60 to 80 min the next frequent length of time required for a one SED exposure. PMID:16757874

  1. Influence of solar UVA on erythemal irradiances

    Parisi, A V [Centre for Rural and Remote Area Health, University of Southern Queensland, Toowoomba 4350 (Australia); Turnbull, D J [Centre for Rural and Remote Area Health, University of Southern Queensland, Toowoomba 4350 (Australia); Kimlin, M G [Institute of Health and Biomedical Innovation, Queensland University of Technology, Brisbane, Qld (Australia)

    2006-06-21

    Many materials in everyday use such as window glass in homes and offices, glass in sunrooms and greenhouses, vehicle glass and some brands of sunscreens act as a barrier to the shorter UVB wavelengths while transmitting some of the longer UVA wavelengths. This paper reports on the erythemal exposures due to the UVA waveband encountered over a 12-month period for a solar zenith angle (SZA) range of 4{sup 0} to 80{sup 0} and the resulting times required for an erythemal exposure of one standard erythemal dose (SED) due to the erythemal exposures to the UVA wavelengths. The minimum time for an exposure of one SED due to the UVA wavelengths in winter is approximately double that what it is in summer. The time period of 40 to 60 min was the most frequent length of time for an exposure of one SED with 60 to 80 min the next frequent length of time required for a one SED exposure.

  2. E/Z MAS demonstration

    Los Alamos National Laboratory has developed E/Z MAS, a new generation nuclear material accountability application based on the latest technology and designed for facilities required to track nuclear materials with a simple-to-use interface. E/Z MAS is based on years of experience spent developing nuclear material accounting systems. E/Z MAS uses a modern relational database with a web server and enables users on a classified local area network to interact with the database with web browsers. The E/Z MAS Demonstration poster session demonstrates the E/Z MAS functions required by an operational nuclear facility to track material as it enters and leaves a facility and to account for the material as it moves through a process. The generation of internal facility reports and external reports for the Russian Federal system will be demonstrated. Bar-code readers will be used to demonstrate the ability of EZ MAS to automate certain functions, such as physical inventories at facilities

  3. In vitro UV-A protection factor (PF-UVA) of organic and inorganic sunscreens.

    Couteau, C; El-Boury, S; Paparis, E; Sébille-Rivain, V; Coiffard, L J M

    2009-01-01

    The objective of this research was to evaluate the efficacy of various sunscreen agents incorporated into an O/W emulsion. Within the scope of this study only an in vitro method was used. According to selected filter UVA, we can obtain more or less effective creams. With the seven available filters, we can cover a range of values between 2 and 12. In addition to these seven filters absorbing in UVA range, variously coated titanium dioxide and zinc oxide were tested as well. So it appears that the best organic UVA filter is anisotriazine at 10% (PF-UVA = 11.82). Its effectiveness is comparable with that of the titanium dioxide forms used at 25%. Photostability in Suntest showed that the more photostable UVA-filters are the benzophenones. PMID:19630696

  4. Synergistic damage by UVA radiation and pollutants.

    Burke, K E; Wei, H

    2009-01-01

    Not only is skin cancer by far the most common human cancer but also the incidence of skin cancer has been increasing at an alarming rate in recent decades. Fortunately, most people now realize that sun exposure causes unattractive photoaging and skin cancer, so they do apply sunscreens conscientiously. However, until recently, most sunscreens did not adequately protect against ultraviolet A (UVA) radiation. Although UVA is indeed less erythrogenic and less carcinogenic than UVB, UVA directly causes photoaging and enhances UVB-induced skin cancer. Furthermore, recent research demonstrates that UVA combined with environmental pollutants (including cigarette smoke) significantly increases the risk of skin cancer. Similarly, previous research demonstrated another synergy between environmental pollutants and UV: When ozone exposure precedes UV exposure, there is enhancement of UV-induced depletion of protective vitamin E from the skin's stratum corneum. This article reviews experimental evidence that environmental pollutants (such as benzo[a]pyrene (BaP), a commonly used index of environmental pollution) are photosensitizers that generate reactive oxygen species (ROS) when exposed to UVA radiation. This in turn causes oxidative and genetic damage, leading to unattractive photodamage and carcinogenesis. PMID:19651790

  5. Utilising polyphenylene oxide for high exposure solar UVA dosimetry

    Turnbull, D. J.; Schouten, P. W.

    2008-05-01

    A personal UV dosimeter that can quantitatively assess high exposure solar UVA exposures has been developed. The chemical polyphenylene oxide has been previously reported on its ability to measure high UVB exposures. This current research has found that polyphenylene oxide, cast in thin film form, is responsive to both the UVA and UVB parts of the solar spectrum. Further to this, the UVB wavelengths were filtered out with the use of mylar. This combined system responded to the UVA wavelengths only and underwent a change in optical absorbance as a result of UVA exposure. Preliminary results indicate that this UVA dosimeter saturates steadily when exposed to sunlight and can measure exposures of more than 20 MJ/m2 of solar UVA radiation with an uncertainty level of no more than ±5%.

  6. Utilising polyphenylene oxide for high exposure solar UVA dosimetry

    D. J. Turnbull

    2008-05-01

    Full Text Available A personal UV dosimeter that can quantitatively assess high exposure solar UVA exposures has been developed. The chemical polyphenylene oxide has been previously reported on its ability to measure high UVB exposures. This current research has found that polyphenylene oxide, cast in thin film form, is responsive to both the UVA and UVB parts of the solar spectrum. Further to this, the UVB wavelengths were filtered out with the use of mylar. This combined system responded to the UVA wavelengths only and underwent a change in optical absorbance as a result of UVA exposure. Preliminary results indicate that this UVA dosimeter saturates steadily when exposed to sunlight and can measure exposures of more than 20 MJ/m2 of solar UVA radiation with an uncertainty level of no more than ±5%.

  7. Utilising polyphenylene oxide for high exposure solar UVA dosimetry

    D. J. Turnbull

    2008-02-01

    Full Text Available Researchers at the University of Southern Queensland have developed a personal UV dosimeter that can quantitatively assess high exposure solar UVA exposures. The chemical polyphenylene oxide has been previously reported on its ability to measure high UVB exposures. This current research has found that polyphenylene oxide, cast in thin film form, is responsive to both the UVA and UVB parts of the solar spectrum. Further to this, the UVB wavelengths were filtered out with the use of mylar. This combined system responded to the UVA wavelengths only and underwent a change in optical absorbance as a result of UVA exposure. Preliminary results indicate that this UVA dosimeter saturates steadily when exposed to sunlight and can measure exposures of more than 20 MJ/m2 of solar UVA radiation with an uncertainty level of no more than ±5%.

  8. UAV Robust Strategy Control Based on MAS

    Jian Han; Changhong Wang; Guoxing Yi

    2014-01-01

    A novel multiagent system (MAS) has been proposed to integrate individual UAV (unmanned aerial vehicle) to form a UAV team which can accomplish complex missions with better efficiency and effect. The MAS based UAV team control is more able to conquer dynamic situations and enhance the performance of any single UAV. In this paper, the MAS proposed and established combines the reacting and thinking abilities to be an initiative and autonomous hybrid system which can solve missions involving coo...

  9. Vegetable surface sterilization system using UVA light-emitting diodes.

    Aihara, Mutsumi; Lian, Xin; Shimohata, Takaaki; Uebanso, Takashi; Mawatari, Kazuaki; Harada, Yumi; Akutagawa, Masatake; Kinouchi, Yohsuke; Takahashi, Akira

    2014-01-01

    Surface sterilization of fresh produce has been needed in the food manufacturing/processing industry. Here we report a UVA-LED (Ultra Violet A-Light Emitting Diode) system for surface sterilization that is safe, efficacious, low cost, and apparently harmless to fresh produce. To test the system, Escherichia coli strain DH5α was spot-inoculated onto vegetable tissues, and treated under UVA-LED. Tissues were homogenized and bacteria quantified by colony-forming assay. Possible effects of UVA-LED on vegetable quality were evaluated by HPLC. Tissue weight changes were checked after treatment at 4℃, 15℃, and 30℃. Bacterial inactivation by UVA-LED radiation was observed after a 10 min treatment and increased with increasing time of irradiation. The log survival ratio reached -3.23 after a 90 min treatment. Bacterial cells surviving treatment grew slowly compared to non-irradiated control cells. Cabbage tissue lost weight over time after treatment, and weight loss increased with increasing incubation temperature, but there was no difference between losses by UVA-LED treated and control tissues at any temperature tested. In addition, no differences of Vitamin C content in cabbage tissue were detected by HPLC after UVA-LED treatment. These results suggest that UVA-LED treatment has great potential for vegetable surface sterilization in the food manufacturing/processing industry. PMID:25264046

  10. Psoralen-UVA-treated psoriatic lesions

    Psoralen-ultraviolet light (PUVA)-treated psoriatic lesions were studied for ultrastructural changes. In early stages of treatment, sunburn cells in the epidermis and bizarre giant cells in the dermis were more frequently observed. When clinical improvement was apparent, these changes had subsided. Dermal abnormality in long-term therapy consisted of a thick perivascular cost of amorphous substance. No abnormality was found in the epidermal keratinocytes in long-term therapy, except a clustering and giant cell formation of melanocytes, a heavy melanization of keratinocytes, and hyperkeratosis. Low-dose initiation and slow increment of both 8-methoxypsoralen and UVA is probably a reasonable regimen for benign dermatoses such as psoriasis because it will allow enough time for the skin to become more protected, while the therapeutic results are as satisfactory as in a high-dose schedule

  11. Fluid flow dynamics in MAS systems.

    Wilhelm, Dirk; Purea, Armin; Engelke, Frank

    2015-08-01

    The turbine system and the radial bearing of a high performance magic angle spinning (MAS) probe with 1.3mm-rotor diameter has been analyzed for spinning rates up to 67kHz. We focused mainly on the fluid flow properties of the MAS system. Therefore, computational fluid dynamics (CFD) simulations and fluid measurements of the turbine and the radial bearings have been performed. CFD simulation and measurement results of the 1.3mm-MAS rotor system show relatively low efficiency (about 25%) compared to standard turbo machines outside the realm of MAS. However, in particular, MAS turbines are mainly optimized for speed and stability instead of efficiency. We have compared MAS systems for rotor diameter of 1.3-7mm converted to dimensionless values with classical turbomachinery systems showing that the operation parameters (rotor diameter, inlet mass flow, spinning rate) are in the favorable range. This dimensionless analysis also supports radial turbines for low speed MAS probes and diagonal turbines for high speed MAS probes. Consequently, a change from Pelton type MAS turbines to diagonal turbines might be worth considering for high speed applications. CFD simulations of the radial bearings have been compared with basic theoretical values proposing considerably smaller frictional loss values. The discrepancies might be due to the simple linear flow profile employed for the theoretical model. Frictional losses generated inside the radial bearings result in undesired heat-up of the rotor. The rotor surface temperature distribution computed by CFD simulations show a large temperature gradient over the rotor. PMID:26073599

  12. Seasonal variations of solar UVB and UVA in Syria

    Seasonal variations of solar UVB (2850320 nm) and UVA (320-400 nm) were measured in three sites in Syria (33-37 N o) for 2 y: 1992-1993. UVB measurements were performed using polysulphone films and Robertson-Berger meters, while UVA measurements were done by a UVA intensity meter. Two sets of measurements were carried out: l) Maximal daily doses 3 times per week (every other day; and 2) Diurnal variations from sunrise to sunset, every 1 h, twice per month (every fortnight). (author). 17 Refs., 5 Figs

  13. A social-democracia do MAS boliviano

    Guilherme Simões Reis

    2013-01-01

    O partido MAS, que governa a Bolívia e é liderado pelo presidente Evo Morales, geralmente é classificado como populista ou como revolucionário. Este artigo contesta ambos os diagnósticos, e sustenta que o MAS é um partido social-democrata. Tanto em sua gênese, como em seu comportamento na oposição, como em suas políticas no governo, o MAS apresenta todas as características necessárias para ser classificado como um representante da social-democracia. Para contestar os diagnósticos predominante...

  14. UVA Phototransduction Drives Early Melanin Synthesis in Human Melanocytes

    Nadine L Wicks; Chan, Jason W.; Najera, Julia A.; Ciriello, Jonathan M.; Oancea, Elena

    2011-01-01

    Exposure of human skin to solar ultraviolet radiation (UVR), a powerful carcinogen [1] comprising ~95% UVA and ~5% UVB at the Earth’s surface, promotes melanin synthesis in epidermal melanocytes [2, 3], which protects skin from DNA damage [4, 5]. UVB causes DNA lesions [6] that lead to transcriptional activation of melanin-producing enzymes, resulting in delayed skin pigmentation within days [7]. In contrast, UVA causes primarily oxidative damage [8] and leads to immediate pigment darkening (...

  15. Efficient DNA interstrand crosslinking by 6-thioguanine and UVA radiation.

    Brem, Reto; Daehn, Ilse; Karran, Peter

    2011-08-15

    Patients taking the immunosuppressant and anticancer thiopurines 6-mercaptopurine, azathioprine or 6-thioguanine (6-TG), develop skin cancer at a very high frequency. Their DNA contains 6-TG which absorbs ultraviolet A (UVA) radiation, and their skin is UVA hypersensitive, consistent with the formation of DNA photodamage. Here we demonstrate that UVA irradiation of 6-TG-containing DNA causes DNA interstrand crosslinking. In synthetic duplex oligodeoxynucleotides, the interstrand crosslinks (ICLs) can form between closely opposed 6-TG bases and, in a less favoured reaction, between 6-TG and normal bases on the opposite strand. In vivo, UVA irradiation of cultured cells containing 6-TG-substituted DNA also causes ICL formation and induces the chromosome aberrations that are characteristically associated with this type of DNA lesion. 6-TG/UVA activates the Fanconi anemia (FA) pathway via monoubiquitination of the FANCD2 protein. Cells defective in the FA pathway or other factors involved in ICL processing, such as XPF and DNA Polζ, are all hypersensitive to killing by 6-TG/UVA-consistent with a significant contribution of photochemical ICLs to the cytotoxicity of this treatment. Our findings suggest that sunlight-exposed skin of thiopurine treated patients may experience chronic photochemical DNA damage that requires constant intervention of the FA pathway. PMID:21723207

  16. Albedo Measurement System for UVA and the Visible Wavelength

    An instrument system to measure the UVA and visible albedo from the snow capped mountain ranges has been built. Albedo is the ratio between the incoming radiation and the reflected radiation for a given location. Measuring albedo of the UVA and the Photosynthetic Active Radiation (PAR) wavelength range involves measuring the global irradiance and the reflections from the slopes around the measuring location. This system can be installed in any mountain peak to measure the reflectivity around the snow covered slopes. Global irradiance is measured by a standard global sensor using a Gigahertz UVA head and a home built UVA head. The UVA reflection is measured by an 1 deg. telescope fitted with a home built UVA head. The home built UVA detector systems have been built using Hamamatsu silicon UV diodes and temperature stabilized using Peltier elements driven by a closed loop feedback control system. Two such similar systems have been built and used for directional and global measurements for direct comparison. PAR reflection is measured by a standard area CCD camera fitted with a wide angle lens and an optical filter. Global PAR is measured by using LI-COR Quantum sensors. The telescope and the CCD camera have been mounted on an Alta-Azimuth mount for scanning the surface around the peak to measure the reflectivity. A set of reflection standards along with the global PAR sensor has been mounted on a boom and fixed with the azimuth table. These reflection standards are visible in the field of view of the CCD camera. This provides the reference pixels in every CCD image that can be used to calibrate the rest of the CCD pixels. This system has been used to make the albedo images at the Zugspitze for the CUVRA (Characteristic of Ultra Violet Radiation in the Alps) project. Preliminary results are shown here. (author)

  17. Comparison of UVA induced cytotoxicity by iodoHoechst isomers

    Full text: Isomers of the DNA minor groove binding ligand, iodoHoechst, have been shown to sensitise DNA to cleavage by ultraviolet type A (UVA). The DNA damage has been attributed to formation of a carbon-centred radical upon UVA induced dehalogenation of the drugs. Comparison of the efficacy of the ligands in inducing DNA single strand breaks in plasmid DNA has indicated that the ortho isomer is more efficient than the para- and meta-isomers, mainly due to a greater cross-section for dehalogenation, and to some extent from increased efficiency of DNA damage per dehalogenation event. In the present study, the efficiency of dehalogenation and cytotoxicity of the three iodoHoechst isomers has been compared in human erythroleukemic, K562 cells. The uptake of the iodoHoechst compounds in K562 nuclei has been measured, and the photoefficiency of the cellular associated dehalogenation by UVA has been established for the three isomers. The results indicate that the sensitivity to UVA mediated dehalogenation is much higher for the ortho analogue compared to the para and meta-analogues. Values of the UVA D37 doses for the ortho, para and meta isomers are 49 ± 2, 327 ± 29 and 251 ± 32 J/m2 , respectively. Clonogenic survival assays have been used to compare the efficiency of sensitisation of cells to UVA irradiation by the analogues. The ortho analogue exhibits higher efficiency compared to the meta and para analogues. The numbers of dehalogenation events required for cell kill have been calculated from the clonogenic survival at various levels of drug uptake, and the results for the ortho, para and meta isomers are 1.2x104 , 3.9x104 and 11.6x104 , respectively. These results indicate that the ortho analogue is the most efficient isomer in sensitising cell kill by UVA irradiation due to both the high quantum yield for dehalogenation and the higher cytotoxic efficiency of dehalogenation events

  18. Effects of arsenite and UVA-1 radiation on calcineurin signaling

    Musson, Ruben E.A., E-mail: rm@ream.nl [Department of Clinical Chemistry, Leiden University Medical Center (Netherlands); Department of Toxicogenetics, Leiden University Medical Center (Netherlands); Mullenders, Leon H.F. [Department of Toxicogenetics, Leiden University Medical Center (Netherlands); Smit, Nico P.M. [Department of Clinical Chemistry, Leiden University Medical Center (Netherlands)

    2012-07-01

    Calcineurin is a Ca{sup 2+}-dependent serine/threonine phosphatase and the target of the immunosuppressive drugs cyclosporin and tacrolimus, which are used in transplant recipients to prevent rejection. Unfortunately, the therapeutic use of this drugs is complicated by a high incidence of skin malignancy, which has set off a number of studies into the role of calcineurin signaling in skin, particularly with respect to cell cycle control and DNA repair. Both UVA1 radiation and arsenic species are known to promote skin cancer development via production of reactive oxygen species. In light of the well-documented sensitivity of calcineurin to oxidative stress, we examined and compared the effects of UVA1 and arsenite on calcineurin signaling. In this paper, we show that physiologically relevant doses of UVA1 radiation and low micromolar concentrations of arsenite strongly inhibit calcineurin phosphatase activity in Jurkat and skin cells and decrease NFAT nuclear translocation in Jurkat cells. The effects on calcineurin signaling could be partly prevented by inhibition of NADPH oxidase in Jurkat cells or increased dismutation of superoxide in Jurkat and skin cells. In addition, both UVA1 and arsenite decreased NF-{kappa}B activity, although at lower concentrations, arsenite enhanced NF-{kappa}B activity. These data indicate that UVA1 and arsenite affect a signal transduction route of growingly acknowledged importance in skin and that calcineurin may serve as a potential link between ROS exposure and impaired tumor suppression.

  19. Caracterização fenológica e produtiva da variedade de uva Superior Seedless cultivada no Vale do São Francisco Phenologic and productive characterization of Superior Seedless grape cultivar in the São Francisco Valley

    LEILSON COSTA GRANGEIRO; PATRÍCIA COELHO DE SOUZA LEÃO; JOSÉ MONTEIRO SOARES

    2002-01-01

    A variedade Superior Seedless, devido não somente às excelentes características morfológicas, mas também ao agradável sabor de seus frutos, tem se destacado nos últimos anos como a principal uva sem sementes cultivada no Vale do São Francisco.Este trabalho teve por objetivo caracterizar o comportamento fenológico e produtivo da variedade de uva Superior Seedless cultivada no Vale do São Francisco. As avaliações foram realizadas em uma área comercial, durante o segundo semestre de 1999 e prime...

  20. Impact of UVA exposure on psychological parameters and circulating serotonin and melatonin

    Sauermann Kirsten; Bechara Falk G; Vojvodic Mirjana; Bader Armin; Gambichler Thilo; Altmeyer Peter; Hoffmann Klaus

    2002-01-01

    Abstract Background People tend to feel better after exposure to ultraviolet (UV) radiation. This study was performed to investigate the impact of UVA exposure on psychological and neuroendocrine parameters. Methods Fifty-three volunteers were separated into 42 individuals who had UVA exposure and 11 individuals who had no UVA exposure. The UVA-exposed volunteers had irradiation sessions six times in a three-week period. All volunteers completed two questionnaires at baseline (T1) and at the ...

  1. Enhancement of cutaneous delayed hypersensitivity reactions by a single exposure to UV-A or PUVA

    Moberg, S.; Mobacken, H.

    1982-03-01

    The influence of irradiation with UV-A and PUVA (8-methoxy-psoralen and UV-A) on delayed hypersensitivity reactions to microbial antigens was studied in healthy human individuals. Skin reactions to Candida albicans antigen and PPD were enhanced by UV-A als well as by PUVA compared with nonirradiated tests. A statistically significant difference was reached with UV-A for both antigens. For PUVA, erythemogenic doses to Candida tests produced a significant increase of response.

  2. Enhancement of cutaneous delayed hypersensitivity reactions by a single exposure to UV-A or PUVA

    The influence of irradiation with UV-A and PUVA (8-methoxy-psoralen and UV-A) on delayed hypersensitivity reactions to microbial antigens was studied in healthy human individuals. Skin reactions to Candida albicans antigen and PPD were enhanced by UV-A als well as by PUVA compared with nonirradiated tests. A statistically significant difference was reached with UV-A for both antigens. For PUVA, erythemogenic doses to Candida tests produced a significant increase of response. (orig.)

  3. QUALIDADE FÍSICO-QUÍMICA DA UVA E PERFIL SENSORIAL VÍNICO PARA DIFERENTES CULTIVARES DE VIDEIRA SUBMETIDAS À PODA MECANIZADA

    ANTONIO ODAIR SANTOS

    2015-06-01

    Full Text Available Estudos ao longo do Globo têm mostrado que a mecanização da poda, dentre outros processos de manejo da videira, é adequada para a obtenção de vinhedos com “stands” bem formados e com qualidade de produção equivalente ou superior àqueles conduzidos sob manejo manual, sobretudo com economia de capital humano e financeiro. Informações sobre o padrão de poda que influencia diretamente a ecofisiologia do dossel, a composição do rendimento e a qualidade de derivados da uva são existentes para condições de manejo tradicional manual, mas incipientes para a uma condição mecanizada, no Brasil. Um experimento foi realizado com Vitis sp. e Vitis vinifera, visando a estudar os impactos da adoção inicial da poda mecanizada, sobre a composição do rendimento, qualidade da uva e perfil sensorial dos vinhos produzidos no experimento. Os resultados mostraram que a aplicação da poda mecanizada em vinhedos tradicionais causou pequenas flutuações na qualidade da uva, em duas safras analisadas.

  4. Impactos socioambientais e de segurança do alimento na gestão da produção integrada de uvas finas de mesa

    Francisco Alves Pinheiro

    2009-05-01

    Full Text Available Este artigo procurou identificar e analisar os impactos socioambientais e de Segurança do
    Alimento do processo de certificação da produção de uvas finas de mesa no programa de
    Produção Integrada de Uva (PI-UVA recentemente implantado na região do Submédio do
    Vale do rio São Francisco, no município de Petrolina. A metodologia adotada baseou-se em
    um estudo de caso, analisando-se o processo de certificação vivenciado por uma média
    empresa da região. Os resultados obtidos apontam que a certificação não é só
    compensadora em termos de abertura e manutenção de importantes fatias do mercado
    externo, mas, mesmo internamente apresenta vantagens ao nível do controle operacional e
    satisfação no trabalho entre seus funcionários

  5. Estudo cinético da secagem da uva Isabel para produção de uva passa

    Antônio Vitor Machado; José Aldenor de Souza; Rafael da Silva Novaes

    2015-01-01

    A fruticultura é um dos segmentos mais importantes na agricultura nacional, porém um grande problema enfrentado pelos fruticultores é a conservação dos frutos maduros. A falta de tecnologias adequadas para o melhor aproveitamento dos frutos tem resultado em um alto índice de desperdício, cerca de toneladas ano. A uva Isabel, é uma das principais variedades Vitis labrusca, que apresenta sabor característico e pigmentação bastante acentuada, destacando-se como uva de mesa comum, apresentando-se...

  6. Ultra-low temperature MAS-DNP

    Lee, Daniel; Bouleau, Eric; Saint-Bonnet, Pierre; Hediger, Sabine; De Paëpe, Gaël

    2016-03-01

    Since the infancy of NMR spectroscopy, sensitivity and resolution have been the limiting factors of the technique. Regular essential developments on this front have led to the widely applicable, versatile, and powerful spectroscopy that we know today. However, the Holy Grail of ultimate sensitivity and resolution is not yet reached, and technical improvements are still ongoing. Hence, high-field dynamic nuclear polarization (DNP) making use of high-frequency, high-power microwave irradiation of electron spins has become very promising in combination with magic angle sample spinning (MAS) solid-state NMR experiments. This is because it leads to a transfer of the much larger polarization of these electron spins under suitable irradiation to surrounding nuclei, greatly increasing NMR sensitivity. Currently, this boom in MAS-DNP is mainly performed at minimum sample temperatures of about 100 K, using cold nitrogen gas to pneumatically spin and cool the sample. This Perspective deals with the desire to improve further the sensitivity and resolution by providing "ultra"-low temperatures for MAS-DNP, using cryogenic helium gas. Different designs on how this technological challenge has been overcome are described. It is shown that stable and fast spinning can be attained for sample temperatures down to 30 K using a large cryostat developed in our laboratory. Using this cryostat to cool a closed-loop of helium gas brings the additional advantage of sample spinning frequencies that can greatly surpass those achievable with nitrogen gas, due to the differing fluidic properties of these two gases. It is shown that using ultra-low temperatures for MAS-DNP results in substantial experimental sensitivity enhancements and according time-savings. Access to this temperature range is demonstrated to be both viable and highly pertinent.

  7. Different effects of irradiation with UVA and UVB radiation

    Buehring, M.; Kemmerer, K.; Pirlet, K.; Bocionek, P.; Wolff, F.; Schulz-Amling, W.

    1982-08-01

    Single irradiations with UVA and UVB and a sham irradiation were administered to twelve test persons. The UVB exposition was realized partly with an erythemogenic dose and partly with a weaker dose. During the first 24 hours after the irradiation, the pulse rate was constant at rest, under orthostatic load and during an easy corporal work with 7 mkp/s/1.73 m/sup 3/. Two further groups (n = 12) were treated at regular intervals during four weeks with an UVA or UVB irradiation, respectively (suberythemogenic dose). Compared with the results of a pre-examination, the elasticity coefficient according to Broemser and Ranke as well as the times of reaction to an optic and an acoustic signal were unchanged after the irradiation series. The pulse rate measured at rest, under orthostatic load and during an easy corporal work showed a decrease after UVB irradiation. These values were not influenced by UVA. Thus, the UVA irradiation applied in modern solaria does not influence essential circulatory values and vigilance as determined by a simple measurement value. The values measured after UVB irradiation are compared to other communications in literature which until now are contrary to one another.

  8. UVA I-protection effectiveness of bioactive compound and organic UV filters: an in vitro assessment

    André Rolim Baby

    2009-01-01

    Full Text Available This research work aimed at determining the UVA effectiveness (UVA I/UV ratio, by diffuse transmittance analysis, of sunscreens developed with a bioactive substance, the rutin, associating or not with organic UVB-UVA filters incorporated at a phosphate-base O/W emulsion. Sunscreens provided conflicting and unpredictable results concerning the anti-UVA protection, specially, at the UVA I region. Possible interactions among the organic UV filters and the polyphenolic bioactive substance may have accounted with improvement or reduction of UV protection by a complex and not yet elucidated mechanism, probably regarding wavelength delocalization to superior or inferior values, by resonant molecule stabilization or destabilization.

  9. Quantitative assessment of cumulative damage from repetitive exposures to suberythemogenic doses of UVA in human skin

    Daily exposures to relatively small suberythemogenic fluences of UVA (50-200 kJ/m2) for 8 days resulted in cumulative morphological skin alterations indicative of early tissue injury. Histologically, irradiated skin revealed epidermal hyperplasia, inflammation and deposition of lysozyme along the dermal elastic fiber network. Sunburn cells were also present within the epidermis. These changes were quantified by image analysis and were found to be related to the cumulative UVA fluence. A long UVA waveband (UVAI, 340-400 nm) was as effective as a broad UVA band (320-400 nm), suggesting that these changes are induced by longer UVA wavelengths. (author)

  10. Efeito da safra vitícola na composição da uva, do mosto e do vinho Isabel da Serra Gaúcha, Brasil

    Rizzon Luiz Antenor

    2006-01-01

    Full Text Available Entre os fatores que interferem na composição e na qualidade do vinho, destaca-se a safra vitícola, com suas variações climáticas. Com este objetivo, avaliou-se o efeito das safras de 1999, 2000 e 2001 na composição da uva, do mosto e do vinho Isabel da Serra Gaúcha. Nesse sentido, foram selecionados vinte e dois produtores de uva Isabel de onze municípios dessa região. Por ocasião da maturação, para as avaliações da uva e do mosto e a elaboração das microvinificações, foram colhidos 60kg de uva de cada viticultor. A safra vitícola interferiu significativamente no peso do cacho e da baga, mas não alterou a relação peso da ráquis/peso do cacho. No mosto, observaram-se diferenças em todas as variáveis, exceto para a relação degreesBrix/acidez total. No vinho, teve efeito na maior parte das variáveis avaliadas, com exceção aos cátions K, Mn, Cu e Rb. Em geral, a safra de 1999 foi a melhor, pois apresentou parâmetros mais adequados de acidez total, extrato seco, extrato seco reduzido, alcalinidade das cinzas, taninos, antocianinas e glicerol, variáveis essas que determinam a estrutura e a cor dos vinhos, importantes fatores para sua qualidade.

  11. Interlamellar cohesion after corneal crosslinking using riboflavin and UVA

    Wollensak, Gregor; Spörl, Eberhard; Mazzotta, Cosimo; Kalinski, Thomas; Sel, Saadettin

    2011-01-01

    Abstract ABSTRACT Aims: Collagen crosslinking (CXL) treatment of progressive keratoconus using the photosensitizer riboflavin and UVA light of 370 nm wavelength has been shown to increase significantly the tensile strength of corneal collagen by about 300%. In keratoconus, interlamellar and interfibrillar slippage have been proposed as pathogenetic mechanism. Therefore, the aim of this study was to assess the impact of CXL on the interlamellar cohesive force. Methods: 72 po...

  12. Sensing and Responding to UV-A in Cyanobacteria

    Young-Ho Chung

    2012-12-01

    Full Text Available Ultraviolet (UV radiation can cause stresses or act as a photoregulatory signal depending on its wavelengths and fluence rates. Although the most harmful effects of UV on living cells are generally attributed to UV-B radiation, UV-A radiation can also affect many aspects of cellular processes. In cyanobacteria, most studies have concentrated on the damaging effect of UV and defense mechanisms to withstand UV stress. However, little is known about the activation mechanism of signaling components or their pathways which are implicated in the process following UV irradiation. Motile cyanobacteria use a very precise negative phototaxis signaling system to move away from high levels of solar radiation, which is an effective escape mechanism to avoid the detrimental effects of UV radiation. Recently, two different UV-A-induced signaling systems for regulating cyanobacterial phototaxis were characterized at the photophysiological and molecular levels. Here, we review the current understanding of the UV-A mediated signaling pathways in the context of the UV-A perception mechanism, early signaling components, and negative phototactic responses. In addition, increasing evidences supporting a role of pterins in response to UV radiation are discussed. We outline the effect of UV-induced cell damage, associated signaling molecules, and programmed cell death under UV-mediated oxidative stress.

  13. Broadband Direct UVA irradiance measurement for clear skies evaluated using a smartphone

    UVA wavelengths (320-400 nm) have been implicated in recent studies to contribute to melanoma induction and skin photo-aging in humans and damage to plants. The use of smartphones in UVA observations is a way to supplement measurements made by traditional radiometric and spectro-radiometric technology. Although the smartphone image sensor is not capable of determining broadband UVA irradiances, these can be reconstructed from narrowband irradiances, which the smartphone, with narrowband and neutral density filters, can quantify with discrepancies not exceeding 5 %. Three models that reconstruct direct broadband clear sky UVA were developed from narrowband irradiances derived from smartphone image sensor pixel data with coefficients of determination of between 0.97 and 0.99. Reasonable accuracy and precision in determining the direct broadband UVA was maintained for observations made with solar zenith angles as high as 70 deg. . The developed method has the potential to increase the uptake of the measurement of broadband UVA irradiances. (authors)

  14. Effect of UVA Fluence Rate on Indicators of Oxidative Stress in Human Dermal Fibroblasts

    James D. Hoerter, Christopher S. Ward, Kyle D. Bale, Admasu N. Gizachew, Rachelle Graham, Jaclyn Reynolds, Melanie E. Ward, Chesca Choi, Jean-Leonard Kagabo, Michael Sauer, Tara Kuipers, Timothy Hotchkiss, Nate Banner, Renee A. Chellson, Theresa Ohaeri, L

    2008-01-01

    Full Text Available During the course of a day human skin is exposed to solar UV radiation that fluctuates in fluence rate within the UVA (290-315 nm and UVB (315-400 nm spectrum. Variables affecting the fluence rate reaching skin cells include differences in UVA and UVB penetrating ability, presence or absence of sunscreens, atmospheric conditions, and season and geographical location where the exposure occurs. Our study determined the effect of UVA fluence rate in solar-simulated (SSR and tanning-bed radiation (TBR on four indicators of oxidative stress---protein oxidation, glutathione, heme oxygenase-1, and reactive oxygen species--in human dermal fibroblasts after receiving equivalent UVA and UVB doses. Our results show that the higher UVA fluence rate in TBR increases the level of all four indicators of oxidative stress. In sequential exposures when cells are exposed first to SSR, the lower UVA fluence rate in SSR induces a protective response that protects against oxidative stress following a second exposure to a higher UVA fluence rate. Our studies underscore the important role of UVA fluence rate in determining how human skin cells respond to a given dose of radiation containing both UVA and UVB radiation.

  15. Increased vascular sympathetic modulation in mice with Mas receptor deficiency

    Rabello Casali, K.; Ravizzoni Dartora, D.; Moura, M; Bertagnolli, M.; Bader, M; Haibara, A.; Alenina, N; Irigoyen, M.C.; Santos, R. A

    2016-01-01

    Introduction: The angiotensin-converting enzyme 2 (ACE2)/angiotensin (Ang)-(1–7)/Mas axis could modulate the heart rate (HR) and blood pressure variabilities (BPV) which are important predictors of cardiovascular risk and provide information about the autonomic modulation of the cardiovascular system. Therefore we investigated the effect of Mas deficiency on autonomic modulation in wild type and Mas-knockout (KO) mice. Methods: Blood pressure was recorded at high sample rate (4000 Hz). Statio...

  16. Nanosatellites for Earth Environmental Monitoring: The MicroMAS Project

    Blackwell, William; Allen, G; Conrad, S.; Galbraith, C.; Kingsbury, R.; Leslie, R; McKinley, P.; Osaretin, I.; W. Osborn; Reid, B.; Retherford, L.; Scarito, M.; Semisch, C.; Shield, M; Silver, M

    2012-01-01

    The Micro-sized Microwave Atmospheric Satellite (MicroMAS) is a dual-spinning 3U CubeSat equipped with a passive microwave spectrometer that observes nine channels near the 118.75-GHz oxygen absorption line. The focus of this MicroMAS mission (hereafter, MicroMAS-1) is to observe convective thunderstorms, tropical cyclones, and hurricanes from a near-equatorial orbit. The MicroMAS-1 flight unit is currently being developed by MIT Lincoln Laboratory, the MIT Space Systems Laboratory, and the M...

  17. Photoprotection by dietary phenolics against melanogenesis induced by UVA through Nrf2-dependent antioxidant responses.

    Chaiprasongsuk, Anyamanee; Onkoksoong, Tasanee; Pluemsamran, Thanyawan; Limsaengurai, Saowalak; Panich, Uraiwan

    2016-08-01

    Dietary phenolics may play a protective role in UV-mediated skin pigmentation through their antioxidant and UV-absorbing actions. In this study, we investigated whether genetic silencing of Nrf2, regulating the transcription of antioxidant genes, affected melanogenesis in primary human epidermal melanocytes (HEMn) and B16F10 melanoma cells subjected to UVA (8J/cm(2)) exposure. Then, we explored the antimelanogenic actions of phenolics; caffeic acid (CA) and ferulic acid (FA) providing partial UVA protection; quercetin (QU) and rutin (RU) providing strong UVA protection and; avobenzone (AV), an efficient UVA filter, in association with modulation of Nrf2-mediated antioxidant defenses in response to UVA insults in B16F10 cells. Upon oxidative insults, Nrf2 silencing promoted melanogenesis in both HEMn and B16F10 cells irradiated with UVA. Stimulation of melanogenesis by UVA correlated with increased ROS and oxidative DNA damage (8-OHdG), GSH depletion as well as a transient downregulation of Nrf2 nuclear translocation and of Nrf2-ARE signaling in B16F10 cells. All test compounds exerted antimelanogenic effects with respect to their abilities to reverse UVA-mediated oxidative damage as well as downregulation of Nrf2 activity and its target antioxidants (GCLC, GST and NQO1) in B16F10 cells. In conclusion, defective Nrf2 may promote melanogenesis under UVA irradiation through oxidative stress mechanisms. Compounds with antioxidant and/or UVA absorption properties could protect against UVA-induced melanogenesis through indirect regulatory effect on Nrf2-ARE pathway. PMID:26765101

  18. Phototoxic effects of 8-methoxypsoralen on rabbit corneal endothelium

    The phototoxic effects of 8-methoxypsoralen (8-MOP) were investigated using the rabbit corneal endothelium in organ culture. The corneas were divided into four groups: (a) irradiated with a mercury vapor lamp (emitting UVA and visible radiation) in the presence of 8-MOP (experimental), (b) irradiated without 8-MOP (control A), (c) incubated with 8-MOP (control B) and (d) incubated without 8-MOP (control C). Specular and light microscopic examination showed that the experimental corneas had greater cellular damage compared to the control corneas. The effects of 8-MOP were restricted to certain localized areas of the cornea. However there was no significant difference in the amounts of 51Cr released from the labelled experimental and control corneas. These results show phototoxic damage of the corneal endothelial cells

  19. Phototoxic effects of 8-methoxypsoralen on rabbit corneal endothelium

    Menon, I.A.; Basu, P.K.; Hasany, S.M.; Persad, S.D. (Univ. of Toronto, Ontario (Canada))

    1989-01-01

    The phototoxic effects of 8-methoxypsoralen (8-MOP) were investigated using the rabbit corneal endothelium in organ culture. The corneas were divided into four groups: (a) irradiated with a mercury vapor lamp (emitting UVA and visible radiation) in the presence of 8-MOP (experimental), (b) irradiated without 8-MOP (control A), (c) incubated with 8-MOP (control B) and (d) incubated without 8-MOP (control C). Specular and light microscopic examination showed that the experimental corneas had greater cellular damage compared to the control corneas. The effects of 8-MOP were restricted to certain localized areas of the cornea. However there was no significant difference in the amounts of 51Cr released from the labelled experimental and control corneas. These results show phototoxic damage of the corneal endothelial cells.

  20. Period of remission after treatment with UVA-1 in sclerodermic skin diseases.

    Kroft, E.B.M.; Kerkhof, P.C.M. van de; Gerritsen, M.J.P.; Jong, E.M.G.J. de

    2008-01-01

    BACKGROUND: Sclerodermic skin diseases can cause severe morbidity and disability. UVA-1 has shown to be an effective therapy for sclerodermic skin diseases. However, the period of remission in these patients is not clear. In this study, the effect and remission period of UVA-1 phototherapy in variou

  1. Morphology, anatomy and histology of Doto uva Marcus, 1955 (Opisthobranchia: Nudibranchia) from the Chilean coast

    Fischer, M.A.; Velde, van der G.; Roubos, E.W.

    2006-01-01

    Doto uva Marcus, 1955 is a nudibranch species recorded from the Brazilian and Chilean coast. In spite of its wide distribution, D. uva has been described only superficially, mainly as to the pattern of its coloration, external morphology, radular teeth and reproductive system. Here we substantially

  2. Exposure of vitamins to UVB and UVA radiation generates singlet oxygen.

    Knak, Alena; Regensburger, Johannes; Maisch, Tim; Bäumler, Wolfgang

    2014-05-01

    Deleterious effects of UV radiation in tissue are usually attributed to different mechanisms. Absorption of UVB radiation in cell constituents like DNA causes photochemical reactions. Absorption of UVA radiation in endogenous photosensitizers like vitamins generates singlet oxygen via photosensitized reactions. We investigated two further mechanisms that might be involved in UV mediated cell tissue damage. Firstly, UVB radiation and vitamins also generate singlet oxygen. Secondly, UVB radiation may change the chemical structure of vitamins that may change the role of such endogenous photosensitizers in UVA mediated mechanisms. Vitamins were irradiated in solution using monochromatic UVB (308 nm) or UVA (330, 355, or 370 nm) radiation. Singlet oxygen was directly detected and quantified by its luminescence at 1270 nm. All investigated molecules generated singlet oxygen with a quantum yield ranging from 0.007 (vitamin D3) to 0.64 (nicotinamide) independent of the excitation wavelength. Moreover, pre-irradiation of vitamins with UVB changed their absorption in the UVB and UVA spectral range. Subsequently, molecules such as vitamin E and vitamin K1, which normally exhibit no singlet oxygen generation in the UVA, now produce singlet oxygen when exposed to UVA at 355 nm. This interplay of different UV sources is inevitable when applying serial or parallel irradiation with UVA and UVB in experiments in vitro. These results should be of particular importance for parallel irradiation with UVA and UVB in vivo, e.g. when exposing the skin to solar radiation. PMID:24691875

  3. Impact of UVA exposure on psychological parameters and circulating serotonin and melatonin

    Sauermann Kirsten

    2002-04-01

    Full Text Available Abstract Background People tend to feel better after exposure to ultraviolet (UV radiation. This study was performed to investigate the impact of UVA exposure on psychological and neuroendocrine parameters. Methods Fifty-three volunteers were separated into 42 individuals who had UVA exposure and 11 individuals who had no UVA exposure. The UVA-exposed volunteers had irradiation sessions six times in a three-week period. All volunteers completed two questionnaires at baseline (T1 and at the end of the study (T3. For the determination of serotonin and melatonin serum levels of all volunteers blood samples were collected at baseline (T1, after the first UVA exposure (T2, and at the end of the study after the sixth exposure (T3. Results UVA-exposed volunteers felt significantly more balanced, less nervous, more strengthened, and more satisfied with their appearance at T3. By contrast, the controls did not show significant changes of psychological parameters. In comparison to T1 and T3, serum serotonin was significantly higher and the serum melatonin was significantly lower for the volunteers exposed to UVA at T2. Both, for exposed and non-exposed volunteers serotonin and melatonin levels did not significantly differ at T1 and T3. Conclusions It remains obscure, whether the exposure to UVA or other components of the treatment were responsible for the psychological benefits observed. The changes of circulating neuroendocrine mediators found after UVA exposure at T2 may be due to an UVA-induced effect via a cutaneous pathway. Nevertheless, the positive psychological effects observed in our study cannot be attributed to circulating serotonin or melatonin.

  4. Protective effect of UV-A radiation during acclimation of the photosynthetic apparatus to UV-B treatment.

    Štroch, Michal; Materová, Zuzana; Vrábl, Daniel; Karlický, Václav; Šigut, Ladislav; Nezval, Jakub; Špunda, Vladimír

    2015-11-01

    We examined the acclimation response of the photosynthetic apparatus of barley (Hordeum vulgare L.) to a combination of UV-A and UV-B radiation (UVAB) and to UV-B radiation alone. Our aim was to evaluate whether UV-A radiation prevents UV-B-induced damage to the photosynthetic apparatus and whether UV-A pre-acclimation is required to mitigate the negative influence of UV-B radiation. Barley plants were grown from seeds under low photosynthetically active radiation (50 μmol m(-2) s(-1)) either in the absence or presence of UV-A radiation (UVA- and UVA+ plants, respectively). After 8 days of development, plants were exposed simultaneously to UV-A and UV-B radiation for the next 6 days. Additionally, UVA- plants were exposed to UV-B radiation alone. The UVA+ plants had a higher CO2 assimilation rate near the light-saturation region (A(N)) and a higher content of both total chlorophylls (Chls) and total carotenoids than the UVA- plants. Chls content, A(N), the potential quantum yield of photosystem II (PSII) photochemistry (F(V)/F(M)), the capacity of light-induced thermal energy dissipation and the efficiency of excitation energy transfer within PSII remained the same or even increased in both UVA+ and UVA- plants after UVAB treatment. On the contrary, exposure of UVA- plants to UV-B radiation itself led to a reduction in all these characteristics. We revealed that the presence of UV-A radiation during UVAB treatment not only mitigated but completely eliminated the negative effect of UV-B radiation on the functioning of the photosynthetic apparatus and that UV-A pre-acclimation was not crucial for development of this UV-A-induced resistance against UV-B irradiation. PMID:26233710

  5. Acute whole body UVA irradiation combined with nitrate ingestion enhances time trial performance in trained cyclists.

    Muggeridge, David J; Sculthorpe, Nicholas; Grace, Fergal M; Willis, Gareth; Thornhill, Laurence; Weller, Richard B; James, Philip E; Easton, Chris

    2015-08-01

    Dietary nitrate supplementation has been shown to increase nitric oxide (NO) metabolites, reduce blood pressure (BP) and enhance exercise performance. Acute exposure to ultraviolet (UV)-A light also increases NO bioavailability and reduces BP. We conducted a randomized, counterbalanced placebo-controlled trial to determine the effects of UV-A light alone and in combination with nitrate on the responses to sub-maximal steady-state exercise and time trial (TT) performance. Nine cyclists (VO2max 53.1 ± 4.4 ml/kg/min) completed five performance trials comprising 10 min submaximal steady-state cycling followed by a 16.1 km TT. Following a familiarization the final four trials were preceded, in random order, by either (1) Nitrate gels (NIT) + UV-A, (2) Placebo (PLA) + UV-A, (3) NIT + Sham light (SHAM) and (4) PLA + SHAM (control). The NIT gels (2 × 60 ml gels, ~8.1 mmol nitrate) or a low-nitrate PLA were ingested 2.5 h prior to the trial. The light exposure consisted of 20 J/cm(2) whole body irradiation with either UV-A or SHAM light. Plasma nitrite was measured pre- and post-irradiation and VO2 was measured continuously during steady-state exercise. Plasma nitrite was higher for NIT + SHAM (geometric mean (95% CI), 332 (292-377) nM; P = 0.029) and NIT + UV-A (456 (312-666) nM; P = 0.014) compared to PLA + SHAM (215 (167-277) nM). Differences between PLA + SHAM and PLA + UV-A (282 (248-356) nM) were small and non-significant. During steady-state exercise VO2 was reduced following NIT + UVA (P = 0.034) and tended to be lower in NIT + SHAM (P = 0.086) but not PLA + UV-A (P = 0.381) compared to PLA + SHAM. Performance in the TT was significantly faster following NIT + UV-A (mean ± SD 1447 ± 41 s P = 0.005; d = 0.47), but not PLA + UV-A (1450 ± 40 s; d = 0.41) or NIT + SHAM (1455 ± 47 s; d = 0.28) compared to PLA + SHAM (1469 ± 52 s). These findings demonstrate that exposure to UV-A light alone does not alter the physiological responses to exercise or improve

  6. Estudo cinético da secagem da uva Isabel para produção de uva passa

    Antônio Vitor Machado

    2015-03-01

    Full Text Available A fruticultura é um dos segmentos mais importantes na agricultura nacional, porém um grande problema enfrentado pelos fruticultores é a conservação dos frutos maduros. A falta de tecnologias adequadas para o melhor aproveitamento dos frutos tem resultado em um alto índice de desperdício, cerca de toneladas ano. A uva Isabel, é uma das principais variedades Vitis labrusca, que apresenta sabor característico e pigmentação bastante acentuada, destacando-se como uva de mesa comum, apresentando-se como uma variedade de grande aceitação pelo consumidor e pela indústria de alimentos. A desidratação de frutas vem sendo objeto de muitas pesquisas com o propósito de se obter técnicas que proporcionem, além de baixo custo de produção, a manutenção da qualidade dos produtos desidratados e a redução das perdas pós-colheita. Neste sentido o presente trabalho objetivou estudar a secagem da uva Isabel para obtenção de uva passa desidratada, visando obter informações sobre a qualidade do fruto in-natura e após processamento, realizando-se para isto à caracterização físico-química do fruto in-natura e desidratado. Foram realizadas análises de pH, sólidos solúveis, acidez total titulável,  umidade, atividade de água e do teor de antocianinas nos Laboratórios de Tecnologia da UFERSA e UFCG. De acordo com os resultados obtidos, os frutos desidratados apresentaram um incremento nos teores de sólidos solúveis (de 11,17 para 45° brix, da acidez titulável (de 0,73 para 1,34% e do teor de antocianina, que foi elevado de 117,83 mg/100g para 380,52 mg/100g de fruto desidratado, e redução quanto aos valores de umidade (de 85,65 para 21,75% e atividade de água (de 0,90 para 0,66, estes valores de nutrientes apresentaram-se próximos aos relatados na literatura demonstrando que a secagem solar é uma excelente alternativa para a conservação da uva Isabel, contribuindo assim para redução das perdas pós-colheita e com a

  7. A Construction Way of MAS Based on Organization Theory

    GAO Bo; FEI Qi; CHEN Xue-guang

    2002-01-01

    With emphasizing that the integration of autonomy and coordination is the basis for constructing multi-agent systems (MAS), we analyze the organizational characters inherent with MAS and point out that it's a natural and essential way to construct MAS based on organization theory. We consider that the emphasis of the theory is the process of system analyzing. Then we present an analysis frame to expound the process, which includes the process of organization definition, the process of role definition, the process of organizational structure definition and the process of interaction protocol definition. Lastly, we discuss some issues associated with the processes of system design and implementation.

  8. Effects of long-wavelength ultraviolet (UV-A) radiation on the growth of Anacystis Nidulans

    The growth of Anacystis nidulans cells which had been grown under visible light only (>390 nm) was suppressed by long-wavelength ultraviolet (UV-A, 320-390 nm) radiation. The growth resumed after 24 h. Cells grown under UV-A supplemented light contained less chlorophyll and phycocyanin and more carotenoid than control cells. The finding that UV-A radiation inhibited the rate of delta-aminolevulinic acid synthesis indicated that the decreases in the photosynthetic pigments were mainly due to the inhibition of their biosynthesis rather than to photodestruction of pigments by UV-A radiation. The primary cause of the inhibitory effects seems to be the inhibition of the photosynthetic process which can be measured as the rho-benzoquinone Hill reaction. Previous exposure to UV-A radiation conferred some resistance on the cells to this inhibitory radiation. Thus UV-A radiation itself may activate a system that repairs damage caused by UV-A radiation and/or protects against the radiation. (author)

  9. Apoptosis induction is involved in UVA-induced autolysis in sea cucumber Stichopus japonicus.

    Qi, Hang; Fu, Hui; Dong, Xiufang; Feng, Dingding; Li, Nan; Wen, Chengrong; Nakamura, Yoshimasa; Zhu, Beiwei

    2016-05-01

    Autolysis easily happens to sea cucumber (Stichopus japonicus, S. japonicus) for external stimulus like UV exposure causing heavy economic losses. Therefore, it is meaningful to reveal the mechanism of S. japonicas autolysis. In the present study, to examine the involvement of apoptosis induction in UVA-induced autolysis of S. japonicas, we investigated the biochemical events including the DNA fragmentation, caspase-3 activation, mitogen-activated protein kinases (MAPKs) phosphorylation and free radical formation. Substantial morphological changes such as intestine vomiting and dermatolysis were observed in S. japonicus during the incubation after 1-h UVA irradiation (10W/m(2)). The degradation of the structural proteins and enhancement of cathepsin L activity were also detected, suggesting the profound impact of proteolysis caused by the UVA irradiation even for 1h. Furthermore, the DNA fragmentation and specific activity of caspase-3 was increased up to 12h after UVA irradiation. The levels of phosphorylated p38 mitogen activated protein kinase (MAPK) and phosphorylated c-Jun.-N-terminal kinase (JNK) were significantly increased by the UVA irradiation for 1h. An electron spin resonance (ESR) analysis revealed that UVA enhanced the free radical formation in S. japonicas, even through we could not identify the attributed species. These results suggest that UVA-induced autolysis in S. japonicas at least partially involves the oxidative stress-sensitive apoptosis induction pathway. These data present a novel insight into the mechanisms of sea cucumber autolysis induced by external stress. PMID:26971278

  10. Role of Pin1 in UVA-induced cell proliferation and malignant transformation in epidermal cells

    Highlights: → Pin1 expression is enhanced by low energy UVA irradiation in both skin tissues of hairless mice and JB6 C141 epidermal cells. → UVA irradiation increases activator protein-1 activity and cyclin D1 in a Pin1-dependent manner. → UVA potentiates EGF-inducible, anchorage-independent growth of epidermal cells, and this is suppressed by Pin1 inhibition or by anti-oxidant. -- Abstract: Ultraviolet A (UVA) radiation (λ = 320-400 nm) is considered a major cause of human skin cancer. Pin1, a peptidyl prolyl isomerase, is overexpressed in most types of cancer tissues and plays an important role in cell proliferation and transformation. Here, we demonstrated that Pin1 expression was enhanced by low energy UVA (300-900 mJ/cm2) irradiation in both skin tissues of hairless mice and JB6 C141 epidermal cells. Exposure of epidermal cells to UVA radiation increased cell proliferation and cyclin D1 expression, and these changes were blocked by Pin1 inhibition. UVA irradiation also increased activator protein-1 (AP-1) minimal reporter activity and nuclear levels of c-Jun, but not c-Fos, in a Pin1-dependent manner. The increases in Pin1 expression and in AP-1 reporter activity in response to UVA were abolished by N-acetylcysteine (NAC) treatment. Finally, we found that pre-exposure of JB6 C141 cells to UVA potentiated EGF-inducible, anchorage-independent growth, and this effect was significantly suppressed by Pin1inhibition or by NAC.

  11. POLIFENOLOXIDASA Y PEROXIDASA DE PULPA DE UVA CAIMARONA (Pourouma cecropiifolia)

    Ángela Patricia Rivera Camelo; Patricia Restrepo; Carlos Eduardo Narvaez Cuenca

    2008-01-01

    Las enzimas polifenoloxidasa (PFO) y peroxidasa (POD) fueron extraídas de la pulpa de uva caimarona (Pouroumacecropiifolia) y caracterizadas parcialmente. Para PFO se encontró un pH óptimo de 7,0, temperatura óptima de 45 °C y KM de 0,42 mM con L-Dopa como sustrato. Para POD se halló un pH óptimode 6,0, temperatura óptima de 37 °C y valores de KM de 2,0mMpara guayacol y 0,72 mM para H2O2. El perfil electroforéticomostró ci...

  12. [Is UV-A a cause of malignant melanoma?].

    Moan, J

    1994-03-20

    The first action spectrum for cutaneous malignant melanoma was published recently (2). This spectrum was obtained using the fish Xiphophorus. If the same action spectrum applies to humans, the following statements are true: Sunbathing products (agents to protect against the sun) that absorb UV-B radiation provide almost no protection against cutaneous malignant melanoma. UV-A-solaria are more dangerous than expected so far. If people are determined to use artificial sources of radiation for tanning, they should choose UV-B-solaria rather than UV-A-solaria. Fluorescent tubes and halogen lamps may have weak melanomagnetic effects. Ozone depletion has almost no effect on the incidence rates of CMM, since ozone absorbs very little UV-A radiation. Sunbathing products which contain UV-A-absorbing compounds or neutral filters (like titanium oxide) provide real protection against cutaneous malignant melanoma, at least if they are photochemically inert. PMID:8191472

  13. Is UV-A radiation a cause of malignant melanoma?

    The first action spectrum for cutaneous malignant melanoma was published recently. This spectrum was obtained using the fish Xiphophorus. If the same action spectrum applies to humans, the following statements are true: Sunbathing products (agents to protect against the sun) that absorb UV-B radiation provide almost no protection against cutaneous malignant melanoma. UV-A-solaria are more dangerous than expected so far. If people are determined to use artificial sources of radiation for tanning, they should choose UV-B solaria rather than UV-A-solaria. Fluorescent tubes and halogen lamps may have weak melanomagenic effects. Ozone depletion has almost no effect on the incidence rates of CMM, since ozone absorbs very little UV-A radiation. Sunbathing products which contain UV-A-absorbing compounds or neutral filter (like titanium oxide) provide real protection against cutaneous malignant melanoma, at least if they are photochemically inert. 34 refs., 2 figs

  14. Molecular responses of plants to solar UV-B and UV-A radiation

    Morales Suárez, Luis Orlando

    2014-01-01

    Plant responses to solar ultraviolet radiation (UV, 280-400 nm) were assessed at different molecular levels using Betula pendula Roth (silver birch) and Arabidopsis thaliana (Arabidopsis) as model species in outdoor experiments to assess the possibly interacting roles of the UV-B and UV-A wavebands in acclimation to sunlight. Solar UV-B (280-315 nm) and UV-A (315-400 nm) irradiance was attenuated with plastic films. Both solar UV-B and UV-A promoted the acclimation of silver birch and Arabido...

  15. Erythemal and therapeutic response of psoriasis to PUVA using high-dose UVA

    In PUVA treatment of psoriasis, clinical observation suggests that uninvolved skin is more susceptible to PUVA erythema than lesions of psoriasis. If this is the case, then the efficacy of PUVA treatment might be increased by using localized high-dose UVA restricted to lesional skin. We have therefore studied the erythemal and therapeutic response of psoriasis to PUVA using high-dose UVA and, for comparison, the erythemal response to UVB. This study demonstrates that psoriasis may clear rapidly, without burning, using high-dose UVA. Availability of a suitable irradiation apparatus would allow rapid and effective PUVA treatment to be used for localized, resistant disease. (author)

  16. Long-wave UVA offers partial protection against UVB-induced

    Skov, L.; Villadsen, L.; Ersbøll, Bjarne Kjær;

    2000-01-01

    Ultraviolet-B (UVB, 280–320 nm) interferes with the generation of cell-mediated immunity to contact allergens applied epicutaneously on the irradiated site. To investigate whether pretreatment with UVA-1 (340–400 nm) protects against the UVB-induced immune suppression we sensitized human volunteers...... with diphenylcyclopropenone (DPCP) on normal buttock skin (n=12), on UVB-irradiated buttock skin (n=21), on buttock skin pretreated with UVA-1 (n=12), and on buttock skin pretreated with UVA-1 and thereafter irradiated with UVB (n=22). Sensitization on UVB-irradiated skin reduced the immunization rate...

  17. Evaluating Interaction of MAS Providing Context-Aware Services

    Sánchez-Pi, Nayat; Griol, David; Carbó, Javier; José M. Molina

    2011-01-01

    Much effort has been spent on suggesting and implementing new architectures of MAS to specific domains. Often each new architecture is not even compared to any existing architectures in order to evaluate their potential benefits. The evaluation of Multi-Agent Systems (MAS) is a complex problem and it does not have a single form. The present work follows the research line of considering the agent interaction as the main evaluation criteria, the most important characteristic of any complex soft...

  18. Is UV-A radiation a cause of malignant melanoma. Er UV-A aarsak til malignt melanom

    Moan, J. (Det Norske Radiumhospital, Oslo (Norway))

    1994-03-01

    The first action spectrum for cutaneous malignant melanoma was published recently. This spectrum was obtained using the fish Xiphophorus. If the same action spectrum applies to humans, the following statements are true: Sunbathing products (agents to protect against the sun) that absorb UV-B radiation provide almost no protection against cutaneous malignant melanoma. UV-A-solaria are more dangerous than expected so far. If people are determined to use artificial sources of radiation for tanning, they should choose UV-B solaria rather than UV-A-solaria. Fluorescent tubes and halogen lamps may have weak melanomagenic effects. Ozone depletion has almost no effect on the incidence rates of CMM, since ozone absorbs very little UV-A radiation. Sunbathing products which contain UV-A-absorbing compounds or neutral filter (like titanium oxide) provide real protection against cutaneous malignant melanoma, at least if they are photochemically inert. 34 refs., 2 figs.

  19. EMPREGO DE EMBALAGENS PARA CONSERVAÇÃO PÓS-COLHEITA DE UVAS

    Josalba Vidigal de Castro

    1999-04-01

    Full Text Available RESUMO Neste trabalho avaliou-se o uso de filmes plásticos (polietileno de 0,05 e 0,08 mm de espessura, 'Everfreshbag' e sacolinhas sanfonadas, de caixas de madeira e de papelão ondulado na qualidade de uvas Itália, durante armazenamento refrigerado. Os cachos de uva foram avaliados semanalmente quanto a percentagem de perda de peso, a taxa de desgrana, a mudança de cor das bagas, a ocorrência de bagas deterioradas, ao aspecto do cacho e a qualidade do engaço. Considerando-se em conjunto os vários parâmetros de qualidade da uva avaliados, constatou-se que a embalagem sacolinha plástica demonstrou ser adequada para conservar uvas Itália por até seis semanas em refrigeração.

  20. Cellular Studies with UVA Radiation: A Role for Iron (invited paper)

    The UVA (320-380 nm) component of sunlight or sunbeds acts as an oxidising carcinogen and has been clearly implicated in skin cancer. Since UVA radiation interacts with cells by generating active oxygen species, the damaging effects of this radiation will be exacerbated by the presence of catalytically reactive iron in cells. It has now been shown by two independent techniques (dequenching of metal-quenched calcein fluorescence in cells and changes in the binding activity of the iron responsive protein IRPI) that UVA radiation causes an immediate release of 'free' iron in human skin fibroblasts via the proteolysis of ferritin (Ft). Within minutes of exposure to a range of doses of UVA at natural exposure levels, the binding activity of IRP-1, as well as Ft levels, decrease in a dose-dependent manner. It is proposed that the oxidative damage to lysosomes that leads to Ft degradation and the consequent release of potentially harmful 'free' iron to the cytosol might be a major factor in UVA-induced damage to the skin. UVA radiation also breaks down heme-containing proteins in the microsomal membrane to release free heme as an additional photosensitising component. This will provide another source of enhanced free iron in skin cells since constitutive heme oxygenase 2 (in keratinocytes) and UVA-inducible heme oxygenase-1 (in fibroblasts) are likely to break down any free heme to biliverdin and release iron and carbon monoxide in the process. It is postulated that, in skin fibroblasts, this free heme release and the enhanced free iron pools will lead to an adaptive response involving heme oxygenase (with a maximum about 10 h) and ferritin (in 24-48 h) that will scavenge the heme and iron released by subsequent oxidising (UVA) treatments. (author)

  1. UVA-induced damage to DNA and proteins: direct versus indirect photochemical processes

    Girard, P. M.; Francesconi, S.; Pozzebon, M.; Graindorge, D.; Rochette, P.; Drouin, R.; Sage, E.

    2011-01-01

    UVA has long been known for generating an oxidative stress in cells. In this paper we review the different types of DNA damage induced by UVA, i.e. strand breaks, bipyrimidine photoproducts, and oxidatively damaged bases. Emphasis is given to the mechanism of formation that is further illustrated by the presentation of new in vitro data. Examples of oxidation of proteins involved in DNA metabolism are also given.

  2. UVA-induced damage to DNA and proteins: direct versus indirect photochemical processes

    UVA has long been known for generating an oxidative stress in cells. In this paper we review the different types of DNA damage induced by UVA, i.e. strand breaks, bipyrimidine photoproducts, and oxidatively damaged bases. Emphasis is given to the mechanism of formation that is further illustrated by the presentation of new in vitro data. Examples of oxidation of proteins involved in DNA metabolism are also given.

  3. DNA damage in human skin fibroblasts exposed to UVA light used in clinical PUVA treatment

    Human skin fibroblasts were irradiated with a clinically used UVA light source. The doses (1.1 and 3 J/cm2) were similar to those reaching the dermis during clinical PUVA treatment of psoriasis. DNA strand breaks, as determined by alkaline elution, were formed in a dose-dependent way and disappeared within 1 hr of postincubation at 37 degrees C. These findings have clinical implications since UVA-induced DNA damage may be accompanied by mutagenic and tumor promoting effects

  4. Morphology, anatomy and histology of Doto uva Marcus, 1955 (Opisthobranchia: Nudibranchia) from the Chilean Coast.

    Fischer, M. A.; Van der velde, G.; Roubos, E W

    2006-01-01

    Doto uva Marcus, 1955 is a nudibranch species recorded from the Brazilian and Chilean coast. In spite of its wide distribution, D. uva has been described only superficially, mainly as to the pattern of its coloration, external morphology, radular teeth and reproductive system. Here we substantially extend this description, paying special attention to the morphology, anatomy and histology of the digestive and reproductive system. Furthermore, new data on the morphology of the central nervous s...

  5. Modulation of cathepsin G expression in severe atopic dermatitis following medium-dose UVA1 phototherapy

    Altmeyer Peter

    2002-08-01

    Full Text Available Abstract Background During the last decade, medium-dose UVA1 phototherapy (50 J/cm2 has achieved great value within the treatment of severe atopic dermatitis (AD. The purpose of our study was to investigate to what extent UVA1 irradiation is able to modulate the status of protease activity by the use of a monoclonal antibody labeling cathepsin G. Methods In order to further elucidate the mechanisms by which medium-dose UVA1 irradiation leads to an improvement of skin status in patients with AD, biopsy specimens from 15 patients before and after treatment were analyzed immunohistochemically for proteolytic activation. Results Compared to lesional skin of patients with AD before UVA1 irradiation, the number of cells positive for cathepsin G within the dermal infiltrate decreased significantly after treatment. The decrease of cathepsin G+ cells was closely linked to a substantial clinical improvement in skin condition. Conclusions In summary, our findings demonstrated that medium-dose UVA1 irradiation leads to a modulation of the expression of cathepsin G in the dermal inflammatory infiltrate in patients with severe AD. Cathepsin G may attack laminin, proteoglycans, collagen I and insoluble fibronectin, to provoke proinflammatory events, to degrade the basement membrane, to destroy the tissue inhibitor of metalloproteinases and to increase the endothelial permeability. Therefore, its down-regulation by UVA1 phototherapy may induce the reduction of skin inflammation as well as improvement of the skin condition.

  6. Lipid nanoparticles based on butyl-methoxydibenzoylmethane: in vitro UVA blocking effect

    Niculae, G.; Lacatusu, I.; Badea, N.; Meghea, A.

    2012-08-01

    The aim of the present study was to obtain efficient lipid nanoparticles loaded with butyl-methoxydibenzoylmethane (BMDBM) in order to develop cosmetic formulations with enhanced UVA blocking effect. For this purpose, two adequate liquid lipids (medium chain triglycerides and squalene) have been used in combination with two solid lipids (cetyl palmitate and glyceryl stearate) in order to create appropriate nanostructured carriers with a disordered lipid network able to accommodate up to 1.5% BMDBM. The lipid nanoparticles (LNs) were characterized in terms of particle size, zeta potential, entrapment efficiency, loading capacity and in vitro UVA blocking effect. The efficiency of lipid nanoparticles in developing some cosmetic formulations has been evaluated by determining the in vitro erythemal UVA protection factor. In order to quantify the photoprotective effect, some selected cream formulations based on BMDBM-LNs and a conventional emulsion were exposed to photochemical UV irradiation at a low energy to simulate the solar energy during the midday. The results obtained demonstrated the high ability of cream formulations based on BMDBM-LNs to absorb more than 96% of UVA radiation. Moreover, the developed cosmetic formulations manifest an enhanced UVA blocking effect, the erythemal UVA protection factor being four times higher than those specific to conventional emulsions.

  7. Epidermal changes in human skin following irradiation with either UVB or UVA

    We have demonstrated previously that following UVB irradiation to normal volunteers there is an increase in epidermal and stratum corneum thickness and an increase in the thymidine autoradiographic labeling index. These changes are coupled with alterations in epidermal glucose-6-phosphate dehydrogenase and succinic dehydrogenase activities, despite the absence of erythema clinically. The use of a sunscreen did not completely prevent these changes. In this study, we have examined the effects of repeated irradiation of human skin with either UVB or UVA alone in order to compare the changes produced in the epidermis and to ascertain whether UVA irradiation could cause these. Irradiation with either UVB or UVA alone was found to increase the mean epidermal thickness, the mean stratum corneum thickness, and mean keratinocyte height significantly. Glucose-6-phosphate dehydrogenase activity was significantly increased throughout the epidermis, and succinic dehydrogenase activity was significantly decreased. The autoradiographic labeling index was significantly increased following UVB irradiation but not following UVA irradiation. These results demonstrate that UVA alone can have a direct effect on epidermal morphology and metabolism, suggesting that protection of skin from UV radiation should include adequate protection from UVA

  8. Lipid nanoparticles based on butyl-methoxydibenzoylmethane: in vitro UVA blocking effect

    The aim of the present study was to obtain efficient lipid nanoparticles loaded with butyl-methoxydibenzoylmethane (BMDBM) in order to develop cosmetic formulations with enhanced UVA blocking effect. For this purpose, two adequate liquid lipids (medium chain triglycerides and squalene) have been used in combination with two solid lipids (cetyl palmitate and glyceryl stearate) in order to create appropriate nanostructured carriers with a disordered lipid network able to accommodate up to 1.5% BMDBM. The lipid nanoparticles (LNs) were characterized in terms of particle size, zeta potential, entrapment efficiency, loading capacity and in vitro UVA blocking effect. The efficiency of lipid nanoparticles in developing some cosmetic formulations has been evaluated by determining the in vitro erythemal UVA protection factor. In order to quantify the photoprotective effect, some selected cream formulations based on BMDBM-LNs and a conventional emulsion were exposed to photochemical UV irradiation at a low energy to simulate the solar energy during the midday. The results obtained demonstrated the high ability of cream formulations based on BMDBM-LNs to absorb more than 96% of UVA radiation. Moreover, the developed cosmetic formulations manifest an enhanced UVA blocking effect, the erythemal UVA protection factor being four times higher than those specific to conventional emulsions. (paper)

  9. Effects of Narrowband UVB, UVA1 and PUVA Treatments on Dermoscopic Features of Melanocytic Nevi

    Fulya Karaca

    2014-03-01

    Full Text Available Background and Design: Ultraviolet (UV radiation can effect dermoscopic features of melanocytic nevi by inducing melanin synthesis or melanocyte proliferation. Although UV radiation has widespread usage in the treatment of several skin diseases, only few studies of its effect on dermoscopic features of melanocytic nevi have been performed to date. The present study was designed to determine the effects of narrowband UVB, UVA1 and psoralen and UVA (PUVA treatments on dermoscopic features of melanocytic nevi. Material and Method: A total 55 patients who referred to our phototherapy unit for the treatment of miscellaneous skin disorders were enrolled in this prospective study. 21 patients underwent narrowband UVB, 18 patients underwent UVA1 and 16 patients underwent PUVA treatment. Dermoscopic images of 233 nevi in narrowband UVB group, 233 nevi in UVA1 group and 229 nevi in PUVA group were evaluated for the alterations in dermoscopic structures at the end of three months. Total dermoscopic scores (TDS of melanocytic nevi were calculated according to ABCD rule. Results: The size of melanocytic nevi in all therapy groups did not show any statistically significant increase. Narrowband UVB, UVA1, PUVA cause statistically significant changes in dermoscopic structures of melanocytic nevi. In narrowband UVB therapy group de novo dot formation was documented (p=0,002. The mean TDS of nevi did not show any significant change. Conclusion: Narrowband UVB, UVA1 and PUVA therapies have significant effects on dermoscopic features of melanocytic nevi. Only in narrowband UVB group de novo dot formation was observed.

  10. UV-A induces two calcium waves in Physcomitrella patens

    Our understanding of the role of Ca(2+) in blue/UV-A photoreceptor signaling in a single cell is limited. Insight into calcium signaling has now been attained in Physcomitrella patens and its cryptochrome and phototropin knock-outs. Physcomitrella patens caulonemal filaments grow in the dark by apical extension and their apical cells are highly polarized. Fura-2-dextran ratio images of the apical cell from wild type (WT), Ppcry1a/1b and PpphotA2/B1/B2 were obtained immediately following UV-A exposure (30 mu W cm(-2) at 340 nm for 1,000 ms plus 30 mu W cm(-2) at 380 nm for 1,000 ms) [abbreviated as 1,000 ms (340/ 380 nm)] and demonstrated two intracellular waves: a Ca(2+) wave from the growing apical tip through the apical cap, and a wave from the junction of the neighboring cell through the vacuolar, nuclear and plastid regions. In WT, the UV-A-induced tip wave increase had a magnitude of 454.0 +- 40 nM, traveled at a rate of 3.4 +- 0.7 mu m s(-1) and was complete within 26.6 +- 2.3 s, while the basal vacuolar wave had a magnitude of 596.8 +- 110 nM, a rate of 8.4 +- 0.8 mu m s(-1) and duration of 25.3 +- 4.9 s. Subsequent Ca(2+) spikes of similar magnitude followed these waves. The amplitude of the Ca(2+) waves in the apical cap and basal vacuolar regions of Ppcry1a/1b were higher than those in the WT, while the duration of those in PpphotA2/B1/B2 was longer. Subsequent Ca(2+) spikes occurred in WT and Ppcry1a/1b but not in PpphotA2/B1/B2. When Mn(2+) was added to the culture medium, the [Ca(2+)]cyt increase was delayed, did not move as a wave and lasted longer. The results indicate that plants respond to blue light and UV-A radiation by generating a wave of changes in the [Ca(2+)]cyt. The characteristics of these Ca(2+) waves were dependent upon cryptochrome and phototropin. Blue/UV-A signaling in P patens appears to differ from that in Arabidopsis

  11. An MAS-Based ETL Approach for Complex Data

    Boussaïd, Omar; Darmont, Jérôme

    2008-01-01

    In a data warehousing process, the phase of data integration is crucial. Many methods for data integration have been published in the literature. However, with the development of the Internet, the availability of various types of data (images, texts, sounds, videos, databases...) has increased, and structuring such data is a difficult task. We name these data, which may be structured or unstructured, "complex data". In this paper, we propose a new approach for complex data integration, based on a Multi-Agent System (MAS), in association to a data warehousing approach. Our objective is to take advantage of the MAS to perform the integration phase for complex data. We indeed consider the different tasks of the data integration process as services offered by agents. To validate this approach, we have actually developed an MAS for complex data integration.

  12. Membrane lipid peroxidation by UV-A: Mechanism and implications

    UV-A produced a dose-dependent linear increase of lipid peroxidation in liposomal membrane, as detected by the assay of (i) conjugated dienes, (ii) lipid hydroperoxides, (iii) malondialdehydes (MDA), and (iv) the fluorescent adducts formed by the reaction of MDA with glycine and also a linear dose-dependent increase of [14C]glucose efflux from the liposomes. UV-A-induced MDA production could not be inhibited by any significant degree by sodium formate, dimethyl sulfoxide, EDTA, or superoxide dismutase but was very significantly inhibited by butylated hydroxytoluene, alpha-tocopherol, sodium azide, L-histidine, dimethylfuran, and beta-carotene. MDA formation increased with an increase in the D2O content in water, leading to a maximal amount of nearly 50% enhancement of lipid peroxidation in 100% D2O vis-a-vis water used as dispersion medium. The experimental findings indicate the involvement of singlet oxygen as the initiator of the UV-A-induced lipid peroxidation

  13. Membrane lipid peroxidation by UV-A: Mechanism and implications

    Bose, B.; Agarwal, S.; Chatterjee, S.N. (Saha Institute of Nuclear Physics, Calcutta (India))

    1990-10-01

    UV-A produced a dose-dependent linear increase of lipid peroxidation in liposomal membrane, as detected by the assay of (i) conjugated dienes, (ii) lipid hydroperoxides, (iii) malondialdehydes (MDA), and (iv) the fluorescent adducts formed by the reaction of MDA with glycine and also a linear dose-dependent increase of ({sup 14}C)glucose efflux from the liposomes. UV-A-induced MDA production could not be inhibited by any significant degree by sodium formate, dimethyl sulfoxide, EDTA, or superoxide dismutase but was very significantly inhibited by butylated hydroxytoluene, alpha-tocopherol, sodium azide, L-histidine, dimethylfuran, and beta-carotene. MDA formation increased with an increase in the D{sub 2}O content in water, leading to a maximal amount of nearly 50% enhancement of lipid peroxidation in 100% D{sub 2}O vis-a-vis water used as dispersion medium. The experimental findings indicate the involvement of singlet oxygen as the initiator of the UV-A-induced lipid peroxidation.

  14. POLIFENOLOXIDASA Y PEROXIDASA DE PULPA DE UVA CAIMARONA (Pourouma cecropiifolia

    Ángela Patricia Rivera Camelo

    2008-02-01

    Full Text Available Las enzimas polifenoloxidasa (PFO y peroxidasa (POD fueron extraídas de la pulpa de uva caimarona (Pouroumacecropiifolia y caracterizadas parcialmente. Para PFO se encontró un pH óptimo de 7,0, temperatura óptima de 45 °C y KM de 0,42 mM con L-Dopa como sustrato. Para POD se halló un pH óptimode 6,0, temperatura óptima de 37 °C y valores de KM de 2,0mMpara guayacol y 0,72 mM para H2O2. El perfil electroforéticomostró cinco iso-PFO y tres iso- POD. POD fue más termorresistente que PFO. De cuatro inhibidores estudiados el ácido ascórbico fue el inhibidor más potente, seguido por el bisulfito de sodio, mientras que el ácido cítrico y el cloruro de sodio fueron los menos potentes.

  15. 31P Solid-state MAS NMR spectra

    The structures of the silicoaluminiophosphates MCM-1 and MCM9 were characterized by 27Al and 31P MAS NMR. The structural identity of MCM-1 and its silicon-free homologue AlPO4-H3 is demonstrated. The presence of a structural mixture in MCM-9 is confirmed. 31P MAS NMR spectra of MCM-9 could be interpreted as a superposition of spectra of VPI-5, AlPO4-H3 and SAPO-11 phases. (author). 12 refs.; 3 figs.; 1 tab

  16. Structural biology applications of solid state MAS DNP NMR

    Akbey, Ümit; Oschkinat, Hartmut

    2016-08-01

    Dynamic Nuclear Polarization (DNP) has long been an aim for increasing sensitivity of nuclear magnetic resonance (NMR) spectroscopy, delivering spectra in shorter experiment times or of smaller sample amounts. In recent years, it has been applied in magic angle spinning (MAS) solid-state NMR to a large range of samples, including biological macromolecules and functional materials. New research directions in structural biology can be envisaged by DNP, facilitating investigations on very large complexes or very heterogeneous samples. Here we present a summary of state of the art DNP MAS NMR spectroscopy and its applications to structural biology, discussing the technical challenges and factors affecting DNP performance.

  17. Lifestyle, sun worshipping and sun tanning - what about UV-A sun beds. Livsstil, soling og bruning - hva med UV-A solarier

    Thune, P. (Ullevaal Sykehus, Oslo (Norway))

    1991-06-01

    This article considers the effects of ultraviolet (UV) light from the sun and UV-A sun beds on the skin. Sun worshipping and sun therapy has been en vogue for centuries, but in another way than used today. A changing lifestyle has led to an increase of various skin diseases, including skin cancer. Short wave UV-light (UV-B) in particular has been blamed for inducing not only erythema and pigmentation but also more chronic skin lesions. Long wave UV-light (UV-A) has been shown to be the cause of similar changes to the skin but the pigmentation is of another quality and affords less protection against the harmful effects of UV-B. A concept of sun reactive skin typing has been created. This is based on self-reported responses to an initial exposure to sun as regards tanning ability and erythema reaction. These two factors have certain practical consequences, not only for UV-phototherapy but also for a person's risk of developing skin cancer. Recently, several research groups and dermatologists have discouraged extensive use of UV-A sun beds because of side effects of varying degrees of seriousness. The possible implications of these side effects for the organism are not fully elucidated and may be more profound than known today. The British Photodermatology Group has issued more stringent rules for persons who, despite advice to the contrary, still wish to use UV-A sun beds. 14 refs., 1 tab.

  18. Expression of intercellular adhesion molecule-1 in UVA-irradiated human skin cells in vitro and in vivo

    Ultraviolet A (UVA) radiation represents an important oxidative stress to human skin and certain forms of oxidative stress have been shown to modulate intercellular adhesion molecule-1 (ICAM-1) expression. ICAM-1 has been shown to play an important part in many immune reactions and the perturbations of this molecule by ultraviolet radiation could have implications in many inflammatory responses. An enhancement immunohistochemical method with avidin/biotin was used for analysing the early effects of UVA radiation on human cell cultures and human skin (340-400 nm). Both in vitro and in vivo data show that ICAM-1 staining in epidermal keratinocytes, which was expressed constitutively, decreased in a UVA dose-dependent manner. The decrease was most noted at 3-6 h following UVA radiation with some ICAM-1 staining returning by 48 h post-UVA. ICAM-1 positive staining in the dermis was specific for vascular structures and was increased 24 h after UVA radiation. Cultured dermal fibroblasts exhibited ICAM-1 staining which increased slightly within 6-48 h post-UVA radiation. As epidermal ICAM-1 expression is depleted following UVA radiation and dermal expression increases due to an increase in the vascular structures, ICAM-1 provides a valuable marker following UVA radiation in human skin that can be readily measured in situ. (author)

  19. Carcinogenic effect of sequential artificial sunlight and UV-A irradiation in hairless mice. Consequences for solarium 'therapy'

    The carcinogenic effect of artificial UV sunlight followed by UV-A irradiation in human solaria doses has been studied with the use of the hairless mouse as an animal model. Artificial sunlight exposure alone induced only a moderate skin tumor incidence (animals with at least one tumor) of 0.15 after one year, and UV-A irradiation alone induced no tumor formation. However, the combination of artificial sunlight exposure and subsequent UV-A irradiation significantly increased the tumor incidence to 0.72. We conclude that, in humans, tanning with UV-A for cosmetic purposes may not be an innocuous procedure

  20. Carcinogenic effect of sequential artificial sunlight and UV-A irradiation in hairless mice. Consequences for solarium 'therapy'.

    Staberg, B; Wulf, H C; Poulsen, T; Klemp, P; Brodthagen, H

    1983-08-01

    The carcinogenic effect of artificial UV sunlight followed by UV-A irradiation in human solaria doses has been studied with the use of the hairless mouse as an animal model. Artificial sunlight exposure alone induced only a moderate skin tumor incidence (animals with at least one tumor) of 0.15 after one year, and UV-A irradiation alone induced no tumor formation. However, the combination of artificial sunlight exposure and subsequent UV-A irradiation significantly increased the tumor incidence to 0.72. We conclude that, in humans, tanning with UV-A for cosmetic purposes may not be an innocuous procedure. PMID:6870317

  1. Project MAS 1984-1985. OEA Evaluation Report.

    New York City Board of Education, Brooklyn. Office of Educational Assessment.

    This multi-site instructional program (Project MAS) provides instruction in English as a second language and native language arts, as well as bilingual instruction in mathematics and science to approximately 400 Spanish-speaking schools. It serves third through eighth graders at four sites in the Bronx. Its instructional and non-instructional…

  2. Transglutaminase involvement in UV-A damage to the eye lens

    Solar radiation is believed to be one of the major environmental factors involved in lens cataractogenesis. The purpose of the study was to investigate the mechanisms by which UV-A at 365 nm causes damage to the eye lens. Bovine lenses were placed in special culture cells for pre-incubation of 24 hr. The lenses were positioned so that the anterior surface faced the incident UV-A radiation source and were maintained in the cells during irradiation. After irradiation, lens optical quality was monitored throughout the culture period and lens epithelium, cortex and nuclear samples were taken for biochemical analysis. Transglutaminase activity in the lens was affected by the radiation. The activity of transglutaminase in lens epithelium cortex and nucleus increased as a result of the irradiation and then declined towards control levels during the culture period, as the lens recovered from the UV-A damage. Specific lens proteins αB and βB1 crystallins (the enzyme substrates) were analyzed by SDS polyacrylamid gel electrophoreses and immunoblotting with specific antibodies. Seventy-two hours after irradiation of 44.8 J cm-2 UV-A, αB crystallins were affected as was shown by the appearance of aggregation and degradation products. Some protein changes seem to be reversible. It appears that transglutaminase may be involved in the mechanism by which UV-A causes damage to the eye lens. (Author)

  3. Growth of antarctic cyanobacteria under ultraviolet radiation: UVA counteracts UVB inhibition

    Quesada, A. [Universite Laval, Quebec (Canada)]|[Universidad Autonoma de Madrid (Spain); Mouget, J.L.; Vincent, W.F. [Universite Laval, Quebec (Canada)

    1995-04-01

    A mat-forming cyanobacterium (Phormidium murayi West and West) isolated from an ice-shelf pond in Antarctica was grown under white light combined with a range of UVA and UVB irradiance. The 4-day growth rate decreased under increasing ultraviolet (UV) radiation, with a ninefold greater response to UVB relative to UVA. In vivo absorbance spectra showed that UVA and to a greater extent UVB caused a decrease in phycocyanin/chlorophyll a and an increase in carotenoids/chlorophyll a. The phycocyanin/chlorophyll a ratio was closely and positively correlated to the UVB-inhibited growth rate. Under fixed spectral gradients of UV radiation, the growth inhibition effect was dominated by UVB. However, at specific UVB irradiances the inhibition of growth depended on the ratio of UVB to UVA, and growth rates increased linearly with increasing UVA. These results are consistent with the view that UVB inhibition represents the balance between damage and repair processes that are each controlled by separate wavebands. They also underscore the need to consider UV spectral balance in laboratory and field assays of UVB toxicity. 49 refs., 6 figs.

  4. UVA photoactivation of DNA containing halogenated thiopyrimidines induces cytotoxic DNA lesions.

    Brem, Reto; Zhang, Xiaohui; Xu, Yao-Zhong; Karran, Peter

    2015-04-01

    Photochemotherapy, the combination of a photosensitiser and ultraviolet (UV) or visible light, is an effective treatment for skin conditions including cancer. The high mutagenicity and non-selectivity of photochemotherapy regimes warrants the development of alternative approaches. We demonstrate that the thiopyrimidine nucleosides 5-bromo-4-thiodeoxyuridine (SBrdU) and 5-iodo-4-thiodeoxyuridine (SIdU) are incorporated into the DNA of cultured human and mouse cells where they synergistically sensitise killing by low doses of UVA radiation. The DNA halothiopyrimidine/UVA combinations induce DNA interstrand crosslinks, DNA-protein crosslinks, DNA strand breaks, nucleobase damage and lesions that resemble UV-induced pyrimidine(6-4)pyrimidone photoproducts. These are potentially lethal DNA lesions and cells defective in their repair are hypersensitive to killing by SBrdU/UVA and SIdU/UVA. DNA SIdU and SBrdU generate lethal DNA photodamage by partially distinct mechanisms that reflect the different photolabilities of their C-I and C-Br bonds. Although singlet oxygen is involved in photolesion formation, DNA SBrdU and SIdU photoactivation does not detectably increase DNA 8-oxoguanine levels. The absence of significant collateral damage to normal guanine suggests that UVA activation of DNA SIdU or SBrdU might offer a strategy to target hyperproliferative skin conditions that avoids the extensive formation of a known mutagenic DNA lesion. PMID:25747491

  5. Singlet Oxygen-Mediated Oxidation during UVA Radiation Alters the Dynamic of Genomic DNA Replication.

    Dany Graindorge

    Full Text Available UVA radiation (320-400 nm is a major environmental agent that can exert its deleterious action on living organisms through absorption of the UVA photons by endogenous or exogenous photosensitizers. This leads to the production of reactive oxygen species (ROS, such as singlet oxygen (1O2 and hydrogen peroxide (H2O2, which in turn can modify reversibly or irreversibly biomolecules, such as lipids, proteins and nucleic acids. We have previously reported that UVA-induced ROS strongly inhibit DNA replication in a dose-dependent manner, but independently of the cell cycle checkpoints activation. Here, we report that the production of 1O2 by UVA radiation leads to a transient inhibition of replication fork velocity, a transient decrease in the dNTP pool, a quickly reversible GSH-dependent oxidation of the RRM1 subunit of ribonucleotide reductase and sustained inhibition of origin firing. The time of recovery post irradiation for each of these events can last from few minutes (reduction of oxidized RRM1 to several hours (replication fork velocity and origin firing. The quenching of 1O2 by sodium azide prevents the delay of DNA replication, the decrease in the dNTP pool and the oxidation of RRM1, while inhibition of Chk1 does not prevent the inhibition of origin firing. Although the molecular mechanism remains elusive, our data demonstrate that the dynamic of replication is altered by UVA photosensitization of vitamins via the production of singlet oxygen.

  6. Growth of antarctic cyanobacteria under ultraviolet radiation: UVA counteracts UVB inhibition

    A mat-forming cyanobacterium (Phormidium murayi West and West) isolated from an ice-shelf pond in Antarctica was grown under white light combined with a range of UVA and UVB irradiance. The 4-day growth rate decreased under increasing ultraviolet (UV) radiation, with a ninefold greater response to UVB relative to UVA. In vivo absorbance spectra showed that UVA and to a greater extent UVB caused a decrease in phycocyanin/chlorophyll a and an increase in carotenoids/chlorophyll a. The phycocyanin/chlorophyll a ratio was closely and positively correlated to the UVB-inhibited growth rate. Under fixed spectral gradients of UV radiation, the growth inhibition effect was dominated by UVB. However, at specific UVB irradiances the inhibition of growth depended on the ratio of UVB to UVA, and growth rates increased linearly with increasing UVA. These results are consistent with the view that UVB inhibition represents the balance between damage and repair processes that are each controlled by separate wavebands. They also underscore the need to consider UV spectral balance in laboratory and field assays of UVB toxicity. 49 refs., 6 figs

  7. UVA and UVB in sunlight, Optimal Utilization of UV rays in Sunlight for phototherapy

    Balasaraswathy P

    2002-01-01

    Full Text Available The disadvantages of sunlight as the source of UVA for phototherapy include variation with time, place, season, and atmospheric conditions. In the present study at Coimbatore, India we measured the UVa and UVB irradiance for one year using PMA 2100 meter. UVB irradiance was mazimum between 12.00 noon- 1.00 p.m (19.50µw/cm2 to 40.2µw/cm2 and UVA between 12 noon-1.15 p.m. (4.70mw/cm2 tp 6.59mw/cm2. The ratio of UVA was 1:500 to 1:600 during early hours and late evening and 1:200 during mid-day. At peak time (11.30 a.m. to 1.30 p.m., the exposure time for 1 June of UVA was 2 min. 32 sec. to 4 min. 31 sec and for 10mj of UVB it was from 4 min. 55 sec. to 11 min. 22 sec. We recommend the ideal time for UVB phototheraphy between 11.00 a.m. to 2.00 p.m. and for PUVASOL between 9.30 a.m. to 11 a.m. and 2 p.m. to 3.30 p.m. when incidental UVB and infrared rays responsible for heat are less.

  8. Animal and human responses to UVA and UVB

    Ultraviolet radiation (UVR) comprises the most energetic region of the optical radiation spectrum and is able to induce photochemical changes in the superficial tissues of animals and people which can lead to various acute or chronic adverse health effects. The evidence concerning experimental studies of animals and, where available, volunteers of the effects of occupationally relevant wavelengths (principally UVB, 280-315 rim, and UVA, 315-400 nm) has been reviewed. Experimental studies on animals indicate that exposure to UVR elicits transient (acute) and long-lasting (chronic) effects in the skin and the eye, the severity of which increases in proportion to the exposure. Transient responses have also been investigated in human volunteers and these include adaptive changes such as immediate pigment darkening, melanogenesis and epidermal hyperplasia, and inflammatory responses such as erythema in the skin and keratitis and conjunctivitis in the eye. Irreversible, long-lasting changes also occur following exposure; these include photoageing of the skin, and the development of cataracts in the lens of the eye. Animal studies show that UVR can act either as a complete carcinogen, capable of inducing tumours when applied by itself, or as a co-carcinogen acting in combination with tumour initiators and promoters. The interaction of UVR with the immune system is complex. Exposure to UVR affects the immune system, depressing certain types of cell-mediated antigen-specific responses. Variable immunosuppressive effects have also been reported in humans. In addition, exogenous chemical sensitisers can initiate phototoxic or photoallergic responses in humans and animals; these can precede the development of more persistent idiopathic photodermatoses in which the sensitiser may be an endogenous chemical or antigen. Recommendations for further research are made. (author)

  9. Chronic UVA (365-nm) irradiation induced scratching in hairless mice: dose-time dependency and the effect of ketanserin

    In a study on the dose-response relationship for longwave UVA (UVA1; 340-400 nm) carcinogenesis in hairless mice scratch marks appeared after months of daily exposure as an unwanted side effect. Tumor induction in the highest of the 4 tested dose groups (receiving a daily dose of 430 kJ/m2 of 365-nm radiation) could not be determined because extensive scarification occurred prior to the development of any tumors. The induction of scratch marks could be scored and quantified in all 4 dose groups tested. The UVA1 dose-dependencies for the induction of tumors and scratch marks were compared. We found that the induction of scratch marks depended mainly on the cumulative UVA1 exposure, whereas tumor induction showed a lesser dose-dependency. An attempt was made to prevent the apparent pruritogenic effect of UVA1 irradiation and to understand its mechanism. The influence of ketanserin, a serotonin/histamine antagonist, on the UVA1 induction of scratch marks was tested in groups of 8 mice daily irradiated with 430 kJ/m2. No difference was found between treated and untreated animals. Histological examination of skin biopsies from irradiated mice from the 430-kJ/m2 dose group from the UVA1 carcinogenic experiment, showed no changes in numbers of mast cells or other inflammatory features when compared to skin biopsies from unirradiated control mice. This indicated that UVA1-induced scratching is not mediated through mast cell release of serotonin and/or histamine. An adequate therapeutic treatment which can prevent UVA1-induced scratching would enable us to test tumor induction with UVA1 over a larger dose range, and may provide additional insight in how this radiation damages the skin. It remains conjectural whether there exists and analogous UVA-induced pruritus in human skin. (au)

  10. Chronic UVA (365-nm) irradiation induced scratching in hairless mice: dose-time dependency and the effect of ketanserin

    Laat, J.M.T. de; Groenendijk, M.; Vloten, W.A. van; Gruijl, F.R. de [Univ. Hospital Utrecht, Dept. of Dermatology (Netherlands); Seite, S. [L`Oreal-Centre de Recherche Charles Zviak, Recherche Avancee Biologie (France)

    1997-12-31

    In a study on the dose-response relationship for longwave UVA (UVA1; 340-400 nm) carcinogenesis in hairless mice scratch marks appeared after months of daily exposure as an unwanted side effect. Tumor induction in the highest of the 4 tested dose groups (receiving a daily dose of 430 kJ/m{sup 2} of 365-nm radiation) could not be determined because extensive scarification occurred prior to the development of any tumors. The induction of scratch marks could be scored and quantified in all 4 dose groups tested. The UVA1 dose-dependencies for the induction of tumors and scratch marks were compared. We found that the induction of scratch marks depended mainly on the cumulative UVA1 exposure, whereas tumor induction showed a lesser dose-dependency. An attempt was made to prevent the apparent pruritogenic effect of UVA1 irradiation and to understand its mechanism. The influence of ketanserin, a serotonin/histamine antagonist, on the UVA1 induction of scratch marks was tested in groups of 8 mice daily irradiated with 430 kJ/m{sup 2}. No difference was found between treated and untreated animals. Histological examination of skin biopsies from irradiated mice from the 430-kJ/m{sup 2} dose group from the UVA1 carcinogenic experiment, showed no changes in numbers of mast cells or other inflammatory features when compared to skin biopsies from unirradiated control mice. This indicated that UVA1-induced scratching is not mediated through mast cell release of serotonin and/or histamine. An adequate therapeutic treatment which can prevent UVA1-induced scratching would enable us to test tumor induction with UVA1 over a larger dose range, and may provide additional insight in how this radiation damages the skin. It remains conjectural whether there exists and analogous UVA-induced pruritus in human skin. (au) 26 refs.

  11. 1H MAS, 13C CP/MAS, and 2H NMR spectra studies of piperidinium p-chlorobenzoate

    Anomalous H/D isotope effects were detected in the 1H MAS NMR spectra of piperidinium p-chlorobenzoate (C5H10NH 2+⋅ ClC6H4COO − ) upon deuterium substitution of hydrogen atoms which form two kinds of N-H⋯O H-bonds in the crystal; in contrast to these spectra, only slight chemical shifts were recorded in 13C CP/MAS NMR spectra. 2H NMR spectrum of the deuterated sample show quadrupole coupling constants of 148 and 108 kHz, and reveal that there are a few motions contributing to the electric-field modulation of the 2H nucleus. The 1H MAS NMR spectra of piperidinium p-chlrobenzoate-d16 (C5D10ND 2+⋅ ClC6D4COO − ) and -d14 (C5D10NH 2+⋅ ClC6D4COO − ) revealed that the change in the envelope is caused by chemical shifts of each signal upon deuteration. Calculations based on the density-functional-theory showed that the N-H distance along the crystallographic a-axis mainly contributes to the anomalous isotope effects on 1H MAS NMR envelopes.

  12. Cytotoxicity and mutagenicity of opthalmic solution preservatives and UVA radiation in L5178Y cells

    Four preservatives used in ophthalmic solutions were tested for toxic and mutagenic potential in mouse lymphoma cells with and without exposure of cells to ultraviolet A (UVA) radiation. The preservatives tested were benzalkonium chloride (BAK), chlorhexidine, thimerosal and ethylenediaminetetraacetic acid (EDTA). Cell survival and mutagenesis were measured using the L5178Y mouse lymphoma (TK+/-) system. Cells were exposed to varying amounts of preservatives for 1 h at 370C, and aliquots irradiated with UVA radiation (during exposure to preservative). Cells were then assayed for survival, and mutagenesis at the thymidine kinase (TK) locus. In concentrations commonly found in ophthalmic solutions, BAK, chlorhexidine, and thimerosal were toxic to cells, and thimerosal was slightly mutagenic. When cells were exposed to preservative and UVA radiation, chlorhexidine was mutagenic and the mutagenic activity of thimerosal was enhanced. (author)

  13. Cytotoxicity and mutagenicity of opthalmic solution preservatives and UVA radiation in L5178Y cells

    Withrow, T.J.; Brown, N.T.; Hitchins, V.M.; Strickland, A.G. (Food and Drug Administration, Rockville, MD (USA). Center for Devices and Radiological Health)

    1989-09-01

    Four preservatives used in ophthalmic solutions were tested for toxic and mutagenic potential in mouse lymphoma cells with and without exposure of cells to ultraviolet A (UVA) radiation. The preservatives tested were benzalkonium chloride (BAK), chlorhexidine, thimerosal and ethylenediaminetetraacetic acid (EDTA). Cell survival and mutagenesis were measured using the L5178Y mouse lymphoma (TK{sup +/-}) system. Cells were exposed to varying amounts of preservatives for 1 h at 37{sup 0}C, and aliquots irradiated with UVA radiation (during exposure to preservative). Cells were then assayed for survival, and mutagenesis at the thymidine kinase (TK) locus. In concentrations commonly found in ophthalmic solutions, BAK, chlorhexidine, and thimerosal were toxic to cells, and thimerosal was slightly mutagenic. When cells were exposed to preservative and UVA radiation, chlorhexidine was mutagenic and the mutagenic activity of thimerosal was enhanced. (author).

  14. Synergistic bactericidal effect by combined exposure to Ag nanoparticles and UVA

    Zhao, Xiaoxu; Toyooka, Tatsushi; Ibuki, Yuko, E-mail: ibuki@u-shizuoka-ken.ac.jp

    2013-08-01

    Broad and strong antimicrobial properties of silver (Ag) have been used for biomedical applications, water treatment, etc. In this study, a synergistic antibacterial effect between Ag nanoparticles (AgNPs) and ultraviolet (UV) light was examined. AgNPs (< 0.1 μm) with subsequent exposure to UVA (320–400 nm) showed pronounced toxicity in Escherichia coli, but micro-sized Ag particles (> 1 μm) with UVA and AgNPs with UVB (280–325 nm) did not. As significant bactericidal activity was also exhibited by hydrogen peroxide-treated AgNPs, the surface oxidation of AgNPs caused by UVA irradiation was considered to contribute to the enhanced antibacterial effect. Although no difference in NP-incorporation rates was observed with or without the surface oxidation of AgNPs, a particle size of less than 0.1 μm was a factor for AgNPs uptake and an essential requirement for the antimicrobial function of Ag particles. Incorporated AgNPs oxidized by UVA irradiation released larger amounts of Ag ion inside cells than reduced AgNPs, which reacted with intercellular molecules having –SH groups such as glutathione. The synergistic use of AgNPs and UVA could become a powerful tool with broad antimicrobial applications. Highlights: • Combined treatment with AgNPs and UV achieved a remarkable antibacterial effect in E. coli. • For the antibacterial effect, it is necessary to satisfy the following requirements: • 1) Translocation of nano-sized Ag particles inside E. coli. • 2) Oxidation of AgNPs by UVA, and extensive and persistent release of Ag{sup +} inside E. coli. • Ag{sup +} released inside cells reacted with intercellular molecules having –SH groups such as GSH.

  15. Effects of UV-A Radiation on Desmodesmus armatus: Changes in Growth Rate, Pigment Content and Morphological Appearance

    Pálffy, Károly; Vörös, Lajos

    2006-10-01

    Laboratory cultures of Desmodesmus armatus (R. Chod.) Hegew. were grown under different levels of photosynthetically active radiation (PAR) supplemented with 3.75 mW . cm-2 UV-A radiation. Growth rate was monitored daily, chlorophyl-a concentration, total carotenoid content, cell number and the relative abundance of different coenobial forms was determined at the end of each experiment. Exposure to UV-A radiation resulted in an increasing inhibition of growth towards higher PAR levels, reaching 100% at 400 μmol . m-2 . s-1. Cellular carotenoid content was higher in the presence of UV-A radiation, on the other hand no differences were observed in cellular chlorophyll-a concentration. UV-A radiation also induced changes in coenobium formation with a decreasing proportion of 4-celled coenobia and an increase in the abundance of 2-celled and teratologic coenobia, suggesting that high intensity UV-A radiation may influence cell cycle events or morphology development.

  16. Pilot Study for UVA-LED Disinfection of Escherichia coli in Water for Space and Earth Applications

    Ragolta, Carolina

    2010-01-01

    To test the efficacy of UVA-LED disinfection, a solution of Escherichia coli was pumped through a modified drip flow reactor at a flow rate of 1 ml/min. The experiment was conducted in a controlled environment chamber to ensure that temperature did not cause disinfection. The reactor featured three wells with different treatments: UVA-LED irradiation, UVA-LEDs with Ti02, and UVA-LEDs with nanosilver. Samples from each well were taken throughout a 340 hour period, inactivated, assayed, and analyzed for E. coli disinfection. Results of the duplicate experiments indicated longer exposure times are needed for UVA-LED disinfection of E. coli in water. Further research would consider a longer sampling period and different test conditions, such as increased contact area and various flow rates.

  17. UVA-induced immune suppression in human skin: protective effect of vitamin E in human epidermal cells in vitro

    UVA (320-400 nm) radiation damage to membranes, proteins, DNA and other cellular targets is predominantly related to oxidative processes. In the present study, we demonstrated that cutaneous UVA-induced immunosuppression can be related, at least in part, to the appearance of these oxidative processes. The UVA-induced oxidative processes in freshly isolated epidermal cells were monitored by measuring the thiobarbituric acid reactive substances (TBARS) as an index of peroxidation. The in vitro immunosuppressive effects of UVA were demonstrated by measuring the allogenic lymphocyte proliferation induced by epidermal cells or purified Langerhans cells in the mixed epidermal cell-lymphocyte reaction (MECLR). In addition, the effects of a potent antioxidant (vitamin E) on these two UVA-induced processes were analysed. (author)

  18. UVA-induced immune suppression in human skin: protective effect of vitamin E in human epidermal cells in vitro

    Clement-Lacroix, P.; Michel, L.; Moysan, A.; Morliere, P.; Dubertret, L. [Hopital Saint-Louis, 75 - Paris (France)

    1996-01-01

    UVA (320-400 nm) radiation damage to membranes, proteins, DNA and other cellular targets is predominantly related to oxidative processes. In the present study, we demonstrated that cutaneous UVA-induced immunosuppression can be related, at least in part, to the appearance of these oxidative processes. The UVA-induced oxidative processes in freshly isolated epidermal cells were monitored by measuring the thiobarbituric acid reactive substances (TBARS) as an index of peroxidation. The in vitro immunosuppressive effects of UVA were demonstrated by measuring the allogenic lymphocyte proliferation induced by epidermal cells or purified Langerhans cells in the mixed epidermal cell-lymphocyte reaction (MECLR). In addition, the effects of a potent antioxidant (vitamin E) on these two UVA-induced processes were analysed. (author).

  19. SUCO DE UVA EM PÓ FORTIFICADO COM FERRO

    A. A. GONÇALVES

    2009-01-01

    Full Text Available

    Atualmente a defi ciência de ferro é um dos problemas nutricionais mais prevalentes no mundo, acometendo grande número de crianças e mulheres. Não existem dados que estimem a real prevalência da deficiência de ferro no Brasil, porém, tendo-se a anemia como indicadora indireta, estima-se que, nos países não industrializados, a maioria das crianças em idade pré-escolar e as gestantes, apresentem deficiência de ferro, sendo mais elevada em crianças. Estudos no Brasil mostram que cerca de 40% das crianças possuem prevalência de anemia, já entre as gestantes, este valor varia de acordo com o período de gestação, oscilando entre 12 e 55%. Os resultados desse estudo são significativos e sugerem a necessidade para o desenvolvimento de um produto enriquecido com ferro que seja de fácil preparo e acessível às populações de risco, permitindo-lhes suprir de forma efi ciente, as necessidades diárias individuais de ferro. Desta forma, desenvolveu-se um suco de uva em pó enriquecido com ferro para atender possivelmente esse desafi o. As análises realizadas mostraram ser um produto com elevado valor de ferro (6mg/200ml de suco o que representa 60% das necessidades de uma criança em idade pré-escolar, conforme a IDR. Este produto foi bem aceito pelo público infantil, e pode representar uma alternativa à prevenção da anemia e deficiência de ferro. Post-doc research – Department of Civil & Resource Engineering – Dalhousie University – Halifax – NS – Canadá

  20. DynamicWorkflow in Grid-MAS Integration Context

    Salle, Paola; Duvert, Frédéric; Hérin, Danièle; Stefano A. CERRI

    2007-01-01

    This paper addresses the architectural foundations of dynamic workflows in distributed multi-agent systems (MAS) integrated in Grid context. The purpose is to design an architecture at the same time taking into consideration tasks dependencies among agents, adaptation with respect to historic lessons learnt from past behaviour (memory) and the autonomous decisions when an unpredicted event occurs. In order to do this, given one ontology, called AGIO, which describes Agent-Grid Integration, we...

  1. In vitro photosafety and efficacy screening of apigenin, chrysin and beta-carotene for UVA and VIS protection.

    Freitas, Juliana Vescovi; Gaspar, Lorena Rigo

    2016-06-30

    Currently most of sunscreens provide effective protection in the full UV range but lack VIS protection. The addition of effective antioxidants to sunscreens might afford suitable UV-VIS protection. Apigenin (API), chrysin (CRI) and beta-carotene (BTC) have shown potential for UV-VIS protection. This paper reports a photosafety and efficacy screening of such antioxidants through evaluation of the photostability, photoreactivity and phototoxicity as well as UVA/UVB ratio and critical wavelength. The assessment of the photostability, photoreactivity and phototoxicity of API, CRI and BTC, isolated and combined (CMB) was performed by HPLC, ROS assay and 3T3 NRU phototoxicity test, respectively. The phototoxicity test was also performed for CMB plus bemotrizinol (BMZ). The in vitro evaluation of the UVA protection was assessed by the determination of the UVA/UVB ratio and the critical wavelength. The antioxidants API, CRI, BTC and CMB were stable under UVA/VIS and VIS light. However weak photoreactivity after UVA/VIS irradiation was observed for API, CRI and CMB in the ROS assay. In the 3T3 NRU phototoxicity test, phototoxic potential was observed for CRI, BTC, CMB and CMB+BMZ after UVA/VIS exposure, and for BTC and CMB after VIS exposure. BMZ reduced the phototoxic potential of CMB in the VIS range. In the in vitro evaluation of UVA protection API, CRI, BTC, CMB and CMB+BMZ presented ultra UVA protection (UVA/UVB ratio>0.9) and exhibited critical wavelength close to or above 370nm. In conclusion, the use of API, CRI, BTC and their CMB aiming skin photoprotection could be considered safer in the VIS range. Furthermore, API presented the best performance in the photosafety screening among the studied antioxidants, since it was photostable and non-phototoxic in UVA/VIS and photostable, non-photoreactive and non-phototoxic in VIS range. PMID:27130544

  2. Commercial facility site selection simulating based on MAS

    Chao, Yi; Li, Qingquan; Zheng, Guizhou

    2008-10-01

    The location of commercial facility decides the benefit of the operator to a large degree. Existing location methods can express the static relationships between site selection result and location factors, but there still are some limites when express the dynamic and uncertain relationship between them. Hence, a dynamic, stochastic and forecastable location model should be built which can introduce the customer's behavior into the model and combine the macro pattern and micro spatial interaction. So the authors proposes Geosim-LM based on MAS. Geosim-LM has 3 kinds of agents, CustAgent, SiteAgent and GovAgent. They represent the customers, commercial fercilities and government. The land type, land price and traffic are the model environment. Then Geosim-LM is applied in the bank branches site evaluation and selection in Liwan district, Guangzhou. In existing bank branches site evaluation, there are 70% consistent in score grade between result of Geosim-LM after 200 round runing and actual rebust location. It proves the model is reliable and feasible. The conclusions can be get from the paper. MAS have advantages in location choice than existed methods. The result of Geosim-LM running can powerfully proves that building location model based on MAS is feasible.

  3. MAS及其相关概念%MAS and Correlation Conceptions

    程显毅; 董红斌

    2000-01-01

    The researching of MAS originates from distributed artificial intelligence ,because new theory framework is provided for solving some problems in complex and distributed environment ,MAS is valued increasingly by computer ,automatic control and management science.

  4. Importance of UVA photoprotection as shown by genotoxic related endpoints: DNA damage and p53 status

    In order to demonstrate the importance of photoprotection in the UVA range (320-400 nm), an in vitro approach where sun formulations are spread on a quartz slide, and placed over human keratinocytes in culture is proposed as a convenient test for photoprotection assessment at the DNA level. Using the comet assay, DNA strand breaks, oxidative DNA damage or drug-induced DNA breaks were assessed. Accumulation of p53 protein was also studied as a marker for UV-induced genotoxic stress. Such a method was used to compare two formulations with different photostability. Spectroradiometry showed that a photounstable formulation lost its effectiveness in UVA screening when pre-irradiated by simulated sunlight (UVB + UVA). As a consequence, it was also shown that this formulation was not as protective as the photostable one at the genomic level. These data demonstrate that the loss of absorbing efficiency within UVA wavelengths due to photounstability may have detrimental consequences leading to impairments implicated in genotoxic events

  5. Lifestyle, sun worshipping and sun tanning - what about UV-A sun beds?

    This article considers the effects of ultraviolet (UV) light from the sun and UV-A sun beds on the skin. Sun worshipping and sun therapy has been en vogue for centuries, but in another way than used today. A changing lifestyle has led to an increase of various skin diseases, including skin cancer. Short wave UV-light (UV-B) in particular has been blamed for inducing not only erythema and pigmentation but also more chronic skin lesions. Long wave UV-light (UV-A) has been shown to be the cause of similar changes to the skin but the pigmentation is of another quality and affords less protection against the harmful effects of UV-B. A concept of sun reactive skin typing has been created. This is based on self-reported responses to an initial exposure to sun as regards tanning ability and erythema reaction. These two factors have certain practical consequences, not only for UV-phototherapy but also for a person's risk of developing skin cancer. Recently, several research groups and dermatologists have discouraged extensive use of UV-A sun beds because of side effects of varying degrees of seriousness. The possible implications of these side effects for the organism are not fully elucidated and may be more profound than known today. The British Photodermatology Group has issued more stringent rules for persons who, despite advice to the contrary, still wish to use UV-A sun beds. 14 refs., 1 tab

  6. Long-wave UVA offers partial protection against UVB-induced

    Skov, L.; Villadsen, L.; Ersbøll, Bjarne Kjær; Simon, J. C.; Barker, J. N.; Baadsgaard, O.

    2000-01-01

    Ultraviolet-B (UVB, 280–320 nm) interferes with the generation of cell-mediated immunity to contact allergens applied epicutaneously on the irradiated site. To investigate whether pretreatment with UVA-1 (340–400 nm) protects against the UVB-induced immune suppression we sensitized human voluntee...

  7. Convenient Synthesis of a Novel Flavonoid with Extended π-System: Active Agent for UVA Protection

    Saleh Al-Busafi

    2013-01-01

    Flavonoid derivative with extended cinnamic acid moiety was synthesized using Baker-Venkataraman reaction. The compound shows interesting UV absorption properties which make it a good UVA absorber. A bathochromic shift of 18 nm was observed when the size of cinnamic acid segment was increased by one styrylogous extension.

  8. Can dietary furanocoumarin ingestion enhance the erythemal response during high-dose UVA1 therapy?

    Beattie, Paula E; Wilkie, Murray J V; Smith, Gillian; Ferguson, James; Ibbotson, Sally H

    2007-01-01

    As phototoxic skin reactions caused by psoralen are induced by wavelengths within the UVA1 spectrum, we assessed the potential of the small amount of psoralen in a normal diet to provoke phototoxicity in volunteers with skin types I and II. Threshold erythema was unaffected by ingestion of a 200-g portion of parsnip. PMID:17097373

  9. (Pheo)melanin photosensitizes UVA-induced DNA damage in cultured human melanocytes

    Wenczl, E.; Schans, G.P. van der; Roza, L.; Kolb, R.M.; Timmerman, A.J.; Smit, N.P.M.; Pavel, S.; Schothorst, A.A.

    1998-01-01

    The question of whether melanins are photoprotecting and/or photosensitizing in human skin cells continues to be debated. To evaluate the role of melanin upon UVA irradiation, DNA single-strand breaks (ssb) were measured in human melanocytes differing only in the amount of pigment produced by cultur

  10. IBIS UvA: Combining theory and practice in the area of quality and efficiency improvement

    M. Schoonhoven

    2012-01-01

    The institute for Business and Industrial Statistics of the University of Amsterdam (IBIS UvA) is an independent consultancy firm. The institute sees the interaction between scientific research, on the one hand, and the application of technology in business and healthcare, on the other, as its core.

  11. Importance of UVA photoprotection as shown by genotoxic related endpoints: DNA damage and p53 status

    Marrot, Laurent [L' Oreal Research, Life Sciences Research, Phototoxicology Unit, Genotoxicity Group 1, av. E. Schueller, 93600 Aulnay-Sous-Bois (France)]. E-mail: lmarrot@rd.loreal.com; Belaidi, Jean-Philippe [L' Oreal Research, Life Sciences Research, Phototoxicology Unit, Genotoxicity Group 1, av. E. Schueller, 93600 Aulnay-Sous-Bois (France); Meunier, Jean-Roch [L' Oreal Research, Life Sciences Research, Phototoxicology Unit, Genotoxicity Group 1, av. E. Schueller, 93600 Aulnay-Sous-Bois (France)

    2005-04-01

    In order to demonstrate the importance of photoprotection in the UVA range (320-400 nm), an in vitro approach where sun formulations are spread on a quartz slide, and placed over human keratinocytes in culture is proposed as a convenient test for photoprotection assessment at the DNA level. Using the comet assay, DNA strand breaks, oxidative DNA damage or drug-induced DNA breaks were assessed. Accumulation of p53 protein was also studied as a marker for UV-induced genotoxic stress. Such a method was used to compare two formulations with different photostability. Spectroradiometry showed that a photounstable formulation lost its effectiveness in UVA screening when pre-irradiated by simulated sunlight (UVB + UVA). As a consequence, it was also shown that this formulation was not as protective as the photostable one at the genomic level. These data demonstrate that the loss of absorbing efficiency within UVA wavelengths due to photounstability may have detrimental consequences leading to impairments implicated in genotoxic events.

  12. A General Protocol for Temperature Calibration of MAS NMR Probes at Arbitrary Spinning Speeds

    Guan, Xudong; Stark, Ruth E.

    2010-01-01

    A protocol using 207Pb NMR of solid lead nitrate was developed to determine the temperature of magic-angle spinning (MAS) NMR probes over a range of nominal set temperatures and spinning speeds. Using BioMAS and fastMAS probes with typical sample spinning rates of 8 and 35 kHz, respectively, empirical equations were devised to predict the respective sample temperatures. These procedures provide a straightforward recipe for temperature calibration of any MAS probe.

  13. Formalization of the Abstract Architecture of MAS Based on FIPA Specification

    Zheng Liwei(郑丽伟); Yu Xueli; Feng Xiufang

    2003-01-01

    The FIPA specification of MAS (multi-agent system)is accepted by most of the applications of MAS in the world, and has been used in many projects. This paper draws an abstract architecture from the FIPA based MAS, and gives formalization about it.

  14. Influence of uvA on the erythematogenic and therapeutic effects of uvB irradiation in psoriasis; photoaugmentation effects

    The effect of repeated exposure to an additive dose of long ultraviolet (uvA) radiation on the erythemogenic and therapeutic effects of middle ultraviolet (uvB) irradiation was investigated in 8 patients with psoriasis. The surface of the backs of these patients was divided into 2 parts, 1 of which received only uvB irradiation 4 times a week and the other uvA + uvB. uvB was provided by Philips TL-12 lamps and uvA by glass-filtered Philips TL-09 lamps. uvA was held constantly at 10 J/cm2, whereas uvB alone were evaluated by 4 tests during the treatment to determine the minimal erythema dose (MED). Test I (at the start of the therapy) showed a photoaugmentative effect which was no longer apparent in Test III (third week). Test III showed a reversal of the ratios of the MEDs of the sites irradiated with the uvA + uvB and uvB (MED A + B/MED B). This is ascribed to the marked pigmentation which appeared after repeated irradiation with the uvA + uvB combination. Comparison showed for the improvement of the psoriasis no distinct differences between uvA + uvB irradiation and uvB alone, but the former had the cosmetic advantage of giving pleasing tan

  15. Altered decorin expression of systemic sclerosis by UVA1 (340–400 nm phototherapy: Immunohistochemical analysis of 3 cases

    Morita Akimichi

    2003-03-01

    Full Text Available Abstract Background Ultraviolet A1 (340–400 nm, UVA1 phototherapy is highly effective in sclerotic lesions of systemic sclerosis (SSc. Histological evaluation of skin specimens obtained before and after UVA1 phototherapy revealed loosening of collagen bundles and the appearance of small collagen fibers. We have previously shown that UVA1 irradiation induced collagenase in vitro study by using SSc fibroblasts. The increased levels of mRNA and protein of decorin in SSc fibroblasts were reported. In this study, we focus on the lesional expression of small dermatan sulfate proteoglycan, decorin that has a role of binding to collagen and fibrillogenesis. Case presentation We employed immunohistochemical analysis of decorin before and after UVA1 phototherapy. The skin specimens from three patients who were effectively treated with UVA1 phototherapy were analysed. Monoclonal antibody 6B6 as the specific reactivity to decorin was used. The increased decorin was focally accumulated in the newly synthesized collagen fibers in the sclerotic lesion of SSc. After UVA1 phototherapy, decorin was decreased in upper to middle dermis, although decorin was slightly increased in papillary dermis. Conclusions These results suggest that decreased and normalized levels of accumulated decorin may relate to the efficacy of sclerotic lesions in UVA1 phototherapy.

  16. Endonuclease IV Is the Main Base Excision Repair Enzyme Involved in DNA Damage Induced by UVA Radiation and Stannous Chloride

    José Carlos P. De Mattos

    2010-01-01

    Full Text Available Stannous chloride (SnCl2 and UVA induce DNA lesions through ROS. The aim of this work was to study the toxicity induced by UVA preillumination, followed by SnCl2 treatment. E. coli BER mutants were used to identify genes which could play a role in DNA lesion repair generated by these agents. The survival assays showed (i The nfo mutant was the most sensitive to SnCl2; (ii lethal synergistic effect was observed after UVA pre-illumination, plus SnCl2 incubation, the nfo mutant being the most sensitive; (iii wild type and nfo mutants, transformed with pBW21 plasmid (nfo+ had their survival increased following treatments. The alkaline agarose gel electrophoresis assays pointed that (i UVA induced DNA breaks and fpg mutant was the most sensitive; (ii SnCl2-induced DNA strand breaks were higher than those from UVA and nfo mutant had the slowest repair kinetics; (iii UVA+SnCl2 promoted an increase in DNA breaks than SnCl2 and, again, nfo mutant displayed the slowest repair kinetics. In summary, Nfo protects E. coli cells against damage induced by SnCl2 and UVA+ SnCl2.

  17. Disinfection of Spacecraft Potable Water Systems by Photocatalytic Oxidation Using UV-A Light Emitting Diodes

    Birmele, Michele N.; O'Neal, Jeremy A.; Roberts, Michael S.

    2011-01-01

    Ultraviolet (UV) light has long been used in terrestrial water treatment systems for photodisinfection and the removal of organic compounds by several processes including photoadsorption, photolysis, and photocatalytic oxidation/reduction. Despite its effectiveness for water treatment, UV has not been explored for spacecraft applications because of concerns about the safety and reliability of mercury-containing UV lamps. However, recent advances in ultraviolet light emitting diodes (UV LEDs) have enabled the utilization of nanomaterials that possess the appropriate optical properties for the manufacture of LEDs capable of producing monochromatic light at germicidal wavelengths. This report describes the testing of a commercial-off-the-shelf, high power Nichia UV-A LED (250mW A365nnJ for the excitation of titanium dioxide as a point-of-use (POD) disinfection device in a potable water system. The combination of an immobilized, high surface area photocatalyst with a UV-A LED is promising for potable water system disinfection since toxic chemicals and resupply requirements are reduced. No additional consumables like chemical biocides, absorption columns, or filters are required to disinfect and/or remove potentially toxic disinfectants from the potable water prior to use. Experiments were conducted in a static test stand consisting of a polypropylene microtiter plate containing 3mm glass balls coated with titanium dioxide. Wells filled with water were exposed to ultraviolet light from an actively-cooled UV-A LED positioned above each well and inoculated with six individual challenge microorganisms recovered from the International Space Station (ISS): Burkholderia cepacia, Cupriavidus metallidurans, Methylobacterium fujisawaense, Pseudomonas aeruginosa, Sphingomonas paucimobilis and Wautersia basilensis. Exposure to the Nichia UV-A LED with photocatalytic oxidation resulted in a complete (>7-log) reduction of each challenge bacteria population in UV-A LEDs and semi

  18. Synergistic bactericidal effect by combined exposure to Ag nanoparticles and UVA

    Broad and strong antimicrobial properties of silver (Ag) have been used for biomedical applications, water treatment, etc. In this study, a synergistic antibacterial effect between Ag nanoparticles (AgNPs) and ultraviolet (UV) light was examined. AgNPs ( 1 μm) with UVA and AgNPs with UVB (280–325 nm) did not. As significant bactericidal activity was also exhibited by hydrogen peroxide-treated AgNPs, the surface oxidation of AgNPs caused by UVA irradiation was considered to contribute to the enhanced antibacterial effect. Although no difference in NP-incorporation rates was observed with or without the surface oxidation of AgNPs, a particle size of less than 0.1 μm was a factor for AgNPs uptake and an essential requirement for the antimicrobial function of Ag particles. Incorporated AgNPs oxidized by UVA irradiation released larger amounts of Ag ion inside cells than reduced AgNPs, which reacted with intercellular molecules having –SH groups such as glutathione. The synergistic use of AgNPs and UVA could become a powerful tool with broad antimicrobial applications. Highlights: • Combined treatment with AgNPs and UV achieved a remarkable antibacterial effect in E. coli. • For the antibacterial effect, it is necessary to satisfy the following requirements: • 1) Translocation of nano-sized Ag particles inside E. coli. • 2) Oxidation of AgNPs by UVA, and extensive and persistent release of Ag+ inside E. coli. • Ag+ released inside cells reacted with intercellular molecules having –SH groups such as GSH

  19. UVA experimental and high energy physics. Final grant report 1992-1997

    The period 1992--1997 was a mixture of frustrations and of accomplishments for the UVa HEP group. The experimental HEP group began this period with the completion of a truncated run of Experiment E771 at Fermilab in 1992. This experiment was designed to measure the cross section for beauty production in 800 GeV/c pN interactions. It succeeded in this goal as well as in obtaining one of the best limits on FCNC in charm decays by setting an upper limit on D0 -> μ+μ-. In addition, they were able to measure Ψ, Ψ, χ1,χ2 and upsilon production. Three UVa PhD theses have resulted from this experiment (as well as 12 other PhD's at other institutions). At the same time, the UVa experimental group was vigorously pursuing the goal of studying CP violation in B production. This took the form of a proposal to the SSC for a super fixed target facility, the SFT, which would focus on studies of B mesons. B. Cox was the spokesman of this experiment that had over thirty institutions. This proposal EOI-14 had a good reception by the SSC PAC. A R and D activity to prove the technique of crystal channeling was undertaken to prove the accelerator aspects of this proposal. This activity, known as E853 or CEX at Fermilab, resulted in proof of the crystal channeling technique as viable for the extraction of 20 TeV beam at the SSC. In addition to this activity, the UVa group investigated many other aspects of B physics at the SSC. They were among the leaders of the 1993 Snowmass meeting on B Physics at Hadronic Accelerators. The UVa HEP group worked vigorously on developing the ideas for B physics at the SSC, as evidenced by the many different studies listed in the publication list given, up to the very day the SSC was terminated by an act of Congress

  20. Optimization of MAS and MODIS Polar ocean cloud mask

    Memmen, Sean P.

    2000-01-01

    With the reduction of funding for sea ice reconnaissance flights, the National/Naval Ice Center needs to capitalize on the improvements in satellite technology. Imaging sensors such as AVHRR, DMSP/OLS, SSM/I and RADARSAT have been used to detect the presence of sea ice, but with the exception of SSM/I and RADARSAT, clouds are a major obstacle to viewing the surface. With NASA's development of the Moderate-resolution Imaging Spectroradiometer (MODIS) and MODIS Airborne Simulator (MAS), there i...

  1. MAS-SCM for Auto Sector-The Framework

    Ritu Sindhu

    2011-07-01

    Full Text Available The purpose of this study is to describe in detail the development status of the innovative Multi -Agent based supply chain management (MAS-SCMAS for auto sector. This study was undertaken in view of the significance of improvement in efficiency of automobile sector and the development of a good multi-agent system framework to achieve that. The factors affecting the efficiency or OEE of the industry and the efficiency properties were identified. It was clearly revealed that the available model do not fulfill the needs in the supply chain management of automobile industry and there is a scope for evolving new model resulting in better efficiency.

  2. The MAS Six Years in Power in Bolivia

    2012-01-01

    Review Essay of:– The Rise of Evo Morales and the MAS, by Sven Harten. London/New York: Zed Books, 2011.– Evo Morales and the Movimiento al Socialismo in Bolivia; The First Term in Context, edited by Adrian J. Pearce. London, Institute for the Study of the Americas, 2011.– El estado de derecho como tiranía, by Luis Tapia. La Paz: CIDES/UMSA, 2011.– From Rebellion to Reform in Bolivia: Class Struggle, Indigenous Liberation and the Politics of Evo Morales, by Jeffery R. Webber. Chicago: Haymark...

  3. Atividade antibacteriana, antioxidante e tanante de subprodutos da uva Antibacterial, antioxidant and tanning activity of grape by-product

    Rui Rotava; Irineo Zanella; Leila Picolli da Silva; Melânia Palermo Manfron; Carla Speroni Ceron; Sydney Hartz Alves; Ana Kátia Karkow; João Paulo Aquino Santos

    2009-01-01

    O objetivo neste trabalho foi determinar-se in vitro a atividade antibacteriana, antioxidante e tanante de subprodutos da uva (Vitis vinifera) para seu aproveitamento como ingredientes alternativos na indústria avícola e na conservação de alimentos. Compostos polares foram extraídos da semente de uva desengordurada, em solução contendo acetona, água e ácido acético, resultando em 10,3% de rendimento de extrato de semente de uva desengordurada (ESUD). O ESUD apresentou alta atividade antibacte...

  4. Photobiological implications of melanin photoprotection after UVB-induced tanning of human skin but not UVA-induced tanning

    Coelho, Sergio G.; Yin, Lanlan; Smuda, Christoph; Mahns, Andre; Kolbe, Ludger; Hearing, Vincent J.

    2015-01-01

    Repetitive suberythemal UVA and/or UVB exposures were used to generate comparable UV-induced tans in human skin over the course of 2 weeks. In order to evaluate the potential photoprotective values of those UVA- and/or UVB- induced tans and to avoid the confounding issue of residual UV-induced DNA damage, we waited 1 week before challenging those areas with a 1.5 MED dose of UVA+UVB after which we measure DNA damage. The results show that the type of UV used to induce skin pigmentation affect...

  5. Milli-Arcsecond (MAS) Imaging of the Solar Corona

    Davila, Joseph M.; Oktem, Figen S.; Kamalabadi, Farzad; O'Neill, John; Novo-Gradac, Anne-Marie; Daw, Adrian N.; Rabin, Douglas M.

    2016-05-01

    Dissipation in the solar corona is believed to occur in extremely thin current sheets of order 1-100 km. Emission from these hot but thin current sheets should be visible in coronal EUV emission lines. However, this spatial scale is far below the resolution of existing imaging instruments, so these dissipation sites have never been observed individually. Conventional optics cannot be manufactured with sufficient surface figure accuracy to obtain the required spatial resolution in the extreme-ultraviolet where these hot plasmas radiate. A photon sieve, a diffractive imaging element similar to a Fresnel zone plate, can be manufactured to provide a few milli-arcsec (MAS) resolution, with much more readily achievable tolerances than with conventional imaging technology. Prototype photon sieve elements have been fabricated and tested in the laboratory. A full-scale ultra-high resolution instrument will require formation flying and computational image deconvolution. Significant progress has been made in overcoming these challenges, and some recent results in these areas are discussed. A simple design for a sounding rocket concept demonstration payload is presented that obtains 80 MAS (0.080 arcsec) imaging with a 100 mm diameter photon sieve to image Fe XIV 334 and Fe XVI 335. These images will show the structure of the corona at a resolution never before obtained, and they will also allow a study of the temperature structure in the dissipation region.

  6. Skin Treatment with Pulsed Monochromatic UVA1 355 Device and Computerized Morphometric Analysis of Histochemically Identified Langerhans Cells

    Zerbinati, Nicola; Riva, Federica; Paulli, Marco; Parodi, Pier Camillo

    2016-01-01

    Fluorescent or metal halide lamps are widely used in therapeutic applications in dermatological diseases, with broadband or narrow band emission UVA/UVA1 (320–400 nm) obtained with suitable passive filters. Recently, it has been possible for us to use a new machine provided with solid state source emitting pulsed monochromatic UVA1 355 nm. In order to evaluate the effects of this emission on immunocells of the skin, human skin samples were irradiated with monochromatic 355 nm UVA1 with different energetic fluences and after irradiation Langerhans cells were labeled with CD1a antibodies. The immunohistochemical identification of these cells permitted evaluating their modifications in terms of density into the skin. Obtained results are promising for therapeutical applications, also considering that a monochromatic radiation minimizes thermic load and DNA damage in the skin tissues. PMID:27525266

  7. Whole body UVA irradiation lowers systemic blood pressure by release of nitric oxide from intracutaneous photolabile nitric oxide derivates

    Opländer, C.; Volkmar, C.M.; Paunel-Görgülü, A; van Faassen, E.E.H.; Heiss, C

    2009-01-01

    Rationale: Human skin contains photolabile nitric oxide derivates like nitrite and S-nitroso thiols, which after UVA irradiation, decompose and lead to the formation of vasoactive NO. Objective: Here, we investigated whether whole body UVA irradiation influences the blood pressure of healthy volunteers because of cutaneous nonenzymatic NO formation. Methods and Results: As detected by chemoluminescence detection or by electron paramagnetic resonance spectroscopy in vitro with human skin speci...

  8. UVA is the major contributor to the photodegradation of tretinoin and isotretinoin: implications for development of improved pharmaceutical formulations

    Tashtoush, Bassam M.; Jacobson, Elaine L.; Jacobson, Myron K.

    2007-01-01

    The chemical stability of tretinoin (RA) and isotretinoin (13RA) in ethanol and dermatological cream preparations exposed to solar simulated light (SSL), UVA, and visible light has been studied. Photostability was monitored by an HPLC method that allowed simultaneous analysis of RA and 13RA, thus allowing photodegradation due to isomerization to other retinoids and photolysis to non-retinoid products to be monitored. Both retinoids undergo both isomerization and photolysis following SSL, UVA ...

  9. Plasma levels of 8-methoxypsoralen following PUVA-bath photochemotherapy

    Kobyletzki, G. von; Hoffmann, K.; Kerscher, M.; Altmeyer, P. [Ruhr-Univ., Dept. of Dermatology, Bochum (Germany)

    1998-08-01

    Administration of 8-methoxypsoralen (8-MOP) in a dilute bath water solution is an effective therapeutic alternative to oral PUVA therapy, avoiding systemic side effects, offering better bioavailability of the psoralen and requiring much smaller amounts of UVA for induction of therapeutic effects. To obtain exact data about the percutaneous absorption of 8-MOP during a psoralen bath, the plasma levels of the drug were determined in 26 patients with different skin diseases by a reverse high-performance liquid chromatographic method. Fifteen patients receiving oral PUVA therapy (0.8 mg 8-MOP/kg body weight) served as a positive control group. Bath solutions were prepared by diluting 15 ml of 0.5% stock solution of 8-MOP in 150 l of bath water (0.5 mg/l, 37 deg. C). Blood samples were drawn from patients 5, 30, 60, 120 and 180 min after the bath. In the oral PUVA group, blood samples were obtained 1 1/2 h after administration of the drug. In 23 og 26 patients, 8-MOP levels were undetectable in every blood sample. After 30 min, two patients showed detectable levels of 8-MOP (5 ng/ml, 7 ng/ml), while 60 min after the PUVA bath 8-MOP was detectable in only one volunteer (5 ng/ml). In patients receiving oral 8-MOP therapy, serum levels varied between 45 and 360 ng/ml 1 1/2 h after drug administration. Our data confirm extremely low 8-MOP levels resulting from 8-MOP bath water treatments and provide confirmation of the absence of systemic side effects in patients who are undergoing PUVA-bath therapy. (au) 15 refs.

  10. Plasma levels of 8-methoxypsoralen following PUVA-bath photochemotherapy

    Administration of 8-methoxypsoralen (8-MOP) in a dilute bath water solution is an effective therapeutic alternative to oral PUVA therapy, avoiding systemic side effects, offering better bioavailability of the psoralen and requiring much smaller amounts of UVA for induction of therapeutic effects. To obtain exact data about the percutaneous absorption of 8-MOP during a psoralen bath, the plasma levels of the drug were determined in 26 patients with different skin diseases by a reverse high-performance liquid chromatographic method. Fifteen patients receiving oral PUVA therapy (0.8 mg 8-MOP/kg body weight) served as a positive control group. Bath solutions were prepared by diluting 15 ml of 0.5% stock solution of 8-MOP in 150 l of bath water (0.5 mg/l, 37 deg. C). Blood samples were drawn from patients 5, 30, 60, 120 and 180 min after the bath. In the oral PUVA group, blood samples were obtained 1 1/2 h after administration of the drug. In 23 og 26 patients, 8-MOP levels were undetectable in every blood sample. After 30 min, two patients showed detectable levels of 8-MOP (5 ng/ml, 7 ng/ml), while 60 min after the PUVA bath 8-MOP was detectable in only one volunteer (5 ng/ml). In patients receiving oral 8-MOP therapy, serum levels varied between 45 and 360 ng/ml 1 1/2 h after drug administration. Our data confirm extremely low 8-MOP levels resulting from 8-MOP bath water treatments and provide confirmation of the absence of systemic side effects in patients who are undergoing PUVA-bath therapy. (au)

  11. Activation of NF-κB in human skin fibroblasts by the oxidative stress generated by UVA radiation

    We have examined the role of the nucleus and the membrane in the activation of nuclear factor (NF)-kB by oxidant stress generated via the UVA (320-380 nm) component of solar radiation. Nuclear extracts from human skin fibroblasts that had been irradiated with UVA at doses that caused little DNA damage contained activated NF-κB that bound to its recognition sequence in DNA. The UVA radiation-dependent activation of NF-κB in enucleated cells confirmed that the nucleus was not involved. On the other hand, UVA radiation-dependent activation of NF-κB appeared to be correlated with membrane damage, and activation could be prevented by α-tocopherol and butylated hydroxytoluene, agents that inhibited UVA radiation-dependent peroxidation of cell membrane lipids. The activation of NF-κB by the DNA damaging agents UVC (200-290 nm) and UVB (290-320 nm) radiation also only occurred at doses where significant membrane damage was induced, and, overall, activation was not correlated with the relative levels of DNA damage induced by UVC/UVB and UVA radiations. We conclude that the oxidative modification of membrane components may be an important factor to consider in the UV radiation-dependent activation of NF-κB over all wavelength ranges examined. (Author)

  12. Activation of NF-{kappa}B in human skin fibroblasts by the oxidative stress generated by UVA radiation

    Vile, G.F.; Tanew-Iliitschew, Adrian; Tyrrell, R.M. [Institut Suisse de Recherches Experimentales sur le Cancer, Lausanne (Switzerland)

    1995-09-01

    We have examined the role of the nucleus and the membrane in the activation of nuclear factor (NF)-kB by oxidant stress generated via the UVA (320-380 nm) component of solar radiation. Nuclear extracts from human skin fibroblasts that had been irradiated with UVA at doses that caused little DNA damage contained activated NF-{kappa}B that bound to its recognition sequence in DNA. The UVA radiation-dependent activation of NF-{kappa}B in enucleated cells confirmed that the nucleus was not involved. On the other hand, UVA radiation-dependent activation of NF-{kappa}B appeared to be correlated with membrane damage, and activation could be prevented by {alpha}-tocopherol and butylated hydroxytoluene, agents that inhibited UVA radiation-dependent peroxidation of cell membrane lipids. The activation of NF-{kappa}B by the DNA damaging agents UVC (200-290 nm) and UVB (290-320 nm) radiation also only occurred at doses where significant membrane damage was induced, and, overall, activation was not correlated with the relative levels of DNA damage induced by UVC/UVB and UVA radiations. We conclude that the oxidative modification of membrane components may be an important factor to consider in the UV radiation-dependent activation of NF-{kappa}B over all wavelength ranges examined. (Author).

  13. Avaliação da uva cv. Isabel para a elaboração de vinho tinto

    RIZZON Luiz Antenor

    2000-01-01

    Full Text Available A uva Isabel, originária do Sul dos Estados Unidos, é uma das principais cultivares de Vitis labrusca. Atualmente é a cultivar mais difundida na Serra Gaúcha, representando aproximadamente 45% de toda a uva produzida nessa região. Além da elaboração de vinho tinto comum, a Isabel é utilizada para elaboração de vinho rosado e suco e comercializada como uva de mesa. O objetivo do presente trabalho foi determinar as características agronômicas e enológicas da uva Isabel, para elaboração de vinho tinto comum. Para isso, avaliou-se a maturação da uva e realizaram-se estudos para caracterizar o cacho, o mosto e o vinho tinto, nas safras de 1988 a 1994. Os resultados obtidos evidenciaram que a uva Isabel tem cacho pequeno, solto, formado por bagas e sementes grandes. O mosto apresenta cor rosada pouco intensa, tem bom teor de açúcar e baixo nível de ácido málico e acidez total. O vinho tem cor vermelha viva; o aroma é intenso e com acentuada tipicidade varietal; a análise sensorial evidencia que geralmente falta ao vinho equilíbrio e maciez.

  14. Obtención de taninos a partir de la pepita de uva

    Paniagua Paez, Alvaro

    2015-01-01

    En este trabajo se ha diseñado una planta piloto para la extracción de taninos a partir de pomada de uva (pepitas de uva, hollejos y tallos), con una capacidad de tratamiento de 18 kg/día de pomada, para obtener 6.7 kg/día de concentrado tánico del 14% en peso. La instalación consta de un extractor discontinuo de tanque agitado (50 L), una centrifuga de tazón tubular para separar el sólido agotado del extracto y una etapa final de concentración del licor tánico mediante memb...

  15. MODIS Airborne simulator (MAS) Final Report for CLASIC

    Thomas Arnold; Steven Platnick

    2010-11-24

    The MAS was flown aboard the NASA ER-2 for the CLASIC field experiment, and for all data collected, provided calibrated and geolocated (Level-1B) radiance data for it’s 50 spectral bands (ranging in wavelength for 0.47 to 14.3 µm). From the Level-1B data, as directed in the Statement of Work, higher order (Level-2) data products were derived. The Level-2 products include: a) cloud optical thickness, b) cloud effective radius, c) cloud top height (temperature), d) cloud fraction, e) cloud phase products. Preliminary Level-1B and Level-2 products were provided during the field experiment (typically within one or two days of data collection). Final version data products were made available in December 2008 following considerable calibration analysis. Data collection, data processing (to Level-2), and discussion of the calibration work are summarized below.

  16. The MAS Six Years in Power in Bolivia

    Ton Salman

    2012-04-01

    Full Text Available Review Essay of:– The Rise of Evo Morales and the MAS, by Sven Harten. London/New York: Zed Books, 2011.– Evo Morales and the Movimiento al Socialismo in Bolivia; The First Term in Context, edited by Adrian J. Pearce. London, Institute for the Study of the Americas, 2011.– El estado de derecho como tiranía, by Luis Tapia. La Paz: CIDES/UMSA, 2011.– From Rebellion to Reform in Bolivia: Class Struggle, Indigenous Liberation and the Politics of Evo Morales, by Jeffery R. Webber. Chicago: Haymarket Books, 2011.– La democracia desde los márgenes: Transformaciones en el campo político boliviano, by María Teresa Zegada, with Claudia Arce, Gabriela Canedo and Alber Quispe. La Paz: Muela del Diablo Editores/CLACSO, 2011.

  17. Food Waste Composting Study from Makanan Ringan Mas

    Kadir, A. A.; Ismail, S. N. M.; Jamaludin, S. N.

    2016-07-01

    The poor management of municipal solid waste in Malaysia has worsened over the years especially on food waste. Food waste represents almost 60% of the total municipal solid waste disposed in the landfill. Composting is one of low cost alternative method to dispose the food waste. This study is conducted to compost the food waste generation in Makanan Ringan Mas, which is a medium scale industry in Parit Kuari Darat due to the lack knowledge and exposure of food waste recycling practice. The aim of this study is to identify the physical and chemical parameters of composting food waste from Makanan Ringan Mas. The physical parameters were tested for temperature and pH value and the chemical parameter are Nitrogen, Phosphorus and Potassium. In this study, backyard composting was conducted with 6 reactors. Tapioca peel was used as fermentation liquid and soil and coconut grated were used as the fermentation bed. Backyard composting was conducted with six reactors. The overall results from the study showed that the temperature of the reactors were within the range which are from 30° to 50°C. The result of this study revealed that all the reactors which contain processed food waste tend to produce pH value within the range of 5 to 6 which can be categorized as slightly acidic. Meanwhile, the reactors which contained raw food waste tend to produce pH value within the range of 7 to 8 which can be categorized as neutral. The highest NPK obtained is from Reactor B that process only raw food waste. The average value of Nitrogen is 48540 mg/L, Phosphorus is 410 mg/L and Potassium is 1550 mg/L. From the comparison with common chemical fertilizer, it shows that NPK value from the composting are much lower than NPK of the common chemical fertilizer. However, comparison with NPK of organic fertilizer shown only slightly difference value in NPK.

  18. Quercetin enhances UVA-induced DNA damage in a rat fibroblast cell line

    De Castro, M. F.; Basto, Diana; Silva, João P.; Coutinho, O P

    2007-01-01

    Ultraviolet A (UVA) radiation from sunlight induces the production of reactive oxygen species (ROS), affecting a variety of cellular targets including the DNA. Quercetin, a flavonol present in many fruits, vegetables and beverages has been reported as a powerful antioxidant with an important role in prevention of carcinogenesis. The use of this compound, in topical formulations, could be of benefit in the prevention of skin damage produced by sunlight exposure. We investigated the effec...

  19. Protective effect of selenium and zinc on UV-A damage in human skin fibroblasts

    Ultraviolet A radiation participates in cytotoxicity and carcinogensis of the skin by a mechanism involving the generation of reactive oxygen species. Endogenous antiradical defense systems utilize metalloenzymes including Se-dependent glutathione peroxidase and Cu and Zn superoxide dismutase. The aim of the present work was to determine the protective effect of two trace elements, Se and Zn, on cultured human diploid fibroblasts exposed to UV-A radiation (broad-spectrum source with a maximum intensity at 375 nm). (Author)

  20. Exposure of vitamins to UVB and UVA radiation generates singlet oxygen

    Knak, Alena; Regensburger, Johannes; Maisch, Tim; Bäumler, Wolfgang

    2014-01-01

    Deleterious effects of UV radiation in tissue are usually attributed to different mechanisms. Absorption of UVB radiation in cell constituents like DNA causes photochemical reactions. Absorption of UVA radiation in endogenous photosensitizers like vitamins generates singlet oxygen via photosensitized reactions. We investigated two further mechanisms that might be involved in UV mediated cell tissue damage. Firstly, UVB radiation and vitamins also generate singlet oxygen. Secondly, UVB radiati...

  1. UVA light-assisted anticancer drugs - study on 4-thiothymidine and its analogues

    Zhang, X. H.; Wang, A L; Li, D. P.; Xu, Y.-Z.

    2010-01-01

    The article reviews the chemical methods for the preparation of DNA containing 4-thiothymine. 4-Thiothymine has several unique properties, such as easy alkylation, ready oxidation and strong absorption in UVA region. These chemical and physical properties are retained at its nucleoside and DNA levels and particularly useful for chemical manipulation and photo crossing of the thiothymine DNA with other biomolecules of interest. The ability to make DNA containing thiothymine or their functional...

  2. UVA and UVB irradiation differentially regulate microRNA expression in human primary keratinocytes.

    Anne Kraemer

    Full Text Available MicroRNA (miRNA-mediated regulation of the cellular transcriptome is an important epigenetic mechanism for fine-tuning regulatory pathways. These include processes related to skin cancer development, progression and metastasis. However, little is known about the role of microRNA as an intermediary in the carcinogenic processes following exposure to UV-radiation. We now show that UV irradiation of human primary keratinocytes modulates the expression of several cellular miRNAs. A common set of miRNAs was influenced by exposure to both UVA and UVB. However, each wavelength band also activated a distinct subset of miRNAs. Common sets of UVA- and UVB-regulated miRNAs harbor the regulatory elements GLYCA-nTRE, GATA-1-undefined-site-13 or Hox-2.3-undefined-site-2 in their promoters. In silico analysis indicates that the differentially expressed miRNAs responding to UV have potential functions in the cellular pathways of cell growth and proliferation. Interestingly, the expression of miR-23b, which is a differentiation marker of human keratinocytes, is remarkably up-regulated after UVA irradiation. Studying the interaction between miR-23b and its putative skin-relevant targets using a Luciferase reporter assay revealed that RRAS2 (related RAS viral oncogene homolog 2, which is strongly expressed in highly aggressive malignant skin cancer, to be a direct target of miR-23b. This study demonstrates for the first time a differential miRNA response to UVA and UVB in human primary keratinocytes. This suggests that selective regulation of signaling pathways occurs in response to different UV energies. This may shed new light on miRNA-regulated carcinogenic processes involved in UV-induced skin carcinogenesis.

  3. Lactobacillus sakei lipoteichoic acid inhibits MMP-1 induced by UVA in normal dermal fibroblasts of human.

    You, Ga-Eun; Jung, Bong-Jun; Kim, Hye-Rim; Kim, Han-Geun; Kim, Tae-Rahk; Chung, Dae-Kyun

    2013-10-28

    Human skin is continuously exposed to ultraviolet (UV)-induced photoaging. UVA increases the activity of MMP-1 in dermal fibroblasts through mitogen-activated protein kinase (MAPK), p38, signaling. The irradiation of keratinocytes by UVA results in the secretion of the inflammatory cytokine, tumor necrosis factor-α (TNF-α), and the stimulation of MMP-1 in normal human dermal fibroblasts (NHDFs). Lipoteichoic acid (LTA) is a component of the cell wall of gram-positive Lactobacillus spp. of bacteria. LTA is well known as an anti-inflammation molecule. LTA of the bacterium Lactobacillus plantarum has an anti-photoaging effect, but the potential anti-photoaging effect of the other bacteria has not been examined to date. The current study showed that L. sakei LTA (sLTA) has an immune modulating effect in human monocyte cells. Our object was whether inhibitory effects of sLTA on MMP-1 are caused from reducing the MAPK signal in NHDFs. It inhibits MMP-1 and MAPK signaling induced by UVA in NHDFs. We also confirmed effects of sLTA suppressing TNF-α inducing MMP-1 in NHDFs. PMID:23851272

  4. Terrestrial humic substances in Daliao River and its estuary: optical signatures and photoreactivity to UVA light.

    Chen, Hao; Lei, Kun; Wang, Xuechun

    2016-04-01

    Fluorescent dissolved organic matter (FDOM) components were identified by Parallel Factor Analysis (PARAFAC) in surface water of Daliao River and its estuary with a focus on terrestrial humic substance-(HS)-like FDOM identified under two contrasting hydrological conditions. The hydrological conditions did not have noticeable effect on the spectral features of the terrestrial HS-like FDOM, but did affect the components' intensities and photoreactivity: (1) the intensities of terrestrial HS-like components were higher in the normal flow period than in the high flow period, and (2) a spectrally similar terrestrial HS-like FDOM identified under the two contrasting hydrological conditions showed distinct photoreactivity to the same dose of UVA illumination. The findings indicated that terrestrial HS was generated at lower intensities at the terrestrial sources during the high flow period than during the normal flow period and that the transport of terrestrial HS material through the river-estuary system was affected dominantly by seawater dilution along the salinity gradient while fine-tuned by solar UVA illumination. This study exemplifies the effect of hydrological conditions on optical signatures of terrestrial HS-like FDOM and their photoreactivity towards UVA illumination, improving our understanding of the dynamics of terrestrial HS material in river-estuary systems in the framework of the currently proposed new conceptual model for terrestrial organic matter. PMID:26627698

  5. Mechanism of Aloe Vera extract protection against UVA: shelter of lysosomal membrane avoids photodamage.

    Rodrigues, Daniela; Viotto, Ana Cláudia; Checchia, Robert; Gomide, Andreza; Severino, Divinomar; Itri, Rosangela; Baptista, Maurício S; Martins, Waleska Kerllen

    2016-03-01

    The premature aging (photoaging) of skin characterized by wrinkles, a leathery texture and mottled pigmentation is a well-documented consequence of exposure to sunlight. UVA is an important risk factor for human cancer also associated with induction of inflammation, immunosuppression, photoaging and melanogenesis. Although herbal compounds are commonly used as photoprotectants against the harmful effects of UVA, the mechanisms involved in the photodamage are not precisely known. In this study, we investigated the effects of Aloe Vera (Aloe barbadensis mil) on the protection against UVA-modulated cell killing of HaCaT keratinocytes. Aloe Vera exhibited the remarkable ability of reducing both in vitro and in vivo photodamage, even though it does not have anti-radical properties. Interestingly, the protection conferred by Aloe Vera was associated with the maintenance of membrane integrity in both mimetic membranes and intracellular organelles. The increased lysosomal stability led to a decrease in lipofuscinogenesis and cell death. This study explains why Aloe Vera extracts offer protection against photodamage at a cellular level in both the UV and visible spectra, leading to its beneficial use as a supplement in protective dermatological formulations. PMID:26815913

  6. Perencanaan Disain Deep Dig Arm pada Kapal Water Witch Untuk Pengerukan Sampah di Kali Mas Surabaya

    Tony Bambang Musriyadi; Erno Setyawan; Irfan Syarif Arief

    2014-01-01

    Kali Mas merupaka salah satu Sungai di Surabaya yang bermanfaat bagi hajat hidup penduduk Surabaya,Namun seiring berjalan waktu Kali Mas mengalami pendangkalan dan polusi sampah padat akibat pembuangan sampah sembarangan.Oleh karena itu penting untuk melakuakan pengerukan sendimen dan sampah yang efektif dan tepat agar tidak menggangu fungsi utama dari Kali Mas,maka perlu suatu alat untuk pengerukan,Backhoe dreger merupak alat yang tepat untuk pengerukan, akan tetapi harus disesuaikan lengan ...

  7. MOS-2: A Two-Dimension Space for Positioning MAS Organizational Models

    Abbas, Hosny; Shaheen, Samir

    2015-01-01

    The increased complexity and dynamism of present and future Multi-Agent Systems (MAS) enforce the need for considering both of their static (design-time) and the dynamic (run-time) aspects. A type of balance between the two aspects can definitely give better results related to system stability and adaptivity. MAS organization is the research area that is concerned with these issues and it is currently a very active and interesting research area. Designing a MAS with an initial organization an...

  8. An HR-MAS MR Metabolomics Study on Breast Tissues Obtained with Core Needle Biopsy

    MuLan Li; Yonghyun Song; Nariya Cho; Jung Min Chang; Hye Ryoung Koo; Ann Yi; Hyeonjin Kim; Sunghyouk Park; Woo Kyung Moon

    2011-01-01

    BACKGROUND: Much research has been devoted to the development of new breast cancer diagnostic measures, including those involving high-resolution magic angle spinning (HR-MAS) magnetic resonance (MR) spectroscopic techniques. Previous HR-MAS MR results have been obtained from post-surgery samples, which limits their direct clinical applicability. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we performed HR-MAS MR spectroscopic studies on 31 breast tissue samples (13 cancer and 18 non...

  9. Rapid repair of UVA-induced oxidized purines and persistence of UVB-induced dipyrimidine lesions determine the mutagenicity of sunlight in mouse cells

    Besaratinia, Ahmad; Kim, Sang-In; Pfeifer, Gerd P.

    2008-01-01

    Despite the predominance of UVA relative to UVB in terrestrial sunlight, solar mutagenesis in humans and rodents is characterized by mutations specific for UVB. We have investigated the kinetics of repair of UVA- and UVB-induced DNA lesions in relation to mutagenicity in transgenic mouse fibroblasts irradiated with equilethal doses of UVA and UVB in comparison to SSL. We have also analyzed mutagenesis-derived carcinogenesis in sunlight-associated human skin cancers by compiling the published ...

  10. The induction and repair of DNA damage and its influence on cell death in primary human fibroblasts exposed to UV-A or UV-C irradiation

    Irradiation with UV-A of normal human fibroblasts in phosphate-buffered saline induced cell death, measured as lack of colony-forming ability. After UV-A irradiation, single-strand breaks (alkali-labile bonds) could be detected in DNA; these lesions were rapidly repaired. Excision repair, monitored as unscheduled DNA synthesis, was induced strongly by irradiation with UV-C, but could not be detected after UV-A irradiation. The results indicate that lethality by UV-A wavelengths > 330 nm is caused by lesions other than single-strand breaks (alkali-labile bonds) and pyrimidine dimers. (Auth.)

  11. Carcinogenic effect of sequential artificial sunlight and UV-A irradiation in hairless mice. Consequences for solarium 'therapy'

    Staberg, B.; Wulf, H.C.; Poulsen, T.; Klemp, P.; Brodthagen, H.

    1983-08-01

    The carcinogenic effect of artificial UV sunlight followed by UV-A irradiation in human solaria doses has been studied with the use of the hairless mouse as an animal model. Artificial sunlight exposure alone induced only a moderate skin tumor incidence (animals with at least one tumor) of 0.15 after one year, and UV-A irradiation alone induced no tumor formation. However, the combination of artificial sunlight exposure and subsequent UV-A irradiation significantly increased the tumor incidence to 0.72. We conclude that, in humans, tanning with UV-A for cosmetic purposes may not be an innocuous procedure.

  12. UVA1治疗皮肤病的现状%Ultraviolet A1 for the treatment of cutaneous diseases

    陈利红; 郑捷

    2014-01-01

    在过去的30年中,UVA1因能进入皮肤深层诱导T细胞凋亡,下调多种细胞因子,激活内皮细胞并促进血管新生,逐渐被用于治疗各种皮肤疾病.目前有随机对照队列研究证据的疾病包括特应性皮炎、局限性硬皮病、系统性红斑狼疮,其他的适应证还有皮肤T细胞淋巴瘤、系统性硬皮病、胫前黏液性水肿、结节性痒疹等.相比其他光疗法,UVA1的近期不良反应相对较少,远期副作用目前尚无报道,仍需跟踪随访.%Since ultraviolet A1 (UVA1) can penetrate into deep layers of the skin,induce the apoptosis of T cells,down-regulate multiple cytokines,activate endothelial cells and promote neovascularization,it has been used to treat many dermatoses over the last three decades.There have been evidences from randomized control and cohort studies for the application of UVA1 phototherapy in atopic dermatitis,localized scleroderma and systemic lupus erythematosus.Other indications of UVA1 phototherapy are cutaneous T cell lymphoma,systemic scleroderma,pretibial myxedema,prurigo nodularis,etc.Compared with the other phototherapy regimens,UVA1 phototherapy shows less short-term side effects.However,little is known about long-term side effects of UVA1 phototherapy,and long-term follow-up studies are required.

  13. Comparative studies on the lethal, mutagenic, and recombinogenic effects of ultraviolet -A, -B, -C, and visible light with and without 8-methoxypsoralen in Saccharomyces cerevisiae

    Genetic effects of UV-A, UV-B, UV-C and the combination of 8-methoxypsoralen (8-MOP) with UV-A or visible light were studied in the haploid strain XV185-14C and diploid strain D5 of Saccharomyces cerevisiae. The induction of his+, lys+, and hom+ reverse mutations was measured in strain XV185-14C. In strain D5 we measured the induction of genetically altered colonies, particularly twin spot colonies arising from a mitotic crossing-over. UV-C and UV-B induced point mutations at the three loci in the haploid strain and mitotic crossing-over and other genetic alterations in the diploid strain. UV-C was more mutagenic and recombinogenic than UV-B. UV-A or visible light alone did not induce genotoxic effects at the doses tested. However, UV-A plus 8-MOP produced lethal and mutagenic effects in the haploid strain XV185-14C, although mutagenic activity was less than that of UV-B. Visible light plus 8-MOP also induced genotoxic effects in strain XV185-14C. In the diploid strain D5, UV-A plus 8-MOP induced a higher frequency of genetic alterations than UV-B at comparative doses. Visible light plus 8-MOP was also genetically active in strain D5. The haploid strain was more sensitive to the lethal effects of UV-C, UV-B, UV-A, and impure visible light plus 8-MOP than the diploid strain. (Author)

  14. Drying rates of Rubi grapes submitted to chemical pretreatments for raisin production Taxas de secagem de uva Rubi submetida a pré-tratamentos químicos para a produção de passas

    Vânia Regina Nicoletti Telis

    2006-03-01

    50ºC, o que resultou em tempos de secagem próximos aos do pré-tratamento com 2,5% de azeite de oliva, mas com um menor consumo dessa substância. Além disso, a imersão das uvas em uma suspensão aquosa de 2% de lecitina de soja, a 50ºC, por 5 minutos, resultou em um tempo de secagem total apenas levemente superior ao do pré-tratamento mais efetivo.

  15. COMPOSIÇÃO IDEAL DA SOLUÇÃO FILMOGÊNICA ADICIONADA DE PREBIÓTICO, APLICADA EM UVAS ‘THOMPSON’

    IURI MIRA

    2015-06-01

    Full Text Available A aplicação de coberturas comestíveis em frutas e hortaliças deve ser precedida de testes que busquem a formulação que melhor se adapta àquele produto. O objetivo deste trabalho foi determinar a composição ideal da cobertura comestível à base de cera de carnaúba adicionada de prebiótico a ser aplicada em uvas variedade Thompson, armazenadas sob refrigeração. Após a seleção, os frutos foram higienizados e procedeu-se à aplicação de soluções aquosas de cera de carnaúba adicionadas de Fruto-oligossacarídeo (FOS. Foram testadas treze formulações, utilizando as combinações de 50; 33; 25 e 0% (v/v de cera de carnaúba e 30; 20; 10 e 0% do FOS (p/v. Durante 25 dias, foram avaliados parâmetros de textura, físicoquímicos e físicos. Os parâmetros de textura avaliados sofreram alterações durante o período do estudo, mas sem evidências de terem sofrido interferência das coberturas aplicadas. As formulações que se mostraram mais promissoras para futuras aplicações comerciais foram dos tratamentos B (50% de cera, 20% de FOS, K (25% de cera, 10% de FOS e L (25% de cera, 0% de FOS.

  16. UVA is the major contributor to the photodegradation of tretinoin and isotretinoin: Implications for development of improved pharmaceutical formulations.

    Tashtoush, Bassam M; Jacobson, Elaine L; Jacobson, Myron K

    2008-03-20

    The chemical stability of tretinoin (RA) and isotretinoin (13RA) in ethanol and dermatological cream preparations exposed to solar simulated light (SSL), UVA, and visible light has been studied. Photostability was monitored by an HPLC method that allowed simultaneous analysis of RA and 13RA, thus allowing photodegradation due to isomerization to other retinoids and photolysis to non-retinoid products to be monitored. Both retinoids undergo both isomerization and photolysis following SSL, UVA and visible light exposure but RA is more sensitive to photodegradation than 13RA. Degradation of both retinoids by photolysis is considerably greater in cream formulations than in ethanol and the photodegradation follows second order kinetics. Rate constants and half-lives for degradation of RA and 13RA in ethanol solution and cream preparations subjected to different light sources are reported. The UVA component of SSL is the major contributor to photodegradation. Since UVA penetrates deeply into skin, our results suggest that photodegradation of RA may contribute to the photosensitivity associated with RA therapy. Our studies suggest that development of improved formulations and the use of effective UVA sunscreens may reduce the side effects of RA therapy. PMID:18093761

  17. UVA Light-excited Kynurenines Oxidize Ascorbate and Modify Lens Proteins through the Formation of Advanced Glycation End Products

    Linetsky, Mikhail; Raghavan, Cibin T.; Johar, Kaid; Fan, Xingjun; Monnier, Vincent M.; Vasavada, Abhay R.; Nagaraj, Ram H.

    2014-01-01

    Advanced glycation end products (AGEs) contribute to lens protein pigmentation and cross-linking during aging and cataract formation. In vitro experiments have shown that ascorbate (ASC) oxidation products can form AGEs in proteins. However, the mechanisms of ASC oxidation and AGE formation in the human lens are poorly understood. Kynurenines are tryptophan oxidation products produced from the indoleamine 2,3-dioxygenase (IDO)-mediated kynurenine pathway and are present in the human lens. This study investigated the ability of UVA light-excited kynurenines to photooxidize ASC and to form AGEs in lens proteins. UVA light-excited kynurenines in both free and protein-bound forms rapidly oxidized ASC, and such oxidation occurred even in the absence of oxygen. High levels of GSH inhibited but did not completely block ASC oxidation. Upon UVA irradiation, pigmented proteins from human cataractous lenses also oxidized ASC. When exposed to UVA light (320–400 nm, 100 milliwatts/cm2, 45 min to 2 h), young human lenses (20–36 years), which contain high levels of free kynurenines, lost a significant portion of their ASC content and accumulated AGEs. A similar formation of AGEs was observed in UVA-irradiated lenses from human IDO/human sodium-dependent vitamin C transporter-2 mice, which contain high levels of kynurenines and ASC. Our data suggest that kynurenine-mediated ASC oxidation followed by AGE formation may be an important mechanism for lens aging and the development of senile cataracts in humans. PMID:24798334

  18. Inhibitory effects of ambient levels of solar UV-A and UV-B radiation on growth of cucumber

    The influence of solar UV-A and UV-B radiation at Beltsville, Maryland, on growth and flavonoid content in four cultivars of Cucumis sativus L. (Ashley, Poinsett, Marketmore, and Salad Bush cucumber) was examined during the summers of 1994 and 1995. Plants were grown from seed in UV exclusion chambers consisting of UV-transmitting Plexiglas, lined with Llumar to exclude UV-A and UV-B, polyester to exclude UV-B, or cellulose acetate to transmit UV-A and UV-B. Despite previously determined differences in sensitivity to supplemental UV-B radiation, all four cultivars responded similarly to UV-B exclusion treatment. After 19–21 days, the four cultivars grown in the absence of solar UV-B (polyester) had an average of 34, 55, and 40% greater biomass of leaves, stems, and roots, respectively, 27% greater stem height, and 35% greater leaf area than those grown under ambient UV-B (cellulose acetate). Plants protected from UV-A radiation as well (Llumar) showed an additional 14 and 22% average increase, respectively, in biomass of leaves and stems, and a 22 and 19% average increase, respectively, in stem elongation and leaf area over those grown under polyester. These findings demonstrate the extreme sensitivity of cucumber not only to present levels of UV-B but also to UV-A and suggest that even small changes in ozone depletion may have important biological consequences for certain plant species. (author)

  19. Pharmacokinetic and biopharmaceutic aspects of some psoralen derivatives used in dermatology

    In the present thesis the pharmacokinetic and biopharmaceutic properties of some psoralen derivatives, that are used in photochemotherapy of dermatological diseases like vitiligo and psoriasis, are studied. Photochemotherapy is a combination of oral administration of one of the psoralen derivatives, 8-methoxypsoralen (8-MOP), 5-methoxypsoralen (5-MOP) or 4, 5', 8-trimethylpsoralen (TMP), and irradiation with long wave ultraviolet light, U.V.-A (320-400 nm), two hours later. This treatment is commonly called PUVA (Psoralen-UV-A). The purpose of the investigation was to develop an 8-MOP dosage form with a fast and reproducible absorption. Various dosage forms of 8-MOP were administered to volunteers and patients and 8-MOP concentrations in body fluids determined. Also the pharmacokinetic properties of 5-MOP and TMP were investigated in a pilot study. (Auth.)

  20. The utility of MAS5 expression summary and detection call algorithms

    Wilson Claire L

    2007-07-01

    Full Text Available Abstract Background Used alone, the MAS5.0 algorithm for generating expression summaries has been criticized for high False Positive rates resulting from exaggerated variance at low intensities. Results Here we show, with replicated cell line data, that, when used alongside detection calls, MAS5 can be both selective and sensitive. A set of differentially expressed transcripts were identified that were found to be changing by MAS5, but unchanging by RMA and GCRMA. Subsequent analysis by real time PCR confirmed these changes. In addition, with the Latin square datasets often used to assess expression summary algorithms, filtered MAS5.0 was found to have performance approaching that of its peers. Conclusion When used alongside detection calls, MAS5 is a sensitive and selective algorithm for identifying differentially expressed genes.

  1. Preventive effects of tamarind seed coat extract on UVA-induced alterations in human skin fibroblasts.

    Phetdee, Khemjira; Rakchai, Racharat; Rattanamanee, Kwanchai; Teaktong, Thanasak; Viyoch, Jarupa

    2014-01-01

    One of the most damaging actions on skin is from solar radiation, particularly from its ultraviolet (UV) component, through the formation of oxidative species. Thus, an antioxidant strategy that prevents the formation of these oxidants could form the basis of an efficacious cutaneous protectant. Many herbal materials contain antioxidant polyphenols, and this study assessed the possibility that tamarind seed coat extract could fulfill this role. An alcoholic extract of the tamarind (Tamarindus indica L.) seed coat showed stronger antioxidant activity (2,2-diphenyl-1-picrylhydrazyl inhibition, EC(50) = 12.9 μg/ml) than L-ascorbic acid (EC(50) = 22.9 μg/ml) and α-tocopherol (EC(50) = 29.3 μg/ml). In cultured fibroblasts taken from human skin, hydrogen peroxide (100-1000 μM) damaged 62-92% of the cells compared to only 35-47% when the cells were preincubated in extract (200 μg/ml) for 24 h. UVA (40 J/cm2) irradiation of human fibroblasts damaged 25% of the cells but the death rate was reduced to 10% with extract. UV irradiation increased the proportion of cells arrest in G(0)/G(1) phase (from 59% to 78%) but this was largely prevented by the extract (64%), according to flow cytometry. Intracellular total glutathione of UVA-irradiated cells pretreated with the extract increased to 10-25% compared to the non-pretreated group at 24-72 h after irradiation. Fibroblasts typically increased matrix metalloproteinase-1 secretion after photodamage, and this is prevented by the extract. This is the first report showing that tamarind seed coat extract is an antioxidant and can protect human skin fibroblasts from cellular damage produced by UVA and thus may form the foundation for an antiaging cosmetic. PMID:24602819

  2. Contrasting patterns of tolerance between chemical and biological insecticides in mosquitoes exposed to UV-A.

    Tetreau, Guillaume; Chandor-Proust, Alexia; Faucon, Frédéric; Stalinski, Renaud; Akhouayri, Idir; Prud'homme, Sophie M; Raveton, Muriel; Reynaud, Stéphane

    2013-09-15

    Mosquitoes are vectors of major human diseases, such as malaria, dengue or yellow fever. Because no efficient treatments or vaccines are available for most of these diseases, control measures rely mainly on reducing mosquito populations by the use of insecticides. Numerous biotic and abiotic factors are known to modulate the efficacy of insecticides used in mosquito control. Mosquito breeding sites vary from opened to high vegetation covered areas leading to a large ultraviolet gradient exposure. This ecological feature may affect the general physiology of the insect, including the resistance status against insecticides. In the context of their contrasted breeding sites, we assessed the impact of low-energetic ultraviolet exposure on mosquito sensitivity to biological and chemical insecticides. We show that several mosquito detoxification enzyme activities (cytochrome P450, glutathione S-transferases, esterases) were increased upon low-energy UV-A exposure. Additionally, five specific genes encoding detoxification enzymes (CYP6BB2, CYP6Z7, CYP6Z8, GSTD4, and GSTE2) previously shown to be involved in resistance to chemical insecticides were found over-transcribed in UV-A exposed mosquitoes, revealed by RT-qPCR experiments. More importantly, toxicological bioassays revealed that UV-exposed mosquitoes were more tolerant to four main chemical insecticide classes (DDT, imidacloprid, permethrin, temephos), whereas the bioinsecticide Bacillus thuringiensis subsp. israelensis (Bti) appeared more toxic. The present article provides the first experimental evidence of the capacity of low-energy UV-A to increase mosquito tolerance to major chemical insecticides. This is also the first time that a metabolic resistance to chemical insecticides is linked to a higher susceptibility to a bioinsecticide. These results support the use of Bti as an efficient alternative to chemical insecticides when a metabolic resistance to chemicals has been developed by mosquitoes. PMID:23911355

  3. The stress caused by nitrite with titanium dioxide nanoparticles under UVA irradiation in human keratinocyte cell

    Highlights: ► Nitrite increased photo-toxicity of nano-TiO2 on human keratinocyte cells in a dose-dependant manner. ► Morphological study suggested the cell death may be mediated by apoptosis inducing factor. ► Protein nitration was generated in the cells, and the most abundant nitrated protein was identified as cystatin-A. ► Tyr35 was the most likely site to be nitrated in cystatin-A. -- Abstract: Our previous work found that in the presence of nitrite, titanium dioxide nanoparticles can cause protein tyrosine nitration under UVA irradiation in vivo. In this paper, the human keratinocyte cells was used as a skin cell model to further study the photo-toxicity of titanium dioxide nanoparticles when nitrite was present. The results showed that nitrite increased the photo-toxicity of titanium dioxide in a dose-dependant manner, and generated protein tyrosine nitration in keratinocyte cells. Morphological study of keratinocyte cells suggested a specific apoptosis mediated by apoptosis inducing factor. It was also found the main target nitrated in cells was cystatin-A, which expressed abundantly in cytoplasm and functioned as a cysteine protease inhibitor. The stress induced by titanium dioxide with nitrite under UVA irradiation in human keratinocyte cells appeared to trigger the apoptosis inducing factor mediated cell death and lose the inhibition of active caspase by cystatin-A. We conclude that nitrite can bring new damage and stress to human keratinocyte cells with titanium dioxide nanoparticles under UVA irradiation.

  4. The generation of hydrogen peroxide by the UVA irradiation of human lens proteins

    The water-insoluble proteins from aged human lens are known to contain protein-bound chromophores that act as UVA sensitizers. The irradiation of a sonication-solubilized, water-insoluble fraction from human lenses (55-75 years) with UVA light (1.5 kJ/cm2, λ > 338nm) caused an oxygen-dependent photolysis of tryptophan, not seen when either α-crystallin or lysozyme were irradiated. The suggested requirement for active oxygen species was consistent with a linear increase in hydrogen peroxide formation, which was also observed. A final concentration of 55 μM H2 O2 was attained, with no H2 O2 being detected in either dark-incubated controls or in irradiated samples of native proteins. The UVA-dependent H2 O2 formation was increased 50% by superoxide dismutase (SOD) and abolished by catalase, arguing for the initial generation of superoxide anion. A linear photolysis of histidine and tryptophan was also seen; however, the addition of SOD or SOD and catalase had no effect on the photolytic destruction of either amino acid. Superoxide dismutase increased the oxidation of protein SH groups implicating H2 O2, but SOD and catalase caused a decrease in SH oxidation only at later time periods. The direct addition of H2 O2 to a water-insoluble sonicate supernatant fraction caused only a slight oxidation of SH groups, but this was increased four- to eight-fold when the protein was denatured in 4.0 M guanidine hydrochloride. (author)

  5. Assessment of cumulative exposure to UVA through study of asymmetric facial skin damage

    Sophie Mac-Mary1

    2010-09-01

    Full Text Available Sophie Mac-Mary1, Jean-Marie Sainthillier1, Adeline Jeudy3, Christelle Sladen2, Cara Williams2, Mike Bell2, Philippe Humbert31Skinexigence SAS, Saint-Jacques University Hospital, Besançon, France; 2The Boots Company, Nottingham, United Kingdom; 3Research and Studies Center on the Integument, Department of Dermatology, Saint-Jacques University Hospital, University of Franche-Comté, Besançon, FranceBackground: Published studies assessing whether asymmetric facial ultraviolet light exposure leads to underlying differences in skin physiology and morphology are only observational. The aim of this study was to assess the visual impact on the skin of repeated ultraviolet-A (UVA exposure through a window.Methods: Eight women and two men presenting with asymmetric signs of photoaging due to overexposure of one side of their face to the sun through a window over a long period of time were enrolled in the study. Split-face biometrologic assessments were performed (clinical scoring, hydration with Corneometer®, mechanical properties with a Cutometer®, transepidermal water loss with AquaFlux®, skin relief with fringe projection, photography, stripping, and then lipid peroxidation analyses.Results: Significant differences were observed in clinical scores for wrinkles, skin roughness assessed by fringe projection on the cheek, and skin heterogeneity assessed with spectrocolorimetry on the cheekbone. Other differences were observed for skin hydration, as well as skin laxity, which tended towards significance.Discussion: This study suggests the potential benefit of daily UVA protection during nondeliberate exposure indoors as well as outside.Keywords: UVA, asymmetry, photodamage, face

  6. AVALIAÇÃO SENSORIAL E COLORIMÉTRICA DE NÉCTAR DE UVA

    Maria Eugênia de Oliveira MAMEDE

    2013-01-01

    Full Text Available Diante da preferência de consumidor pelo néctar de uva e da importância econômica que este tipo de suco tem representado no mercado brasileiro de bebidas não alcoólicas, este trabalho teve como objetivo traçar o perfil sensorial de néctar de uva e obter medidas de parâmetros de cor através de colorímetro. O estudo foi realizado com seis marcas representativas do mercado local. A Análise Descritiva Quantitativa (ADQ, teste de aceitação e Intenção de compra foram as metodologias sensoriais utilizadas no estudo. O espaço de cor utilizado foi o CIELAB utilizando colorímetro portátil Konica Minolta. As amostras A, B e E foram caracterizadas principalmente por atributos como cor vinho, brilho, aroma característico de uva, entre outros, enquanto que as amostras C, D e F foram caracterizadas por atributos como: turvo, cor marrom, aroma de fruta cozida, gosto ácido, entre outros. A amostra E obteve a maior mé- dia para cor vinho (6,16 e a amostra D teve as maiores mé- dias para cor marrom (6,61 e aroma de fruta cozida (4,07. A amostra E alcançou média de aceitação para cor igual a 6,2, enquanto que a amostra D apresentou a menor aceita- ção de cor (3.8 e sabor (4.1. Os resultados indicam que os atributos cor vinho cor marrom e aroma de fruta cozida podem ser determinantes na escolha do consumidor para a compra. A análise física da cor mostrou ser uma medida indicativa de padrão de qualidade da cor de néctar de uva.

  7. The selects of bearberry (Arctostaphylos uva-ursi (l. spreng. from natural populations in Poland

    Hanna Malinowska

    2014-02-01

    Full Text Available Five plants of bearberry selected from natural stands in Poland and one from a Botanical Garden were propagated by cuttings. The clonal plants were first kept under observation for two years planted on different substrates in containers and were afterwards field cultivated for three subsequent years. The existence of a significant differentiation within these Arctostaphylos uva-ursi clones was proved. Two selects of good ornamental features as well as with high concentration of medicinal substance - arbutin were chosen. Plants started fruiting in the fourth year of growth and the area covered by a single plant exceeded 2 m2 after five years of cultivation.

  8. Assessment of extracts of Helichrysum arenarium, Crataegus monogyna, Sambucus nigra in photoprotective UVA and UVB; photostability in cosmetic emulsions.

    Jarzycka, Anna; Lewińska, Agnieszka; Gancarz, Roman; Wilk, Kazimiera A

    2013-11-01

    The aim of our study was to investigate the photoprotective activity and photostability efficacy of sunscreen formulations containing Helichrysum arenarium, Sambucus nigra, Crataegus monogyna extracts and their combination. UV transmission of the emulsion films was performed by using diffuse transmittance measurements coupling to an integrating sphere. In vitro photoprotection and photostability efficacy were evaluated according to the following parameters: sun protection factor (SPF), UVA protection factor (PF-UVA), UVA/UVB ratio and critical wavelength (λc) before and after UV irradiation. The results obtained show that the formulations containing polyphenols fulfill the official requirements for sunscreen products due to their broad spectrum of UV protection combined with their high photostability and remarkable antioxidant properties. Therefore H. arenarium, S. nigra, C. monogyna extracts represent useful additives for cosmetic formulation. PMID:24007865

  9. A maturação fenólica em uvas tintas: comparação de metodologias

    Correia, Pedro Tiago Relvas

    2014-01-01

    A maturação fenólica em uvas tintas é uma importante ferramenta de ajuda na decisão de vindima. Com o presente trabalho pretende-se estudar uma nova metodologia de avaliação de parâmetros relacionados com a maturação fenólica das uvas tintas, em comparação com metodologias mais habituais. Neste contexto a maturação fenólica de uvas foi avaliada através de espectrofotometria de refletância difusa e através dos métodos de bancada e dos métodos baseados em espectrofotometria de infra vermelho...

  10. Chronic exposure to Rhodobacter sphaeroides extract Lycogen™ prevents UVA-induced malondialdehyde accumulation and procollagen I down-regulation in human dermal fibroblasts.

    Yang, Tsai-Hsiu; Lai, Ying-Hsiu; Lin, Tsuey-Pin; Liu, Wen-Sheng; Kuan, Li-Chun; Liu, Chia-Chyuan

    2014-01-01

    UVA contributes to the pathogenesis of skin aging by downregulation of procollagen I content and induction of matrix metalloproteinase (MMP)-associated responses. Application of antioxidants such as lycopene has been demonstrated as a convenient way to achieve protection against skin aging. Lycogen™, derived from the extracts of Rhodobacter sphaeroides, exerts several biological effects similar to that of lycopene whereas most of its anti-aging efficacy remains uncertain. In this study, we attempted to examine whether Lycogen™ could suppress malondialdehyde (MDA) accumulation and restore downregulated procollagen I expression induced by UVA exposure. In human dermal fibroblasts Hs68 cells, UVA repressed cell viability and decreased procollagen I protein content accompanied with the induction of MMP-1 and MDA accumulation. Remarkably, incubation with 50 µM Lycogen™ for 24 h ameliorated UVA-induced cell death and restored UVA-induced downregulation of procollagen in a dose-related manner. Lycogen™ treatment also prevented the UVA-induced MMP-1 upregulation and intracellular MDA generation in Hs68 cells. Activation of NFκB levels, one of the downstream events induced by UVA irradiation and MMP-1 induction, were also prevented by Lycogen™ administration. Taken together, our findings demonstrate that Lycogen™ may be an alternative agent that prevents UVA-induced skin aging and could be used in cosmetic and pharmaceutical applications. PMID:24463291

  11. On the induction of protective responses in Salmonella typhimurium strain TA1535/pSK1002 by UVA (365 nm)

    Exposure to UVA (365 nm) led to growth delay, loss of viability and inhibition of 3H-thymidine incorporation into the cells of Salmonella typhimurium strain TA1535 containing multiple copies of a plasmid pSK1002 carrying a umuC'-'lacZ fusion gene. Ultraviolet-A induced umu gene expression, as monitored by the estimation of β-galactosidase, in a linear fluence-dependent manner. The induction of umu gene expression increased with the increase of postirradiation incubation period of the cells in the LB-ampicillin (LBA) medium at 37oC and leveled off from 2 h onward. The induction of gene expression depended on concomitant protein synthesis and represented the induction of the SOS response in the particular S. typhimurium cells used. The exposure to low fluences (sublethal) of UVA also led to the induction of an adaptive response in the same bacterial cells, which made them resistant to subsequent challenge by a much higher fluence of the same radiation. The adaptive response, as monitored by the assays of viability and β-galactosidase units, increased with the period of exposure to sublethal fluences of UVA, attained a maximum at the UVA exposure of 4.5 kJ/m2 (15 min) and thereafter gradually decreased with further increase of UVA exposure period. Modulation studies involving D2O, LBA growth medium, different scavengers of free radicals and quenchers of activated oxygen species indicated the involvement of both hydroxyl free radicals and singlet oxygen in the UVA-induced umu gene expression. (author)

  12. Monitorización molecular de la ecología levaduriforme de la uva al vino

    López Enríquez, Lorena

    2015-01-01

    La calidad y singularidad de un vino están estrechamente relacionadas con las poblaciones de levaduras asociadas al proceso de transformación desde la uva al vino. El principal objetivo de este trabajo ha sido el estudio de la sucesión natural de especies de levaduras propio de un proceso de vinificación, realizado mediante fermentación espontánea, a partir de uva de variedad Verdejo, recolectada de una parcela de orientación sur, localizada en la D. O. Rueda. Para ello, se ana...

  13. Chronic low-dose UVA irradiation induces local suppression of contact hypersensitivity, Langerhans cell depletion and suppressor cell activation in C3H/HeJ mice

    It has previously been demonstrated that chronic low-dose solar-simulated UV radiation could induce both local and systemic immunosuppression as well as tolerance to a topically applied hapten. In this study, we have used a chronic low-dose UV-irradiation protocol to investigate the effects of UVA on the skin immune system of C3H/HeJ mice. Irradiation with UVA+B significantly suppressed the local and systemic primary contact hypersensitivity (CHS) response to the hapten 2,4,6-trinitrochlorobenzene. Furthermore, UVA+B reduced Langerhans cell (LC) and dendritic epidermal T cell (DETC) densities in chronically UV-irradiated mice. Ultraviolet A irradiation induced local, but not systemic, immunosuppression and reduced LC (32%) but not DETC from the epidermis compared to the shaved control animals. Treatment of mice with both UVA+B and UVA radiation also induced an impaired secondary CHS response, and this tolerance was transferable with spleen cells. (Author)

  14. Sealed rotors for in situ high temperature high pressure MAS NMR

    Hu, Jian Z. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hu, Mary Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhao, Zhenchao [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Xu, Souchang [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Vjunov, Aleksei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shi, Hui [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Camaioni, Donald M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Peden, Charles H. F. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lercher, Johannes A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-07-06

    Magic angle spinning (MAS) nuclear magnetic resonance (NMR) investigations on heterogeneous samples containing solids, semi-solids, liquid and gases or a mixture of them under non-conventional conditions of a combined high pressure and high temperature, or cold temperature suffer from the unavailability of a perfectly sealed rotor. Here, we report the design of reusable and perfectly-sealed all-zircornia MAS rotors. The rotors are easy to use and are suitable for operation temperatures from below 0 to 250 °C and pressures up to 100 bar. As an example of potential applications we performed in situ MAS NMR investigations of AlPO₄-5 molecular sieve crystallization, a kinetic study of the cyclohexanol dehydration reaction using 13C MAS NMR, and an investigation of the metabolomics of intact biological tissue at low temperature using 1H HR-MAS NMR spectroscopy. The in situ MAS NMR experiments performed using the reported rotors allowed reproduction of the results from traditional batch reactions, while offering more detailed quantitative information at the molecular level, as demonstrated for the molecular sieve synthesis and activation energy measurements for cyclohexanol dehydration. The perfectly sealed rotor also shows promising application for metabolomics studies using 1H HR-MAS NMR.

  15. UVA photolysis using the protein-bound sensitizers present in human lens

    This research was undertaken to demonstrate that the protein-bound chromophores in aged human lens can act as sensitizers for protein damage by UVA light. The water-insoluble (WI) proteins from pooled human and bovine lenses were solubilized by sonication in water and illuminated with UV light similar in output to that transmitted by the cornea. Analysis of the irradiated proteins showed a linear decrease in sulfhydryl groups with a 30% loss after 2 h. No loss was seen when native α-crystallin was irradiated under the same conditions. A 25% loss of histidine residues was also observed with the human lens WI fraction, and sodium dodecyl sulfate polyacrylamide gels indicated considerable protein cross-linking. Similar photodamage was seen with a WI fraction from old bovine lenses. While the data show the presence of UVA sensitizers, some histidine destruction and protein cross-linking were also obtained with α-crystallin and with lysozyme which argue that part of the histidine loss in the human WISS was likely due to tryptophan acting as a sensitizer. (Author)

  16. UVA photolysis using the protein-bound sensitizers present in human lens

    Ortwerth, B.J.; Olesen, P.R. (Missouri Univ., Columbia, MO (United States). Mason Inst. of Ophthalmology)

    1994-07-01

    This research was undertaken to demonstrate that the protein-bound chromophores in aged human lens can act as sensitizers for protein damage by UVA light. The water-insoluble (WI) proteins from pooled human and bovine lenses were solubilized by sonication in water and illuminated with UV light similar in output to that transmitted by the cornea. Analysis of the irradiated proteins showed a linear decrease in sulfhydryl groups with a 30% loss after 2 h. No loss was seen when native [alpha]-crystallin was irradiated under the same conditions. A 25% loss of histidine residues was also observed with the human lens WI fraction, and sodium dodecyl sulfate polyacrylamide gels indicated considerable protein cross-linking. Similar photodamage was seen with a WI fraction from old bovine lenses. While the data show the presence of UVA sensitizers, some histidine destruction and protein cross-linking were also obtained with [alpha]-crystallin and with lysozyme which argue that part of the histidine loss in the human WISS was likely due to tryptophan acting as a sensitizer. (Author).

  17. Ascorbic acid glycation of lens proteins produces UVA sensitizers similar to those in human lens

    Soluble calf lens proteins were extensively glycated during a 4 week incubation with ascorbic acid in the presence of oxygen. Amino acids analysis of the dialyzed proteins removed at weekly intervals showed an increasing loss of lysine, arginine and histidine, consistent with the extensive protein cross-linking observed. Irradiation of the dialyzed samples with UVA light (1.0 kJ/cm2 total illumination through a 338 nm cutoff filter) caused an increasing loss of tryptophan, an additional loss of histidine and the production of micromolar concentrations of hydrogen peroxide. No alteration in amino acid content and no photolytic effects were seen in proteins incubated without ascorbic acid in proteins incubated with glucose for 4 weeks. The rate of hydrogen peroxide formation was linear with each glycated sample with a maximum production of 25 nmol/mg protein illuminated. The possibility that the sensitizer activity was due to an ascorbate-induced oxidation of tryptophan was eliminated by the presence of a heavy metal ion chelator during the incubation and by showing equivalent effects with ascorbate-incubated ribonuclease A, which is devoid of tryptophan. The ascorbate-incubated samples displayed increasing absorbance at wavelengths above 300 nm and increasing fluorescence (340/430) as glycation proceeded. The spectra of the 4 week glycated proteins were identical to those obtained with a solubilized water-insoluble fraction from human lens, which is known to have UVA sensitizer activity. (Author)

  18. Mas-Colell, Whinston and Green Versus Scitovsky on Profit and Utility Maximization

    Ormazabal Sánchez, Kepa Mirena

    2005-01-01

    I contrast the theoretical foundation of profit maximization of Mas-Colell, Whinston and Green’s “Microeconomics” against that provided by Scitovsky in a paper of 1943. Whereas Mas-Colell, Whinston and Green try to show that profit maximization can be derived from utility maximization, Scitovsky categorically states the contrary view. I argue, first, that the foundation provided by Mas-Colell, Whinston and Green is not sound and, secondly, that Scitovsky’s line of reasoning opens a better way...

  19. A New Algebraic Modelling Approach to Distributed Problem-Solving in MAS

    帅典勋; 邓志东

    2002-01-01

    This paper is devoted to a new algebraic modelling approach to distributed problem-solving in multi-agent systems (MAS), which is featured by a unified framework for describing and treating social behaviors, social dynamics and social intelligence. A conceptual architecture of algebraic modelling is presented. The algebraic modelling of typical social behaviors, social situation and social dynamics is discussed in the context of distributed problemsolving in MAS. The comparison and simulation on distributed task allocations and resource assignments in MAS show more advantages of the algebraic approach than other conventional methods.

  20. Antimicrobial susceptibility of photodynamic therapy (UVA/riboflavin against Staphylococcus aureus Suscetibilidade antimicrobiana da terapia fotodinâmica (UVA/riboflavina contra Staphylococcus aureus

    Renata Tiemi Kashiwabuchi

    2012-12-01

    Full Text Available PURPOSE: To assess S. aureus in vitro viability after the exposure to ultraviolet light A (UVA and riboflavin (B2. METHODS: Samples of S. aureus in 96 well plates (in triplicate were exposed to riboflavin (B2 and ultraviolet light A (365 nm wavelength at a power density of 3 mW/cm², 8 mm spot diameter, for 30 minutes. Control groups were prepared as well in triplicate: blank control, ultraviolet light A only, riboflavin only and dead bacteria Control. The bacterial viability was measured using fluorescent microscopy. In order to investigate the occurrence of "viable but non-culturable" microorganisms after treatment, the cell viability was also investigated by plate culture procedure onto a broth medium. Statistical analysis was performed using the triplicate values from each experimental condition. RESULTS: No difference was observed among the treatment group and the control samples (p=1. CONCLUSION: The combination of riboflavin 0.1% and ultraviolet light A at 365 nm did not exhibit antimicrobial activity against oxacillin susceptible S. aureus.OBJETIVO: Avaliar a viabilidade celular de S. aureus in vitro após a exposição de riboflavina (B2 e luz ultravioleta A (UVA. MÉTODOS: Amostras de S. aureus colocadas em uma placa de 96 poços (em triplicata foram expostas a riboflavina 0,1% (B2 e luz ultravioleta (comprimento de onda de 365 nm poder de 3 mW/cm², 8 mm de diâmetro, por 30 minutos. Grupos controles foram também preparados em triplicata: controle branco, somente luz ultravioleta A, somente riboflavina e controle morto. A viabilidade bacteriana foi analisada usando microscópio de fluorescência. Para investigar a ocorrência de micro-organismos "viáveis porem não cultiváveis" a viabilidade celular foi avaliada utilizando-se placas de meio de cultivo bacteriano. Analise estatística foi realizada utilizando-se os valores obtidos em triplicata de cada grupo experimental. RESULTADOS: Nenhuma diferença foi observada entre o grupo

  1. The effect of FF-MAS on porcine cumulus-oocyte complex maturation, fertilization and pronucleus formation in vitro

    Færge, Inger; Strejcek, Frantisek; Laurincik, Jozef;

    2006-01-01

    Follicular fluid meiosis-activating sterol (FF-MAS) has been isolated from the follicular fluid (FF) of several species including man. FF-MAS increases the quality of in vitro oocyte maturation, and thus the developmental potential of oocytes exposed to FF-MAS during in vitro maturaion is improve...

  2. BOREAS Level-1B MAS Imagery At-sensor Radiance, Relative X and Y Coordinates

    Strub, Richard; Strub, Richard; Newcomer, Jeffrey A.; Ungar, Stephen

    2000-01-01

    For BOReal Ecosystem-Atmosphere Study (BOREAS), the MODIS Airborne Simulator (MAS) images, along with the other remotely sensed data, were collected to provide spatially extensive information over the primary study areas. This information includes detailed land cover and biophysical parameter maps such as fraction of Photosynthetically Active Radiation (fPAR) and Leaf Area Index (LAI). Collection of the MAS images occurred over the study areas during the 1994 field campaigns. The level-1b MAS data cover the dates of 21-Jul-1994, 24-Jul-1994, 04-Aug-1994, and 08-Aug-1994. The data are not geographically/geometrically corrected; however, files of relative X and Y coordinates for each image pixel were derived by using the C-130 INS data in a MAS scan model. The data are provided in binary image format files.

  3. Cassini's Maneuver Automation Software (MAS) Process: How to Successfully Command 200 Navigation Maneuvers

    Yang, Genevie Velarde; Mohr, David; Kirby, Charles E.

    2008-01-01

    To keep Cassini on its complex trajectory, more than 200 orbit trim maneuvers (OTMs) have been planned from July 2004 to July 2010. With only a few days between many of these OTMs, the operations process of planning and executing the necessary commands had to be automated. The resulting Maneuver Automation Software (MAS) process minimizes the workforce required for, and maximizes the efficiency of, the maneuver design and uplink activities. The MAS process is a well-organized and logically constructed interface between Cassini's Navigation (NAV), Spacecraft Operations (SCO), and Ground Software teams. Upon delivery of an orbit determination (OD) from NAV, the MAS process can generate a maneuver design and all related uplink and verification products within 30 minutes. To date, all 112 OTMs executed by the Cassini spacecraft have been successful. MAS was even used to successfully design and execute a maneuver while the spacecraft was in safe mode.

  4. Five Board Games for the Language Classroom: Uvas, Montana Rusa, El Futbol, La Corrida de Verbos, Paso a Paso.

    Snyder, Barbara

    A collection of five board games for the Spanish language classroom contains gameboards, game markers, and directions for each game. It also contains general instructions for the teacher about the classroom use of board games. The games include: "Uvas," for use in vocabulary development and cultural awareness; "Montana Rusa," for general…

  5. Effciency and safety of the use of long-wave UVA-1 phototherapy in treatment of psoriasis

    Bakulev A.L.

    2012-06-01

    Full Text Available

     

     

    The effectiveness of the long wavelength ultraviolet therapy (UVA-1 in complex treatment of patients with psoriasis has been studied during the research. There 20 patients with moderately severe and severe psoriasis in the phase of progressive dermatosis have been observed. The therapy was organized using photobox Waldmann UV-7001K (Herbert Waldmann GmbH & Co, Germany and F85 100W-TL10R lamps, creating radiation spectrum of UVA-1 (ƛ = 340 – 400 nm and emission maximum was ƛ=370 nm. 20 patients of the comparison group receive standard therapy in combination with PUVA therapy. The group did not differ from the main group of patients in age, duration and form of the disease. The effectiveness of the treatment was measured according to the dynamic assessment of PASI index. The usage of a long wavelength ultraviolet therapy (UVA-1 has caused a reduction of the severity and the extent of skin lesions, gave positive outcomes in all patients of the study. No adverse effects caused by the therapy undertaken have been noted. The administration of long wavelength ultraviolet therapy (UVA-1 is safe and effective in patients with psoriasis.

  6. The ideal table grapes for the Spanish market A uva de mesa ideal para o mercado espanhol

    Cesar Rosso Piva

    2006-08-01

    Full Text Available This paper seeks to explore a survey of consumers in Spain. The survey explores the attributes of quality that consumers are seeking and promotion of grapes via "quality" marks, which are indicators of possible ways to increase demand. The reason consumers are switching to other foods, such as dairy based snacks, is that grapes are not easy to eat, can be unreliable in terms of their quality attributes, and their price more variable. Consumers are also generally unaware of the marks quality currently used.Este trabalho busca explorar o mercado da uva de mesa na Espanha, do ponto de vista do consumidor. O estudo explora os atributos de qualidade que os consumidores estão buscando e a promoção da uva de mesa via marcas de "qualidade" com a possibilidade de incremento de demanda. A importância deste estudo reside na mudança que vem ocorrendo no hábito de consumo de alimentos, onde as frutas e verduras em geral, e a uva de mesa em particular têm perdido espaço para produtos prontos para o consumo, como os derivados lácteos , doces e sobremesas. Em contraste, a uva de mesa não se apresenta pronta para o consumo, possui qualidade de fruta e preços mais variáveis, e o conceito de marca comercial encontra-se ainda pouco estabelecido, ao contrário dos produtos industrializados.

  7. Development of refractoriness of induced human heme oxygenase-1 gene expression to reinduction by UVA irradiation and hemin

    Using primary human fibroblasts we have observed the existence of an acquired refractoriness of the heme oxygenase-1 gene to induction by a second dose of UVA (320-380 nm) radiation. We studied the kinetics of development of refractoriness over a time interval of up to 72 h between the first inducing event and the second (challenge) dose. Complete refractoriness was observed at 48 h. We also studied development of refractoriness after UVA, sodium arsenite and H2O2 treatment in all possible combinations and demonstrated that only UVA led to refractoriness. Ultraviolet radiation induced partial refractoriness to H2O2 induction but did not change the response of sodium arsenite. In an investigation of the mechanism of development of refractories we used the heme oxygenase inhibitor, tin-protoporphyrin IX and showed that induction of heme oxygenases enzymatic activity is a crucial step. However, the induction of ferritin, which is known to play a key role in protection against oxidative stress, did not appear to be involved. Damage to membranes is also probably not involved in the refractoriness mechanism. Because either hemin alone or UVA radiation are able to lead to a refractoriness of the heme oxygenase-1 gene to reinduction by a second exposure to one or the other agent in human fibroblasts we conclude that heme, or an as yet unidentified heme derivative, is involved in the refractoriness response. (Author)

  8. DYNAMO-MAS: a multi-agent system for ontology evolution from text

    Sellami, Zied; Camps, Valérie; Aussenac-Gilles, Nathalie

    2013-01-01

    International audience Manual ontology development and evolution are complex and time-consuming tasks, even when textual documents are used as knowledge sources in addition to human expertise or existing ontologies. Processing natural language in text produces huge amounts of linguistic data that need to be filtered out and structured. To support both of these tasks, we have developed DYNAMO-MAS, an interactive tool based on an adaptive multi-agent system (adaptive MAS or AMAS) that builds...

  9. Efeito da poda verde na composição físico-química do mosto da uva Merlot Effect of summer pruning on the physicochemical composition of the Merlot grape must

    Francisco Mandelli

    2008-09-01

    Full Text Available O manejo do dossel vegetativo da videira pode causar modificações na composição e na qualidade da uva e do vinho. Dentre as práticas culturais utilizadas para essa finalidade, destacam-se as relacionadas à poda verde. Nesse sentido, visando a melhorar a qualidade do mosto da uva Merlot, conduziu-se este experimento com diferentes modalidades de poda verde. O trabalho foi realizado de 1993/1994 a 1996/1997, num vinhedo conduzido em latada. Houve 12 tratamentos e três repetições, sendo o delineamento experimental em blocos casualizados. Os tratamentos constituíram-se da testemunha e de 11 diferentes modalidades de poda verde, i.e., desbrota, desponta e desfolha, algumas delas em diferentes épocas do ciclo vegetativo da videira. Os resultados mostram que houve variação de ano para ano, mas, considerando a média dos quatro anos de avaliação, constatou-se que os tratamentos 10 (desbrota + desponta + desfolha realizada no início da floração e eliminando todas as folhas abaixo dos cachos e 9 (desbrota + desfolha realizada 21 dias antes da colheita e eliminando metade das folhas abaixo dos cachos proporcionaram maior síntese e acúmulo de açúcar na uva, o que é expresso pelo ºBrix e pela densidade, e menor de acidez, expressa pelos ácidos tartárico e málico, pH e acidez titulável. Num segundo plano, mas ainda eficientes, citam-se os tratamentos 11 (desbrota + desponta + desfolha realizada 21 dias antes da colheita e eliminando metade das folhas abaixo dos cachos, 2 (desponta e 3 (desfolha no início da floração e eliminando todas as folhas abaixo dos cachos.Grapevine canopy management can induce modifications in the grape and wine composition and quality, and summer pruning is among the cultural practices used to reach this objective. In this way, an experiment with different types of summer pruning were carried out to improve the quality of Merlot grape must. It was performed from 1993/1994 to 1996/1997 on a vineyard

  10. {sup 29}Si MAS NMR for the zeolite Y - gallium oxide system; {sup 29}Si mas NMR dla ukladu fojazyt-tlenek galu

    Sulikowski, B.; Derewinski, M. [Inst. Katalizy i Fizykochemii Powierzchni, Polska Akademia Nauk, Cracow (Poland); Olejniczak, Z.; Segnowski, S. [Institute of Nuclear Physics, Cracow (Poland)

    1994-12-31

    Wide-pore zeolites modified by gallium oxide has been prepared for catalytic use. Its physico-chemical and catalytic properties have been studied. The structure changes of the catalyst have been investigated by means of MAS NMR spectroscopy. Spectra of {sup 29}Si has been described and discussed. 11 refs, 4 figs, 2 tabs.

  11. Topical pimecrolimus and tacrolimus do not accelerate photocarcinogenesis in hairless mice after UVA or simulated solar radiation.

    Lerche, Catharina M; Philipsen, Peter A; Poulsen, Thomas; Wulf, Hans Christian

    2009-03-01

    Pimecrolimus and tacrolimus are topical calcineurin inhibitors developed specifically for the treatment of atopic eczema. Experience with long-term use of topical calcineurin inhibitors is limited and the risk of rare but serious adverse events remains a concern. We have previously demonstrated the absence of carcinogenic effect of tacrolimus alone and in combination with simulated solar radiation (SSR) on hairless mice. The aim of this study is to determine whether pimecrolimus accelerates photocarcinogenesis in combination with SSR or pimecrolimus and tacrolimus accelerate photocarcinogenesis in combination with UVA. We used 11 groups of 25 hairless female C3.Cg/TifBomTac immunocompetent mice (n = 275). Pimecrolimus cream or tacrolimus ointment was applied on their dorsal skin three times weekly followed by SSR (2, 4, or 6 standard erythema doses, SED) or UVA (25 J/cm(2)) 3-4 h later. This was done up to 365 days in the SSR-treated groups and up to 500 days in the UVA-treated groups. Pimecrolimus did not accelerate the time for development of the first, second or third tumor in any of the groups. Median time to the first tumor was 240 days for the control-2SED group compared with pimecrolimus-2SED group (233 days), control-4SED group (156 days) compared with pimecrolimus-4SED group (163 days) and control-6SED group (162 days) compared with pimecrolimus-6SED group (170 days). Only one mouse in each of the three UVA groups developed a tumor. We conclude that pimecrolimus in combination with SSR and both pimecrolimus and tacrolimus in combination with UVA do not accelerate photocarcinogenesis in hairless mice. PMID:19183401

  12. Authenticity markers in Aglianico, Uva di Troia, Negroamaro and Primitivo grapes.

    Tamborra, Pasquale; Esti, Marco

    2010-02-15

    Aglianico, Negroamaro, Uva di Troia, and Primitivo, non-aromatic red grapes of southern Italy, were analyzed with respect to berry varietal markers, namely anthocyanins, flavonols, hydroxycinnamoyl tartaric acids (HPLC-DAD) and glycosidic aroma precursors (GC-MS) together with shikimic acid (HPLC-UV). In this study, we confirmed that the relative amount of grape glycosidic precursors from various terpene families was a helpful varietal discriminating factor. An additional decisive contribution to varietal differentiation was also provided by shikimic acid, acetylated forms of anthocyanins, cyanidin-3-O-glucoside, trans-caftaric and trans-coutaric acids. A three-dimensional model of principal component analysis was adopted to evidence the study results. PMID:20103166

  13. UVA-UVB photoprotective activity of topical formulations containing Morinda citrifolia extract.

    Serafini, Mairim Russo; Detoni, Cassia Britto; Menezes, Paula dos Passos; Pereira Filho, Rose Nely; Fortes, Vanessa Silveira; Vieira, Maria José Fonseca; Guterres, Sílvia Stanisçuaski; Cavalcanti de Albuquerque Junior, Ricardo Luiz; Araújo, Adriano Antunes de Souza

    2014-01-01

    Exposure to solar radiation, particularly its ultraviolet (UV) component, has a variety of harmful effects on human health. Some of these effects include sunburn cell formations, basal and squamous cell cancers, melanoma, cataracts, photoaging of the skin, and immune suppression. The beneficial photoprotective effects of topical formulations with the extract, Morinda citrifolia, have not been investigated. This present study aims to investigate the potential benefits of M. citrifolia topical application on the dorsal skin of mice, exposed to UVA-UVB light. Using 7 days of treatment, [before (baseline values) and 20 h after UV exposure], the thickness, skin barrier damage (TEWL), erythema, and histological alterations were evaluated. The results showed that the formulations containing the extract protected the skin against UV-induced damage. PMID:25133171

  14. Atributos sensoriais e aceitação de sucos de uva comerciais Sensory attributes and acceptance of commercial grape juices

    Pamella Rio Branco Pontes; Savanna Santos Santiago; Tatiana Nogueira Szabo; Luciana Passos Toledo; Andréa Pittelli Boiago Gollücke

    2010-01-01

    O suco de uva contém compostos fenólicos em quantidades importantes e, portanto, seu consumo é desejável como aporte de substâncias antioxidantes naturais. Os objetivos do estudo foram investigar os atributos sensoriais e avaliar a aceitação de sucos de uva comerciais. Foram analisados três tipos de suco de uva comercializados no Brasil: suco integral, suco concentrado e néctar. Utilizaram-se a Análise Descritiva Quantitativa modificada e o Teste de Aceitação com escala hedônica estruturada d...

  15. Protection against UVA-induced photooxidative damage in mammalian cell lines expressing increased levels of metallothionein

    Metallothionein (MT) is an endogenous low molecular weight protein that is inducible in a variety of eukaryotic cells and has the ability to selectivity bind heavy metal ions such as zinc and the cadmium. Although the exact physiological role of MT is still not understood, there is strong evidence that MT is involved in providing cellular resistance against the damaging effects of heavy metals and in the regulation of intracellular zinc and copper. Recently, it has been demonstrated that MT can scavenge radiation-induced reactive oxygen intermediates in vitro, specifically hydroxyl and superoxide radicals, and because of these observations it has been suggested that MT may provide protection against radiation-induced oxidative stress in vivo. Cell lines expressing increased levels of MT have demonstrated resistance to ionizing radiation, to ultraviolet radiation, and also to various DNA damaging agents including melphalan and cis-diaminedichloroplatinum. It is therefore important to gain some insight into the relationship between cellular MT content and cellular resistance to radiation and other DNA damaging agents. In this study we investigated the role of MT in providing protection against monochromatic 365-nm UVA radiation, which is known to generate intracellular reactive oxygen species that are involved in both DNA damage and cell killing. For this purpose, we used zinc acetate, a potent inducer of MT, to elevate MT levels in V79 Chinese hamster fibroblasts prior to UVA exposure and determined cell survival for uninduced and induced cultures. In order to eliminate any zinc effects other than MT induction, we also isolated and characterized cadmium chloride-resistant clones of V79 cells that have increased steady-state levels of both MT mRNA and protein, and we examined their survival characteristics against 365-nm radiation in the absence of zinc acetate. 14 refs., 3 figs

  16. Synthesis and Photoirradiation of Isomeric Ethylchrysenes by UVA Light Leading to Lipid Peroxidation

    Peter P. Fu

    2007-06-01

    Full Text Available Polycyclic aromatic hydrocarbons (PAHs are widespread genotoxic environmental pollutants. We have recently demonstrated that photoirradiation of PAHs leads to cytotoxicity, DNA damage, and induction of lipid peroxidation. In this paper we report the synthesis of all the six isomeric ethylchrysenes and the study of light-induced lipid peroxidation by these ethylchrysenes. 5-Ethylchrysene was synthesized by reaction of 5-keto-5,6,6a,7,8,9,10,10a-octahydrochrysene with CH3CH2MgBr followed by dehydration catalyzed by p-toluenesulfonic acid and dehydrogenation with DDQ in benzene. 1- and 4-Ethylchrysenes were similarly prepared by reaction of 1-keto-1,2,3,4,5,6-hexahydrochrysene and 4-keto-1,2,3,4-tetrahydrochrysenes, respectively with CH3CH2MgBr followed by dehydration and dehydrogenation. Direct acetylation of chrysene followed by Wolff-Kishner or Clemmensen reduction resulted in the formation of 2-, 3-, and 6-ethylchrysenes in 4%, 16%, and 43% yields, respectively. Photoirradiation of these compounds with 7 and 21 J/cm2 UVA light in the presence of methyl linoleate all resulted in lipid peroxidation. For comparison, photoirradiation of 4-methylchrysene and 5-methylchrysene was similarly conducted. For irradiation at a UVA light dose of 21 J/cm2, the level of induced lipid peroxidation is in the order 4-methylchrysene = 5-methylchrysene = 5-ethylchrysene = 4-ethylchrysene = chrysene > 1-ethylchrysene = 2-ethylchrysene > 3-ethylchrysene > 6-ethylchrysene. Compared with chrysene, these results indicate that the ethyl group at C4 or C5 position either slightly enhances or has no effect on the light-induced lipid peroxidation, while at C1-, C2-, C3-, or C6 position reduces light-induced lipid peroxidation.

  17. UVA Photoirradiation of Halogenated-Polycyclic Aromatic Hydrocarbons Leading to Induction of Lipid Peroxidation

    Peter P. Fu

    2006-06-01

    Full Text Available Since the finding in the 1930s, a large number of polycyclic aromatic hydrocarbons (PAHs of different structures have been tested for potential tumorigenicity. Structure-activity relationships of halo-PAHs have been investigated to determine the regions of a PAH that may be involved in cancer initiation. From these studies, a number of halo-PAHs were found to be tumorigenic in experimental animals. It was not until the 1980s that halo-PAHs were found to be present in the environment, including municipal incinerator fly ash, urban air, coal combustion, soil, snow, automobile exhausts, and tap water. Due to their widespread presence in the environment and their genotoxic activities, including carcinogenicity, many of these compounds may pose a health risk to humans. Although the biological activities, including metabolism, mutagenicity, and carcinogenicity, of halo-PAHs have been studied their phototoxicity and photo-induced biological activity have not been well examined. In this study, we study the photoirradiation of a series of structure-related halo-PAHs by UVA light in the presence of a lipid, methyl linoleate, and determine as to whether or not these compounds can induce lipid peroxidation. The halo-PAHs chosen for study include 2-bromonaphthalene, 1-chloroanthracene, 9,10-dibromoanthracene, 9-chlorophenanthrene, 9-bromophenanthrene, 7-chlorobenz[a]anthracene, 7-bromobenz[a]anthracene, 7-bromo-5-methylbenz[a]anthracene, 6-chlorobenzo[a]pyrene, and 6-bromobenzo[a]pyrene. The results indicate that upon photoirradiation by UVA all these compounds induced lipid peroxidation at different levels. These results suggest that halo-PAHs may be harmful to human health.

  18. A software framework for analysing solid-state MAS NMR data

    Stevens, Tim J.; Fogh, Rasmus H.; Boucher, Wayne [University of Cambridge, Department of Biochemistry (United Kingdom); Higman, Victoria A. [University of Oxford, Department of Biochemistry (United Kingdom); Eisenmenger, Frank; Bardiaux, Benjamin; Rossum, Barth-Jan van; Oschkinat, Hartmut [Leibniz-Institut fuer Molekulare Pharmakologie, Department of Structural Biology (Germany); Laue, Ernest D., E-mail: e.d.laue@bioc.cam.ac.uk [University of Cambridge, Department of Biochemistry (United Kingdom)

    2011-12-15

    Solid-state magic-angle-spinning (MAS) NMR of proteins has undergone many rapid methodological developments in recent years, enabling detailed studies of protein structure, function and dynamics. Software development, however, has not kept pace with these advances and data analysis is mostly performed using tools developed for solution NMR which do not directly address solid-state specific issues. Here we present additions to the CcpNmr Analysis software package which enable easier identification of spinning side bands, straightforward analysis of double quantum spectra, automatic consideration of non-uniform labelling schemes, as well as extension of other existing features to the needs of solid-state MAS data. To underpin this, we have updated and extended the CCPN data model and experiment descriptions to include transfer types and nomenclature appropriate for solid-state NMR experiments, as well as a set of experiment prototypes covering the experiments commonly employed by solid-sate MAS protein NMR spectroscopists. This work not only improves solid-state MAS NMR data analysis but provides a platform for anyone who uses the CCPN data model for programming, data transfer, or data archival involving solid-state MAS NMR data.

  19. A software framework for analysing solid-state MAS NMR data.

    Stevens, Tim J; Fogh, Rasmus H; Boucher, Wayne; Higman, Victoria A; Eisenmenger, Frank; Bardiaux, Benjamin; van Rossum, Barth-Jan; Oschkinat, Hartmut; Laue, Ernest D

    2011-12-01

    Solid-state magic-angle-spinning (MAS) NMR of proteins has undergone many rapid methodological developments in recent years, enabling detailed studies of protein structure, function and dynamics. Software development, however, has not kept pace with these advances and data analysis is mostly performed using tools developed for solution NMR which do not directly address solid-state specific issues. Here we present additions to the CcpNmr Analysis software package which enable easier identification of spinning side bands, straightforward analysis of double quantum spectra, automatic consideration of non-uniform labelling schemes, as well as extension of other existing features to the needs of solid-state MAS data. To underpin this, we have updated and extended the CCPN data model and experiment descriptions to include transfer types and nomenclature appropriate for solid-state NMR experiments, as well as a set of experiment prototypes covering the experiments commonly employed by solid-sate MAS protein NMR spectroscopists. This work not only improves solid-state MAS NMR data analysis but provides a platform for anyone who uses the CCPN data model for programming, data transfer, or data archival involving solid-state MAS NMR data. PMID:21953355

  20. A software framework for analysing solid-state MAS NMR data

    Solid-state magic-angle-spinning (MAS) NMR of proteins has undergone many rapid methodological developments in recent years, enabling detailed studies of protein structure, function and dynamics. Software development, however, has not kept pace with these advances and data analysis is mostly performed using tools developed for solution NMR which do not directly address solid-state specific issues. Here we present additions to the CcpNmr Analysis software package which enable easier identification of spinning side bands, straightforward analysis of double quantum spectra, automatic consideration of non-uniform labelling schemes, as well as extension of other existing features to the needs of solid-state MAS data. To underpin this, we have updated and extended the CCPN data model and experiment descriptions to include transfer types and nomenclature appropriate for solid-state NMR experiments, as well as a set of experiment prototypes covering the experiments commonly employed by solid-sate MAS protein NMR spectroscopists. This work not only improves solid-state MAS NMR data analysis but provides a platform for anyone who uses the CCPN data model for programming, data transfer, or data archival involving solid-state MAS NMR data.

  1. The development of the ProMAS: a Probabilistic Medication Adherence Scale

    Kleppe M

    2015-03-01

    Full Text Available Mieke Kleppe,1,2 Joyca Lacroix,2 Jaap Ham,1 Cees Midden1 1Human Technology Interaction, Eindhoven University of Technology, Eindhoven, the Netherlands; 2Behavior, Cognition and Perception, Philips Research, Eindhoven, the Netherlands Abstract: Current self-report medication adherence measures often provide heavily skewed results with limited variance, suggesting that most participants are highly adherent. This contrasts with findings from objective adherence measures. We argue that one of the main limitations of these self-report measures is the limited range covered by the behaviors assessed. That is, the items do not match the adherence behaviors that people perform, resulting in a ceiling effect. In this paper, we present a new self-reported medication adherence scale based on the Rasch model approach (the ProMAS, which covers a wide range of adherence behaviors. The ProMAS was tested with 370 elderly receiving medication for chronic conditions. The results indicated that the ProMAS provided adherence scores with sufficient fit to the Rasch model. Furthermore, the ProMAS covered a wider range of adherence behaviors compared to the widely used Medication Adherence Report Scale (MARS instrument, resulting in more variance and less skewness in adherence scores. We conclude that the ProMAS is more capable of discriminating between people with different adherence rates than the MARS. Keywords: questionnaire design, probabilistic models, methodology

  2. The effects of UVA irradiation on the metabolism of type I collagen and glycosaminoglycans by human dermal fibroblasts in three dimensional culture

    We studied the production of type I collagen and glycosaminoglycans by human dermal fibroblasts derived from young and old individuals after UVA irradiation. In these experiments, we introduced a new three-dimensional culture system supplemented with L-ascorbic acid 2-phosphate. In fibroblasts from old individuals (n=3), the amount of collagens in the cell layer was significantly decreased and matrix metallproteinase-1 (MMP-1) activity in the supernatant was significantly elevated after UVA irradiation, while the amounts of glycosaminoglycans in the cell layer and stromelysin-1 (MMP-3) activity showed no significant changes. In contrast, there were no significant changes after UVA irradiation of fibroblasts from young individuals (n=3). These results suggest that the donor age of dermal fibroblasts may be crucial to investigating the metabolism of type I collagen after UVA irradiation. (author)

  3. Residue specific hydration of primary cell wall potato pectin identified by solid-state 13C single-pulse MAS and CP/MAS NMR spectroscopy.

    Larsen, Flemming H; Byg, Inge; Damager, Iben; Diaz, Jerome; Engelsen, Søren B; Ulvskov, Peter

    2011-05-01

    Hydration of rhamnogalacturonan-I (RG-I) derived from potato cell wall was analyzed by (13)C single-pulse (SP) magic-angle-spinning (MAS) and (13)C cross-polarization (CP) MAS nuclear magnetic resonance (NMR) and supported by (2)H SP/MAS NMR experiments. The study shows that the arabinan side chains hydrate more readily than the galactan side chains and suggests that the overall hydration properties can be controlled by modifying the ratio of these side chains. Enzymatic modification of native (NA) RG-I provided samples with reduced content of arabinan (sample DA), galactan (sample DG), or both side chains (sample DB). Results of these samples suggested that hydration properties were determined by the length and character of the side chains. NA and DA exhibited similar hydration characteristics, whereas DG and DB were difficult to hydrate because of the less hydrophilic properties of the rhamnose-galacturonic acid (Rha-GalA) backbone in RG-I. Potential food ingredient uses of RG-I by tailoring of its structure are discussed. PMID:21462966

  4. Brazilian green propolis water extract up-regulates the early expression level of HO-1 and accelerates Nrf2 after UVA irradiation

    SAITO,Yuichi; Tsuruma, Kazuhiro; Ichihara, Kenji; Shimazawa, Masamitsu; Hara, Hideaki

    2015-01-01

    Background Exposure to ultraviolet A (UVA) irradiation is the major cause of human skin aging. Suppression of UVA irradiation-induced skin fibroblast cell damage protects the skin against aging. An oxidative stress response transcription factor nuclear factor-(erythroid-derived 2)-related factor 2 (Nrf2) has an important role as a cytoprotective system against oxidative stress in the human skin and other organs. Propolis has been commonly used as a traditional medicine since ancient times. Th...

  5. Influence of Seed pre-treatment by UV-A and UV-C radiation on germination and growth of Mung beans

    *N. Hamid

    2011-12-01

    Full Text Available The consequence of pre-treatment of UV-A (366 nm and UV-C (254 nm radiation on seed germination and growth of Vigna radiata was investigated at three different exposure period (2, 4 and 6 hours. Supplementation of UV-A enhanced the germination rate, specific leaf area, root and shoot length and dry weight than the UV-C supplemented plants.

  6. Technology Enhanced Learning for People with Intellectual Disabilities and Cerebral Paralysis: The MAS Platform

    Colomo-Palacios, Ricardo; Paniagua-Martín, Fernando; García-Crespo, Ángel; Ruiz-Mezcua, Belén

    Education for students with disabilities now takes place in a wide range of settings, thus, including a wider range of assistive tools. As a result of this, one of the most interesting application domains of technology enhanced learning is related to the adoption of learning technologies and designs for people with disabilities. Following this unstoppable trend, this paper presents MAS, a software platform aimed to help people with severe intellectual disabilities and cerebral paralysis in their learning processes. MAS, as a technology enhanced learning platform, provides several tools that supports learning and monitoring for people with special needs, including adaptative games, data processing and monitoring tools. Installed in a special needs education institution in Madrid, Spain, MAS provides special educators with a tool that improved students education processes.

  7. Role of Fapy glycosylase and UvrABC excinuclease in the repair of UVA (320-400 nm)-mediated DNA damage in Escherichia coli

    In contrast to the damage caused by far-UV, the damage caused by UVA (320-400 nm) is largely oxygen dependent, suggesting near-UV-mediated DNA damage involves reactive oxygen species. The DNA repair enzymes that recognize oxidized bases may, therefore, be an important part of the cell's near-UV defense repertoire. To evaluate the relative importance of Fpg (Fapy) glycosy-lase (an enzyme known to remove oxidized bases) and the DNA damage-inducible UvrABC excinuclease in recovery from near-UV-induced stress, we have constructed fpg- and uvrA-derivatives of Escherichia coli and tested the response (survival) of these strains to both UVA and far-UV radiation. Relative to control strains, the fpg- derivatives were found to be consistently more sensitive to the lethal effects of UVA, but not far-UV radiation. In contrast, uvrA- mutants were more sensitive than control strains to both UVA and far-UV radiation. Thymine dimers, known to be produced by far-UV and corrected by UvrABC, were not generated by the UVA fluences used in this study, suggesting that some other UVA-induced lesion(s) is recognized and repaired by this excinuclease. (Author)

  8. Effects of in vitro UVA irradiation and PUVA treatment on membrane fatty acids and activities of antioxidant enzymes in human keratinocytes

    Human Keratinocytes (NCTC 2544) in culture were exposed to either plain ultraviolet A (UVA) irradiation or to 8-methoxypsoralen plus UVA (PUVA) treatment. Lipid peroxidation, activities of antioxidant enzymes, and percentage amounts of 14C-arachidonic acid in various cellular lipid subclasses and in the culture medium were measured. Both UVA irradiation and PUVA treatment induced significant changes in the distribution of arachidonic acid and increased the liberation of arachidonic acid from membrane phospholipids. At 24 h after either UVA irradiation or PUVA treatment the formation of thiobarbituric acid reactive material was significantly increased, whereas the amount of conjugated dienes was unaffected. The activities of the antioxidant enzymes, catalase and superoxide dismutase, were already significantly decreased at 0.5 h after UVA irradiation or PUVA treatment. The enzyme activities were partially restored during the following 24 h incubation. From the present study, we suggest that in keratinocytes both plain UVA irradiation and PUVA treatment induce changes in the distribution of membrane fatty acids and cause an impairment in the enzymic defense system against oxidative stress

  9. Control of skin infections by a combined action of ultraviolet A (from sun or UVA lamp) and hydrogen peroxide (HUVA therapy), with special emphasis on leprosy.

    Ahmad, S I

    2001-10-01

    Despite its abundance and certain therapeutic value, the importance of sunlight in the treatment of infectious skin diseases has not been fully exploited. One reason is that a sufficient amount of the damaging components of sunlight (UVC and most UVB) cannot reach us and the band of UV that can reach (UVA) is a poor inactivator of living cells. UVA, however, can be deleterious to cells in the presence of sensitizers and a number of biological and chemical sensitizers have been identified which can inactivate microbes in the presence of UVA. Of several known agents, I have selected hydrogen peroxide (H(2)O(2)) as a UVA sensitizer and propose that a combined action of H(2)O(2)and UVA (HUVA therapy) can be utilized in controlling skin infections of various types. Of particular interest is infection by Mycobacterium leprae, which is known to affect many millions of humans globally. H(2)O(2)being relatively cheap (and UVA from the sun being free) the cost of application, particularly in third-world countries where leprosy is more common, would be low and therefore the treatment can be employed on a wide scale. A further reason for proposing the use of H(2)O(2)is that, out of several agents we have tested, this was found to be the most potent; it is also easily able to reach target sites, very cheap, relatively safe and there is no known microbial resistance to HUVA. PMID:11601875

  10. Puesta a punto del método de PCR en tiempo real para la cuantificación de Aspergillus carbonarius en uvas Vitis vinifera cv. Tannat

    Gustavo Garmendia

    2011-12-01

    Full Text Available La ocratoxina A (OTA es una micotoxina que ha sido detectada en uvas y vinos. Es producida por Aspergillus ochraceus, Penicillium verrucosum, Aspergillus carbonarius y especies pertenecientes al agregado Aspergillus niger. En los últimos años se ha descrito la presencia de Aspergillus aculeatus y Aspergillus japonicus en la superficie de uvas y su capacidad de producir OTA. A pesar de que la concentración detectada de cepas pertenecientes a la Sección Nigri fue < 100/g de uva, se han aislado, identificado y caracterizado 56 cepas de Aspergillus pertenecientes a la Sección Nigri. El 51 % fue identificado como A. niger, el 39 % como A. japonicus, 5 % como A. tubingensis -like y 5 % como A. foetidus. Ninguna cepa de A. carbonarius fue aislada. Debido a que esta especie ha sido descrita como la principal responsable de la presencia de OTA en uvas y vinos por su capacidad de producir altas concentraciones de OTA, se requiere un método más sensible que los métodos convencionales para detectar y cuantificar la presencia de A. carbonarius en uva. En este trabajo se optimizó la técnica de PCR en tiempo real para la detección y cuantificación de esta especie en uvas d e la variedad Tannat.

  11. Endogenous glutathione protects human skin fibroblasts against the cytotoxic action of UVB, UVA and near-visible radiations

    Both the UVB (290-320 nm) and UVA (320-380 nm) regions of sunlight damage human skin cells but, particularly at the longer wavelengths, information is scant concerning the mechanism(s) of damage induction and the roles of cellular defense mechanisms. Following extensive glutathione depletion of cultured human skin fibroblasts, the cells become strongly sensitized to the cytotoxic action of near-visible (405 nm), UVA (334 nm, 365 nm) and UVB (313 nm) but not UVC (254 nm) radiations. In the critical UVB region, the magnitude of the protection afforded by endogenous glutathione approaches that of the protection provided by excision repair. The results suggest that a significant fraction of even UVB damage can be mediated by free radical attack and that a major role of glutathione in human skin cells is to protect them from the cytotoxic action of sunlight. (author)

  12. The behaviour of the endocrinological parameters cortisol, testosterone, growth hormone and prolactin after UVA and UVB whole-body irradiation

    With two groups, each with 8 healthy subjects UV whole-body irradiation was carried out with uniformly 30 J/cm2 UVA or respectively UVB at the level of the individual minimal erythema dose. Every subject received serial irradiations once a day for four days. The determination of the serum hormone level was accomplished by means of radioimmunoassays. The results show a weakly significant decline of cortisol 4 and 24 hours after 2 serial UVB irradiations. 3,5 and 7 days after the end of the irradiation series the cortisol values have increased, but by the seventh day statistically only weakly significant. With UVA irradiation there was also a weakly significant increase in cortisol levels three days after the end of the irradiation series. The serum levels of the other hormones showed no statistically significant changes. (orig./MG)

  13. Desenvolvimento de biocompósitos com base das fibras de engaço de uva

    Ferreira, Teresa Alexandra Marques Couto

    2010-01-01

    O sector vitivinícola em Portugal é uma actividade em franca expansão onde os produtos da vinificação de natureza lenhocelulósica surgem como matéria-prima para a obtenção de produtos de maior valor económico. O principal objectivo deste trabalho é a utilização do engaço de uva como uma fonte de novos materiais, desenvolvendo biocompósitos com base em fibras obtidas do engaço utilizando várias resinas sintéticas. A composição química do engaço de uva revelou-nos que o componente polimérico ma...

  14. Learning by observing: information spillovers in the execution and valuation of commercial bank M&As

    Gayle DeLong; Robert DeYoung

    2004-01-01

    We hypothesize that banks become better able to manage acquisitions, and investors become better able to value those acquisitions, as these parties ‘learn-by-observing’ information that spills-over from previous bank M&As. We find evidence consistent with these hypotheses for 216 M&As of large, publicly traded U.S. commercial banks between 1987 and 1999. Our theory and our results are predicated on the idea that acquisitions of large and increasingly complex commercial banks were a relatively...

  15. Dibujo y pensamiento en la obra de Rafael Masó

    Marañón González, Rafael Carlos

    2002-01-01

    Rafael Masó, arquitecto noucentista, es además, el artista adecuado para el análisis de una obra totalmente gráfica.Dibujos, escritos, gráficos y bocetos, son los elementos idóneos para que las ideas sobre la expresión gráfica, queden reflejados en esta Tesis Doctoral.Para conocer su obra gráfica, es necesario llegar a lo más profundo de sus pensamientos transmitidos por historiadores y la Familia Masó. Tanto su obra arquitectónica, como sus dibujos, son conocidos por expertos y estudiosos ...

  16. 29Si and 27Al MAS NMR spectra of mullites from different kaolinites.

    He, Hongping; Guo, Jiugao; Zhu, Jianxi; Yuan, Peng; Hu, Cheng

    2004-04-01

    Mullites synthesized from four kaolinites with different random defect densities have been studied by 27Al and 29Si magic angle spinning nuclear magnetic resonance spectroscopy (MAS NMR) and X-ray diffraction (XRD). All these mullites show the same XRD pattern. However, 29Si and 27Al MAS NMR spectra reveal that the mullites derived from kaolinites with high defect densities, have a sillimanite-type Al/Si ordering scheme and are low in silica, whereas those mullites derived from kaolinites with low defect densities, consist of both sillimanite- and mullite-type Al/Si ordering schemes and are rich in silica. PMID:15084323

  17. Protective effect of UV-A radiation during acclimation of the photosynthetic apparatus to UV-B treatment

    Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír

    2015-01-01

    Roč. 96, nov (2015), s. 90-96. ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: EH - Ecology, Behaviour Impact factor: 2.756, year: 2014

  18. Produtividade e composição de uva e de vinho de videiras consorciadas com plantas de cobertura

    Jovani Zalamena

    2013-02-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência de plantas de cobertura verde sobre a produtividade das videiras e sobre a composição da uva e do vinho. Durante duas safras, foram feitas avaliações de três tipos de consórcio, dois manejos das coberturas e de um tratamento controle, com plantas espontâneas controladas por herbicidas e roçagem. Utilizou-se vinhedo de uvas 'Cabernet Sauvignon', localizado a 1.130 m de altitude, em um Cambissolo Húmico distrófico, em São Joaquim, SC. Os consórcios foram realizados com a sucessão de cultivos anuais de moha (Setaria italica com azevém (Lolium multiflorum e de trigo mourisco (Fagopyrum esculentum com aveia‑branca (Avena sativa, bem como com a planta perene festuca (Fetusca sp.. Os manejos consistiram da transferência ou não do resíduo cultural da linha para a entrelinha. As videiras apresentaram maior produtividade de uva no consórcio com as plantas anuais, em comparação ao tratamento controle, ou com a planta perene festuca. O manejo da cobertura verde não teve influência sobre as variáveis avaliadas. Os consórcios não influenciaram de forma consistente os teores de N da uva nem a composição do mosto, embora, na última safra, o teor de sólidos solúveis totais do mosto tenha sido maior nos tratamentos com consórcio, em comparação ao controle. Além disso, as videiras consorciadas com festuca podem proporcionar vinho com maior teor de antocianinas e polifenóis totais.

  19. 'Black star': uma mutação somática natural da uva fina de mesa cv. Brasil

    Sergio Ruffo Roberto

    2012-09-01

    Full Text Available A uva fina de mesa 'Black Star', originada de uma mutação somática da uva cv. Brasil em Marialva-PR, é descrita quanto às suas principais características físico-químicas e produtivas. Suas bagas, com sementes, apresentam formato elipsoide alongado com coloração vermelho-escura, tendendo ao preto durante a maturação plena. O ciclo, o desempenho produtivo e a suscetibilidade às doenças fúngicas assemelham-se aos da cv. Itália. Durante a maturação plena, apresenta teor médio de sólidos solúveis de 14ºBrix, 0,6% de ácido tartárico e índice de maturação de 21. Trata-se de nova cultivar de uva fina de mesa com potencial de cultivo no Brasil.

  20. Effect of coupled UV-A and UV-C LEDs on both microbiological and chemical pollution of urban wastewaters

    Wastewater reuse for irrigation is an interesting alternative for many Mediterranean countries suffering from water shortages. The development of new technologies for water recycling is a priority for these countries. In this study we test the efficiency of UV-LEDs (Ultraviolet-Light-Emitting Diodes) emitting UV-A or UV-C radiations, used alone or coupled, on bacterial and chemical indicators. We monitored the survival of fecal bioindicators found in urban wastewaters and the oxidation of creatinine and phenol which represent either conventional organic matter or the aromatic part of pollution respectively. It appears that coupling UV-A/UV-C i) achieves microbial reduction in wastewater more efficiently than when a UV-LED is used alone, and ii) oxidizes up to 37% of creatinine and phenol, a result comparable to that commonly obtained with photoreactants such as TiO2. - Highlights: ► We test UV-LEDs as an urban wastewater tertiary treatment. ► UV-A and UV-C are coupled, combining germicidal and oxidative properties of UV. ► Coupled wavelengths have the most efficient bactericidal effect. ► Coupling UV-A and UV-C leads to photooxidation of creatinine and phenol.

  1. A novel estrogenic compound transformed from fenthion under UV-A irradiation

    Yamada, Kenta, E-mail: p7404@mail.u-shizuoka-ken.ac.jp [Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, 52-1, Yada, Suruga-ku, Shizuoka 422-8526 (Japan); Terasaki, Masanori, E-mail: terasaki@u-shizuoka-ken.ac.jp [Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, 52-1, Yada, Suruga-ku, Shizuoka 422-8526 (Japan); Makino, Masakazu, E-mail: makinom@u-shizuoka-ken.ac.jp [Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, 52-1, Yada, Suruga-ku, Shizuoka 422-8526 (Japan)

    2010-04-15

    The photo-transformed products of fenthion well-known as one of the most photosensitive organophosphorus insecticides and their estrogenic activities were investigated using a yeast two-hybrid assay incorporating the human estrogen receptor {alpha} (hER{alpha}). We identified fenthion sulfoxide and 3-methyl-4-methylsulfinylphenol (MMS) as the major transformed products and 3-methyl-4-(methylthio)phenol (MMP) as the minor product under UV-A irradiation. Further, significant estrogenic activity was observed in the solution irradiated for 160 min; this activity was evaluated as 18 pM converted to 17{beta}-estradiol (E{sub 2}) equivalent concentration. By using authentic standards, it was found that MMP possessed weak estrogenic activity; its activity was evaluated as 1.7 x 10{sup -6} times compared with that of E{sub 2}. However, it was also revealed that the activity due to MMP was only 13%. From high-performance liquid chromatography (HPLC) and nuclear magnetic resonance (NMR) spectroscopies, we newly identified a significant estrogenic compound transformed from fenthion, O,O-dimethyl S-[3-methyl-4-(methylthio)phenyl]phosphorothioate, S-aryl fenthion.

  2. Solid surface photochemistry of montmorillonite: mechanisms for the arsenite oxidation under UV-A irradiation.

    Yuan, Yanan; Wang, Yajie; Ding, Wei; Li, Jinjun; Wu, Feng

    2016-01-01

    Transformation of inorganic arsenic species has drawn great concern in recent decades because of worldwide and speciation-dependent pollution and the hazards that they pose to the environment and to human health. As(III) photooxidation in aquatic systems has received much attention, but little is known about photochemical transformation of arsenic species on top soil. As(III) photooxidation on natural montmorillonite under UV-A radiation was investigated by using a moisture- and temperature-controlled photochemical chamber with two black-light lamps. Initial As(III) concentration, pH, layer thickness, humic acid (HA) concentration, the presence of additional iron ions, and the contribution of reactive oxygen species (ROS) were examined. The results show that pH values of the clay layers greatly influenced As(III) photooxidation on montmorillonite. As(III) photooxidation followed the Langmuir-Hinshelwood model. HA and additional iron ions greatly promoted photooxidation, but excess Fe(II) competed with As(III) for oxidation by ROS. Scavenging experiments revealed that natural montmorillonite induced the conversion of As(III) to As(V) by generating ROS (mainly HO(•) and HO2(•)/O2(•-)) and that HO(•) radical was the predominant oxidant in this system. Our work demonstrates that photooxidation on the surface of natural clay minerals in top soil can be important to As(III) transformation. This allows understanding and predicting the speciation and behavior of arsenic on the soil surface. PMID:26194238

  3. Homogeneous and heterogeneous degradation of caffeic acid using photocatalysis driven by UVA and solar light.

    Yáñez, Eliana; Santander, Paola; Contreras, David; Yáñez, Jorge; Cornejo, Lorena; Mansilla, Héctor D

    2016-01-01

    Waste water from the wine industry is characterized by a high concentration of dissolved organic matter and the presence of natural phenolic compounds with low biodegradability. High concentrations of phenolic compounds may cause environmental pollution and risks to human health. In this article caffeic acid (CA) was used as a model compound of wine effluent because it is refractory to the conventional wastewater treatments. The oxidation of caffeic acid in water solution (0.01 g L(-1)) by heterogeneous photocatalysis and photo-Fenton reaction was studied using UVA. The optimal conditions for each treatment were performed by multivariate experimental design. The optimal conditions for heterogeneous photocatalysis were pH 5.3 and 0.9 g L(-1) TiO2. In the case of photo-Fenton treatment, optimized variable were 82.4 μmol L(-1) of Fe(2+) and 558.6 μmol L(-1) of H2O2. The degradation profiles of CA were monitored by UV-Vis, HPLC, TOC and COD. To reach 90% of CA removal, 40 and 2 min of reaction, respectively, were required by heterogeneous and photo-Fenton processes, respectively. For comparison purposes, the reactions were also performed under solar light. The use of solar light does not change the efficiency of the photo-Fenton reaction, yet the performance of the heterogeneous process was significantly improved, reaching 90% of degradation in 15 min. PMID:26548918

  4. Phenylmercury degradation by heterogeneous photocatalysis assisted by UV-A light.

    Miranda, Cristian; Yáñez, Jorge; Contreras, David; Zaror, Claudio; Mansilla, Héctor D

    2013-01-01

    Photocatalytic degradation of phenylmercury was studied using TiO2 in aqueous suspension assisted by UV-A irradiation. Reaction conditions, such as pH and amount of TiO2 were set using a factorial design of experiments resulting in a greater influence of pH on phenylmercury degradation. Hg (II) reduction and simultaneous oxidation of aromatic group was observed. Optimum reaction conditions were obtained under nitrogen atmosphere at pH 10 and 0.35 g/L(-1) TiO2. Under these conditions almost 100% reduction of mercury was reached after 30 min UV irradiation. Total mercury reduction was achieved after 40 min reaction under saturated oxygen. Furthermore, phenol and diphenylmercury were identified as intermediate products of oxidation. It was observed that a major fraction of the reduced mercury was removed as metallic vapor by gas stripping, whereas a minor fraction was adsorbed on the catalyst surface, probably as Hg(OH)2. Under optimal conditions obtained by multivariable analysis, total mineralization of organic matter was achieved after about 60-min irradiation. PMID:23947701

  5. Antimicrobial susceptibility of photodynamic therapy (UVA/riboflavin against Staphylococcus aureus

    Renata Tiemi Kashiwabuchi

    2012-12-01

    Full Text Available PURPOSE: To assess S. aureus in vitro viability after the exposure to ultraviolet light A (UVA and riboflavin (B2. METHODS: Samples of S. aureus in 96 well plates (in triplicate were exposed to riboflavin (B2 and ultraviolet light A (365 nm wavelength at a power density of 3 mW/cm², 8 mm spot diameter, for 30 minutes. Control groups were prepared as well in triplicate: blank control, ultraviolet light A only, riboflavin only and dead bacteria Control. The bacterial viability was measured using fluorescent microscopy. In order to investigate the occurrence of "viable but non-culturable" microorganisms after treatment, the cell viability was also investigated by plate culture procedure onto a broth medium. Statistical analysis was performed using the triplicate values from each experimental condition. RESULTS: No difference was observed among the treatment group and the control samples (p=1. CONCLUSION: The combination of riboflavin 0.1% and ultraviolet light A at 365 nm did not exhibit antimicrobial activity against oxacillin susceptible S. aureus.

  6. Photocatalytic Oxidation of Triiodide in UVA-Exposed Dye-Sensitized Solar Cells

    Matthew Carnie

    2012-01-01

    Full Text Available UVA irradiation of glass mounted dye-sensitized solar cells without UV filtration causes failure within 400 hours of light exposure. The failure mode is shown to relate to consumption of I3−, which is directly related to TiO2 photo-catalysis. The onset of failure is easily determined from electrochemical impedance data where the recombination resistance of the TiO2/electrolyte back reaction drops markedly prior to the onset of degradation. At the point of complete cell failure this impedance value then dramatically increases as there is no longer an interfacial reaction possible between the TiO2 and the I3− depleted electrolyte. Device failure is most rapid for cells under electrical load indicating that the degradation of the electrolyte is related to photogenerated hole production by excitation of the TiO2. Once depleted by UV exposure, the I3− can be regenerated by simple application of a reverse bias which can restore severely UV degraded devices to near original working conditions.

  7. UVA/UVB-induced genotoxicity and lesion repair in Colossoma macropomum and Arapaima gigas Amazonian fish.

    Groff, Aline Aparecida; da Silva, Juliana; Nunes, Emilene A; Ianistcki, Martus; Guecheva, Temenouga N; de Oliveira, Alzira Miranda; de Oliveira, Christiane Patrícia Feitosa; Val, Adalberto Luis; Henriques, João A P

    2010-05-01

    Ultraviolet radiation is known to cause adverse effects to aquatic species and aquatic environments. The fish Colossoma macropomum (tambaqui) and Arapaima gigas (pirarucu) live in the Amazon basin, near the Equator, and thus receive high intensity of ultraviolet radiation. Deforestation further aggravates the situation by reducing shade at ground level. The aim of this study was to evaluate the genotoxic effects of UVA and UVB radiation on erythrocytes of tambaqui and pirarucu fish using Micronuclei test and Comet assay. Our study showed that UV radiation caused DNA damage in both species as detected by Comet assay. In addition, there were differences in response to genotoxicity between both species, which are possibly related to their evolutionary history. Tambaqui fish exposed to ultraviolet radiation for different periods presented clear dose-response in DNA damage profile. Significant damage repair was observed 24h after cessation of ultraviolet radiation exposure. At the test conditions used, no significant increase in micronucleated cells was observed in tambaqui and pirarucu fish. Tambaqui proved to be more sensitive to ultraviolet radiation than Pirarucu, as detected by Comet assay, showing statistically higher baseline DNA damage. The present results demonstrated that alkaline Comet assay was very sensitive for detecting the UV-induced genotoxicity during the short exposure period in our study. In addition, the present study also suggests that tambaqui and pirarucu fish are useful sentinel organisms, as their UV sensitivity allows them to be effective monitors of biological hazards in the Amazon region. PMID:20338776

  8. UVA Photoirradiation of Oxygenated Benz[a]anthracene and 3-Methylcholanthene - Generation of Singlet Oxygen and Induction of Lipid Peroxidation

    Diógenes Herreño Sáenz

    2008-03-01

    Full Text Available Polycyclic aromatic hydrocarbons (PAHs are widespread genotoxic environmental pollutants and potentially pose a health risk to humans. Although the biological and toxicological activities, including metabolism, mutagenicity, and carcinogenicity, of PAHs have been thoroughly studied, their phototoxicity and photo-induced biological activity have not been well examined. We have long been interested in phototoxicity of PAHs and their derivatives induced by irradiation with UV light. In this paper we report the photoirradiation of a series of oxygenated benz[a]anthracene (BA and 3-methylcholanthene (3-MC by UVA light in the presence of a lipid, methyl linoleate. The studied PAHs include 2-hydroxy-BA (2-OH-BA, 3-hydroxy-BA (3-OH-BA, 5-hydroxymethyl-BA (5-CH2OH-BA, 7-hydroxymethyl-BA (7-CH2OH-BA, 12-hydroxymethyl-BA (12-CH2OH-BA, 7-hydroxymethyl-12-methyl-BA (7-CH2OH-12-MBA, 5-formyl-BA (5-CHO-BA, BA 5,6-cis-dihydrodiol (BA 5,6-cis-diol, 1-hydroxy-3- methylcholanthene (1-OH-3-MC, 1-keto-3-methylcholanthene (1-keto-3-MC, and 3-MC 1,2-diol. The results indicate that upon photoirradiation by UVA at 7 and 21 J/cm2, respectively all these compounds induced lipid peroxidation and exhibited a relationship between the dose of the light and the level of lipid peroxidation induced. To determine whether or not photoirradiation of these compounds by UVA light produces ROS, an ESR spin-trap technique was employed to provide direct evidence. Photoirradiation of 3-keto-3-MC by UVA (at 389 nm in the presence of 2,2,6,6-tetramethylpiperidine (TEMP, a specific probe for singlet oxygen, resulted in the formation of TEMPO, indicating that singlet oxygen was generated. These overall results suggest that UVA photoirradiation of oxygenated BA and 3-methylcholanthrene generates singlet oxygen, one of the reactive oxygen species (ROS, which induce lipid peroxidation.

  9. Cp-MAS solid state NMR of secondary metabolites from northeastern Brazil plants

    Aiming to learn more about the 13 C NMR of secondary metabolites in the solid state, as well as to make use of the Cp-MAS probe available in the CENAUREMN (Northeastern Center for Application and Use od NMR) laboratory, an analysis has been performed on the the following six classes of secondary metabolites: diterpenes, coumarins, alkaloids, flavonoids and purines

  10. Acceptance Test Report for the Modular Automation System (MAS) Manufactured by Honeywell Inc

    This document details the performance of the acceptance test of the Honeywell MAS Control System for equipment to be installed in gloveboxes HA-20MB and HA-211 at a later date. Equipment that was anticipated included 6 stabilization furnaces, only three and their associated equipment were installed