WorldWideScience

Sample records for 186 mev calculated

  1. Tensor polarization of 6Li*(2.186 MeV, 3+) in the 9Be(p,α)6Li reaction at 40 MeV

    Tensor moments tkq have been determined for the 6Li*(2.186 MeV, 3+) state produced in the 9Be(p,α1)6Li reaction at 40 MeV. Angular correlation measurements were made between α1 and the α-particle or deuteron fragment from the breakup of 6Li*. Comparison of the tkq are made with the predictions of a model that includes direct and exchange processes. Angular distributions of the differential cross sections for the 9Be(p,α)6Li reaction for the g.s. and first two excited states are presented. (orig.)

  2. Yield of Radionuclides and Isomers Measured in Fragmentation of the ^{nat}W and ^{186}W (97%) Targets with Protons at 630, 420 and 270 MeV

    Karamian, S A; Chaloun, P; Filossofov, D V; Henzl, V; Henzlova, D; Kalinnikov, V G; Korolev, N A; Lebedev, N A; Novgorodov, A F; Collins, C B; Popescu, I I; Ur, C A

    2004-01-01

    Yields and cross sections of the radioactive nuclide formation have been measured via induced activity gamma-spectra after irradiation of the natural composition W and enriched ^{186)W targets at Dubna synchrocyclotron. Spallation and fission products have been represented among the detected nuclides. The high-spin isomers of Hf and Lu were produced and the isomer-to-ground state ratios could be estimated. The nuclide yields have also been calculated using the LAHET code at 6 values of proton energy in the range from 100 to 800 MeV both for ^{nat)W and for enriched ^{186)W targets. Measured isotope yields are generally in agreement with the calculations, however, the code is incapable to predict the isomer-to-ground state ratios. In experiment, it has been shown that the ^{177m}Lu, ^{178m2}Hf and ^{179m2}Hf high-spin isomers are produced with 2.5 times higher yield in the 97% enriched ^{186)W target as compared to the ^{nat)W target at identical irradiations. This makes significance for the creation of high-a...

  3. Calculation of 14 MeV neutron transmission

    The possibility of using the 28 group constant system (28-GCS) for calculating the transport of neutrons with initial energy of 14 MeV in thermonuclear reactor blankets is studied. A blanket project suggested by the Oak Ridge National Laboratory is used as a test version to estimate applicability of the 28-GCS. Niobium is used in a blanket as a structural material. A mixture of lithium nuclides is used for tritium production. The results of blanket test calculation and the calculational results obtained using the 28-GCS from the UKNDL library are compared. The numerical 28-group calculation of blonket is carried out by means of the ROZ-6 and ROZ-9 codes but not by the Monte-Carlo method as compared with the test calculation. Time of the blanket calculation on the BESM-6 computer by means of the ROZ-9 code in 2P5 approximation using the 28-GCS amounts to 10 min. It is noted that to create effective codes for the numerical blanket calculation different calculational grids are necessary for different energy grups. The calculations carried out have shown the possibility of using the 28-group library of cross sections for the numerical solution of the neutron transport equation in estimating analysis of blankets

  4. Production cross-section calculations of medical {sup 32}P, {sup 117}Sn, {sup 153}Sm and {sup 186,188}Re radionuclides used in bone pain palliation treatment

    Demir, Bayram [Istanbul Univ. (Turkey). Physics Dept.; Kaplan, A.; Capali, V. [Univ. Isparta (Turkey). Physics Dept.; Sarpuen, I.H. [Afyon Kocatepe Univ., Afyonkarahisar (Turkey). Physics Dept.; Aydin, A. [Kirikkale Univ. (Turkey). Physics Dept.; Tel, E. [Univ. Osmaniye (Turkey). Physics Dept.

    2015-03-15

    In this study, production cross-section calculations of {sup 32}P, {sup 117}Sn, {sup 153}Sm and {sup 186,188}Re radionuclides used in bone pain palliation treatment produced by {sup 30}Si(d,γ){sup 32}P, {sup 118}Sn(γ,n){sup 117}Sn, {sup 116}Sn(n,γ){sup 117}Sn, {sup 150}Nd(α,n){sup 153}Sm, {sup 154}Sm(n,2n){sup 153}Sm, {sup 152}Sm(n,γ){sup 153}Sm, {sup 186}W(d,2n){sup 186}Re, {sup 187}Re(γ,n){sup 186}Re, {sup 185}Re(n,γ){sup 186}Re and {sup 187}Re(n,γ){sup 188}Re reactions have been investigated in the different incident energy range of 0.003-34 MeV. Two-component exciton and generalised superfluid models of the TALYS 1.6 and exciton and generalised superfluid models of the EMPIRE 3.1 computer codes have been used to pre-equilibrium (PEQ) reaction calculations. The calculated production cross-section results have been compared with available experimental results existing in the experimental nuclear reaction database (EXFOR). Except the {sup 118}Sn(γ,n){sup 117}Sn, {sup 150}Nd(α,n){sup 153}Sm and {sup 185}Re(n,γ){sup 186}Re reactions, the two-component exciton model calculations of TALYS 1.6 code exhibit generally good agreement with the experimental measurements for all reactions used in this present study.

  5. Monte Carlo 20 and 45 MeV Bremsstrahlung and dose-reduction calculations

    The SANDYL electron-photon coupled Monte Carlo code has been compared with previously published experimental bremsstrahlung data at 20.9 MeV electron energy. The code was then used to calculate forward-directed spectra, angular distributions and dose-reduction factors for three practical configurations. These are: 20 MeV electrons incident on 1 mm of W + 59 mm of Be, 45 MeV electrons of 1 mm of W and 45 MeV electrons on 1 mm of W + 147 mm of Be. The application of these results to flash radiography is discussed. 7 references, 12 figures, 1 table

  6. The excitation functions of 187Re(n,2n) 186m,gRe reactions

    Huang, Xiao-Long; Kang, Meng-Xiao; Liu, Li-Le; Wang, Ji-Min; Chen, Xiong-Jun

    2016-08-01

    A new value for the emission probability of 137.144 keV γ-rays from 186gRe decay is recommended to be (9.47±0.03)/%. Using this value the measured cross sections for 187Re(n,2n)186mRe and 187Re(n,2n)186gRe reactions around 14 MeV are analyzed, and the cross section for 187Re(n,2n)186m+gRe reaction at 14.8 MeV is (2213±116) mb. The UNF code was adopted to calculate the cross sections for the 187Re(n,2n)186m+gRe reaction below 20 MeV, fitting to the value (2213±116) mb at 14.8 MeV using a set of optimum neutron optical potential parameters which were obtained based on the relevant experimental data of rhenium. The isomeric cross section ratio for the 187Re(n,2n)186m,gRe reaction was analyzed using the V-H method based on nuclear statistical theory. Combining these calculated results, the excitation functions for the 187Re(n,2n)186mRe and 187Re(n,2n)186gRe reactions were obtained. The obtained results are in good agreement with the available experimental data.

  7. Observation of 186mTa

    Unreported tantalum isomer 186mTa has been produced through the reaction 186W(n,p) by irradiation of natW with 14 MeV neutrons. The activity of 186mTa and 186Ta was measured using HPGe detectors and several X-γ as well as γ-γ coincidence arrangements. The 186mTa has been identified by means of measuring known γ rays from 186Ta β-decay. The half-life of 186mTa has been determined to be (1.5±0.1) min. (authors)

  8. n + 55Mn (≤20 MeV) nuclear data calculation and analysis

    n+ 2555Mn(≤20MeV) whole set of nuclear data calculation in ENDF/B6 format was carried out by using spherical optical model, coupled channel optical model, pre-equilibrium exciton model and equilibrium statistical model. The calculated cross sections, angular distributions, spectrum and double differential cross sections by using codes of APOM, ECIS95 and UNF are compared with all existential measured nuclear data for n+ 2555Mn (≤20 MeV) taking from EXFOR. The calculated results are analyzed from theoretical model and model parameters used. (authors)

  9. Shape coexistence in neutron-deficient Hg isotopes studied via lifetime measurements in $^{184,186}$Hg and two-state mixing calculations

    Gaffney, L P; Page, R.D.; Grahn, T.; Scheck, M.; Butler, P.A.; Bertone, P.F.; Bree, N.; Carroll, R.J.; Carpenter, M.P.; Chiara, C.J.; Dewald, A.; Filmer, F.; Fransen, C.; Huyse, M.; Janssens, R.V.F.; Joss, D.T.; Julin, R.; Kondev, F.G.; Nieminen, P.; Pakarinen, J.; Rigby, S.V.; Rother, W.; Van Duppen, P.; Watkins, H.V.; Wrzosek-Lipska, K.; Zhu, S.

    2014-01-01

    The neutron-deficient mercury isotopes, $^{184,186}$Hg, were studied with the Recoil Distance Doppler Shift (RDDS) method using the Gammasphere array and the K\\"oln Plunger device. The Differential Decay Curve Method (DDCM) was employed to determine the lifetimes of the yrast states in $^{184,186}$Hg. An improvement on previously measured values of yrast states up to $8^{+}$ is presented as well as first values for the $9_{3}$ state in $^{184}$Hg and $10^{+}$ state in $^{186}$Hg. $B(E2)$ values are calculated and compared to a two-state mixing model which utilizes the variable moment of inertia (VMI) model, allowing for extraction of spin-dependent mixing strengths and amplitudes.

  10. Observation of 186mTa

    2006-01-01

    Unreported tantalum isomer 18mTa has been produced through the reaction 186W(n,p) by irradiation of natW with 14 MeV neutrons. The activity of 186Ta and 186Ta was measured using HPGe detectors and several X-γ as well as γ-γ coincidence arrangements. The 186mTa has been identified by means of measuring known γ rays from 186Ta p-decay. The half-life of 186mTa has been determined to be (1.5±0.1) min.

  11. Magnetic field calculation for a 13 MeV PET cyclotron

    Yang, W Y; Oh, S; Chai, J S; Ha, J H

    1999-01-01

    A design study of the main magnet for a 13 MeV cyclotron has been carried out in a joint collaboration between the Korea Cancer Center Hospital (KCCH) and POSTECH. A maximum energy of 13 MeV has been chosen to produce radioisotopes such as /sup 18/F. There are four magnet sectors, each with radial-ridged shape. Maximum magnetic fields are 1.85 T and 0.48 T at hill and valley centers, respectively. The total size of the cyclotron is less than 2 m in diameter. The program TOSCA has been utilized for the field calculation and optimization. In this paper, we describe design parameters of the 13 MeV PET cyclotron, with emphasis on the magnetic field shape and the beam optics calculation. (3 refs).

  12. Evaluation and calculation of photonuclear reaction data for 209Bi below 30 MeV

    Based on available experimental data of neutron and photonuclear reaction, both neutron optical potential parameter and giant resonance parameters of gamma for 209Bi were obtained. The photonuclear reaction data for 209Bi were calculated, compared with experimental data and recommended below 30 MeV

  13. Transport calculations for a 14.8 MeV neutron beam in a water phantom

    A coupled neutron/photon Monte Carlo radiation transport code (MORSE-CG) has been used to calculate neutron and photon doses in a water phantom irradiated by 14.8 MeV neutrons from the Gas Target Neutron Source. The source-collimator-phantom geometry was carefully simulated. Results of calculations utilizing two different statistical estimators (next-collision and track-length) are presented

  14. Production cross-sections of 181-186Re isotopes from proton bombardment of natural tungsten.

    Lapi, S; Mills, W J; Wilson, J; McQuarrie, S; Publicover, J; Schueller, M; Schyler, D; Ressler, J J; Ruth, T J

    2007-03-01

    Cross-sections for the production of (181)Re, (182m)Re, (182g)Re, (183)Re, (184)Re, and (186)Re from proton bombardment of natural tungsten have been measured using the stacked foil technique for proton energies up to 17.6 MeV. Results are compared with the theoretical excitation functions as calculated by the EMPIRE II code (version 2.19) and experimental literature values. Results are in strong agreement with some of the previously reported literature as well at theoretical calculations for multiple reactions providing for more reliable estimates for the (186)W(p,n)(186)Re reaction. PMID:17098433

  15. Evaluated Nuclear Data Library for Transport Calculations at Energies up to 150 MeV

    A new evaluated nuclear data library has been created. The library consists of two sub-libraries for neutron and proton incident particles. The first version of neutron sub-library has been completed and described in the present paper. The library contains nuclear data for transport, heating, and shielding applications for 242 nuclides ranging in atomic number from 8 to 82 in the energy region of primary neutrons from 10-5 eV to 150 MeV. Data below 20 MeV are taken mainly from ENDF/B-VI (Revision 8) and for some nuclides, from the JENDL-3.3 and JEFF-3.0 libraries. The evaluation of emitted particle energy and angular distributions at the energies above 20 MeV was performed with the help of the ALICE/ASH code and the analysis of available experimental data. The total cross sections, elastic cross sections, and elastic scattering angular distributions were calculated with the help of the coupled channel model. The results of the calculation were adjusted to the data from ENDF/B-VI, JENDL-3.3m or JEFF-3.0 at the neutron energy equal to 20 MeV. The library is written in ENDF/B-VI format using the MF=3/MT=5 and MF=6/MT=5 representations

  16. Cross sections in the energy range from 10 to 40 MeV calculated with the GNASH code. [GNASA, below 40 MeV

    Arthur, E.D.; Young, P.G.

    1977-01-01

    A brief description of the preequilibrium-statistical model code GNASH is given. Features which make the code applicable to the calculation of cross sections induced by nucleons of energy 40 MeV or less are described. Finally, examples of calculations of neutron- and proton-induced reaction cross sections, activation cross sections, and secondary spectra made with global input parameters are given.

  17. Calculated neutron-induced cross sections for 53Cr from 1 to 20 MeV

    Neutron-induced cross sections of 53Cr have been calculated in the energy regions from 1 to 20 MeV. The quantities obtained are the cross sections for the reactions (n,n'γ), (n,2n), (n,np), (n,nα), (n,pγ), (n,pn), (n,αγ), (n,αn), (n,d), (n,t), (n,3He), and (n,γ), as well as the spectra of emitted neutrons, protons, alpha particles, and gamma rays. The precompound process was included above 5 MeV in addition to the compound process. For the inelastic scattering, the contribution of the direct interaction was calculated with DWBA. 36 refs., 23 figs., 11 tabs

  18. Single event upsets calculated from new ENDF/B-VI proton and neutron data up to 150 MeV

    Chadwick, M.B. [Los Alamos National Lab., NM (United States). Theoretical Div.; Normand, E. [Boeing Military Aircraft and Missile Systems, Seattle, WA (United States)

    1999-06-01

    Single-event upsets (SEU) in microelectronics are calculated from newly-developed silicon nuclear reaction recoil data that extend up to 150 MeV, for incident protons and neutrons. Calculated SEU cross sections are compared with measured data.

  19. Intercomparison of Monte Carlo and SN sensitivity calculations for a 14 MeV neutron benchmark

    An inter-comparison has been performed of probabilistic and deterministic sensitivity calculations with the objective to check and validate the Monte Carlo technique for calculating point detector sensitivities as being implemented in MCSEN, a local version of the MCNP4A code. A suitable 14 MeV neutron benchmark problem on an iron assembly has been considered to this end. Good agreement has been achieved for the calculated individual sensitivity profiles, the uncertainties and the neutron flux spectra as well. It is concluded that the Monte Carlo technique for calculating point detector sensitivities and related uncertainties as being implemented in MCSEN is well qualified for sensitivity and uncertainty analyses of fusion neutronics integral experiments. (orig.)

  20. Calculation of Multisphere Neutron Spectrometer Response Functions in Energy Range up to 20 MeV

    Martinkovic, J

    2005-01-01

    Multisphere neutron spectrometer is a basic instrument of neutron measurements in the scattered radiation field at charged-particles accelerators for radiation protection and dosimetry purposes. The precise calculation of the spectrometer response functions is a necessary condition of the propriety of neutron spectra unfolding. The results of the response functions calculation for the JINR spectrometer with LiI(Eu) detector (a set of 6 homogeneous and 1 heterogeneous moderators, "bare" detector within cadmium cover and without it) at two geometries of the spectrometer irradiation - in uniform monodirectional and uniform isotropic neutron fields - are given. The calculation was carried out by the code MCNP in the neutron energy range 10$^{-8}$-20 MeV.

  1. Calculation of multisphere neutron spectrometer response functions in energy range up to 20 MeV

    Multisphere neutron spectrometer is a basic instrument of neutron measurements in the scattered radiation field at charged-particles accelerators for radiation protection and dosimetry purposes. The precise calculation of the spectrometer response functions is a necessary condition of the propriety of neutron spectra unfolding. The results of the response functions calculation for the JINR spectrometer with LiI(Eu) detector (a set of 6 homogeneous and 1 heterogeneous moderators, 'bare' detector within cadmium cover and without it) at two geometries of the spectrometer irradiation - in uniform monodirectional and uniform isotropic neutron fields - are given. The calculation was carried out by the code MCNP in the neutron energy range 10-8 - 20 MeV

  2. Experimental and Calculated Effectiveness of a Radiochromic Dye Film to Stopping 21 MeV 7Li- and 64 MeV 16O Ions

    Olsen, Kjeld J; Hansen, Johnny

    1984-01-01

    Relative radiation effectiveness, RE, of 21 MeV 7Li and 64 MeV 16O ions being completely stopped in a tissue equivalent film dose meter has been measured as a function of penetration depth and energy, and the results have been compared with calculations based on a δ-ray theory for heavy charged...... in the detector, which are important parameters in the theoretical model, does not improve the overall correlation between theory and experiment. It is concluded that disagreement between theoretical and experimental RE-values below 1.5 MeV/amu is partly due to lack of equivalence between the δ-ray spectrum...

  3. Calculated differential elastic and inelastic neutron scattering by 12C and 16O between 30 and 60 MeV

    Well-verified models for elastic and inelastic scattering of fast neutrons (and protons) from 12C and 16O are translated into a useful form for transport, dosimetry, and scintillator response calculations. The information presented here is complementary to published calculations of secondary-particle production by incident neutrons in the energy region 15 ≤ En ≤ 60 MeV. Tables are given of Legendre expansion coefficients derived from fits to experimental cross sections at incident neutron energies En = 18-26 MeV and from fits to model predictions for 30- to 60-MeV neutrons. 11 refs., 8 tabs

  4. 500-MeV electron beam bench-mark experiments and calculations

    Experiments measuring the energy deposited by electron beams were performed to provide bench marks against which to evaluate our HANDYL76 electron beam computer code. The experiments, done at Stanford's Mk III accelerator, measured dose vs depth and dose vs radius profiles induced in layered aluminum targets by 500-MeV electrons. The dose was measured by passive thermoluminescence and photographic film placed between aluminum plates. The calculations predict a dose vs radius profile that forward-peaks on axis after the beam passes through a 200-cm air gap; the experimental measurements do not show this peak. This discrepancy indicates there may be a problem in using HANDYL76 to calculate deep penetration of a target with a large gap

  5. Calculations of complete data for n + 99Tc reaction in En = 0.01-20 MeV region

    Calculations of complete data for n+99Tc reaction in En=0.01-20 MeV region are given in this paper. The calculated σtot, σnon, σel, σn,γ, σn,n', σn,p, σn,α and σn,nα are good agreement with experimental data

  6. Cross Sections Calculations of ( d, t) Nuclear Reactions up to 50 MeV

    Tel, E.; Yiğit, M.; Tanır, G.

    2013-04-01

    In nuclear fusion reactions two light atomic nuclei fuse together to form a heavier nucleus. Fusion power is the power generated by nuclear fusion processes. In contrast with fission power, the fusion reaction processes does not produce radioactive nuclides. The fusion will not produce CO2 or SO2. So the fusion energy will not contribute to environmental problems such as particulate pollution and excessive CO2 in the atmosphere. Fusion powered electricity generation was initially believed to be readily achievable, as fission power had been. However, the extreme requirements for continuous reactions and plasma containment led to projections being extended by several decades. In 2010, more than 60 years after the first attempts, commercial power production is still believed to be unlikely before 2050. Although there have been significant research and development studies on the inertial and magnetic fusion reactor technology, there is still a long way to go to penetrate commercial fusion reactors to the energy market. In the fusion reactor, tritium self-sufficiency must be maintained for a commercial power plant. Therefore, for self-sustaining (D-T) fusion driver tritium breeding ratio should be greater than 1.05. Working out the systematics of ( d, t) nuclear reaction cross sections is of great importance for the definition of the excitation function character for the given reaction taking place on various nuclei at different energies. Since the experimental data of charged particle induced reactions are scarce, self-consistent calculation and analyses using nuclear theoretical models are very important. In this study, ( d, t) cross sections for target nuclei 19F, 50Cr, 54Fe, 58Ni, 75As, 89Y, 90Zr, 107Ag, 127I, 197Au and 238U have been investigated up to 50 MeV deuteron energy. The excitation functions for ( d, t) reactions have been calculated by pre-equilibrium reaction mechanism. Calculation results have been also compared with the available measurements in

  7. Calculated alpha-induced thick-target neutron and radionuclide yields for Eα≤ 50 MeV

    Thick-target yields for αs incident on elements 4 ≤ Z ≤ 15 and Z = 17 have been calculated using the α stopping data of Ziegler with radionuclide production cross sections calculated with the GNASH code. Comparisons are made of the calculated cross sections with sparse measured data. Radionuclide production yields are tabulated at 5, 10, 20, 30, 40 and 50 MeV. 9 refs., 3 figs., 13 tabs

  8. Use of the nuclear model code GNASH to calculate cross section data at energies up to 100 MeV

    The nuclear theory code GNASH has been used to calculate nuclear data for incident neutrons, protons, and deuterons at energies up to 100 MeV. Several nuclear models and theories are important in the 10--100 MeV energy range, including Hauser-Feshbach statistical theory, spherical and deformed optical model, preequilibrium theory, nuclear level densities, fission theory, and direct reaction theory. In this paper we summarize general features of the models in GNASH and describe the methodology utilized to determine relevant model parameters. We illustrate the significance of several of the models and include comparisons with experimental data for certain target materials that are important in applications

  9. Calculated proton-induced thick-target neutron and radionuclide yields for Ep ≤ 100 MeV

    Earlier proton-induced thick-target yield calculations have been extended in proton energy range and to additional target elements, using the proton stopping cross section data of Anderson and Ziegler and cross sections modeled with the GNASH code. The targets now described include Be, C, O, Ne, Al, Si, Fe, Co, Ni, Cu, W, Pb and Bi. Thick-target yields are presented for these thirteen targets, with most extending to 100 MeV. 13 refs., 3 figs., 13 tabs

  10. Modeling the Bremsstrahlung of 30-60 MeV electrons. Source term calculation

    The photofission process has been recently considered for the production of neutron rich isotopes and the development of radioactive beams. The radioprotection hazard should be studied accordingly. A survey of the radiative electron energy loss theory is reported in order to estimate numerically the Bremsstrahlung production of thick targets. The resulted Bremsstrahlung angular and energy theoretical distributions delivered from W and UCx thick converters are presented and compared with previous results. This study is focused on initial kinetic energies of the electron beam included in the range 30-60 MeV, suitable for the production of large photon yields able to induce the 238U fission. The source term for 50 MeV incident electrons is reported for radioprotection purposes. (authors)

  11. Production and separation of 186gRe from proton bombardment of 186WC

    A proof of concept study was undertaken where non-carrier added 186gRe was produced from the cyclotron bombardment of 186WC. 186WC was carbo-thermally generated from a novel precursor synthesized from 186WO3, aqueous ammonia and hexamethyltetramine. The inherent high electrical and thermal conductivity of this material, coupled with its high melting point, made it an ideal candidate for proton bombardment for production of 186Re. An18 μA irradiation for 3 h and processing via thermo-chromatography, 186WC yielded 0.93 mCi of 186gRe which corresponds to 89% of the calculated theoretical yields. The radiochemical purity of the desired 186gRe species was found to be between 95 and 97% with small contaminants of 186ReO2. The radiochemistry utility of the product was investigated using S-benzoyl-MAG3, and 100% complexation was achieved with stability being maintained for 96 h. The re-oxidation of 186WC back to186WO3 by oxygen in the thermo-chromatography method of processing ensured that the starting material was regenerated and recovered from the process in 94–98% yield

  12. A calculation on n-D scattering cross sections in the energy range 0 to 20 MeV

    A calculation on n-D scattering cross sections with phase shift analysis is carried out in the neutron energy range of 0 to 20 MeV. An optimum set of parameters are obtained by fitting the experimental data which include total, (n,2n) and differential cross section of n-D scattering. The comparisons were made between this calculated results and previous works. It was showed that the obtained differential elastic cross sections are in good agreement with the experimental values

  13. Nucleon transverse momentum-dependent parton distributions from domain wall fermion calculations at 297 MeV pion mass

    Engelhardt, Michael; Musch, Bernhard; Bhattacharya, Tanmoy; Gupta, Rajan; Hagler, Phillip; Negele, John; Pochinsky, Andrew; Shafer, Andreas; Syritsyn, Sergey; Yoon, Boram

    2014-12-01

    Lattice QCD calculations of transverse momentum-dependent parton distributions (TMDs) in a nucleon are performed based on a definition of TMDs via hadronic matrix elements of quark bilocal operators containing staple-shaped gauge connections. A parametrization of the matrix elements in terms of invariant amplitudes serves to cast them in the Lorentz frame preferred for the lattice calculation. Using a RBC/UKQCD domain wall fermion ensemble corresponding to a pion mass of 297MeV, on a lattice with spacing 0.084fm, selected TMD observables are accessed and compared to previous explorations at heavier pion masses on coarser lattices.

  14. Calculation of the longitudinal acceptance of the 50 MeV track microtron

    The algorithm for analysing a longitudinal motion and calculation phase trajectory in racetrack microtron with small injection energy and small energy gain per turn is described. A longitudinal acceptance is calculated. 7 refs.; 9 figs.; 2 tabs

  15. Accuracy of the phase space evolution dose calculation model for clinical 25 MeV electron beams

    The phase space evolution (PSE) model is a dose calculation model for electron beams in radiation oncology developed with the aim of a higher accuracy than the commonly used pencil beam (PB) models and with shorter calculation times than needed for Monte Carlo (MC) calculations. In this paper the accuracy of the PSE model has been investigated for 25 MeV electron beams of a MM50 racetrack microtron (Scanditronix Medical AB, Sweden) and compared with the results of a PB model. Measurements have been performed for tests like non-standard SSD, irregularly shaped fields, oblique incidence and in phantoms with heterogeneities of air, bone and lung. MC calculations have been performed as well, to reveal possible errors in the measurements and/or possible inaccuracies in the interaction data used for the bone and lung substitute materials. Results show a good agreement between PSE calculated dose distributions and measurements. For all points the differences - in absolute dose - were generally well within 3% and 3 mm. However, the PSE model was found to be less accurate in large regions of low-density material and errors of up to 6% were found for the lung phantom. Results of the PB model show larger deviations, with differences of up to 6% and 6 mm and of up to 10% for the lung phantom; at shortened SSDs the dose was overestimated by up to 6%. The agreement between MC calculations and measurement was good. For the bone and the lung phantom maximum deviations of 4% and 3% were found, caused by uncertainties about the actual interaction data. In conclusion, using the phase space evolution model, absolute 3D dose distributions of 25 MeV electron beams can be calculated with sufficient accuracy in most cases. The accuracy is significantly better than for a pencil beam model. In regions of lung tissue, a Monte Carlo model yields more accurate results than the current implementation of the PSE model. (author)

  16. Accuracy of the phase space evolution dose calculation model for clinical 25 MeV electron beams

    Korevaar, Erik W.; Akhiat, Abdelhafid; Heijmen, Ben J. M.; Huizenga, Henk

    2000-10-01

    The phase space evolution (PSE) model is a dose calculation model for electron beams in radiation oncology developed with the aim of a higher accuracy than the commonly used pencil beam (PB) models and with shorter calculation times than needed for Monte Carlo (MC) calculations. In this paper the accuracy of the PSE model has been investigated for 25 MeV electron beams of a MM50 racetrack microtron (Scanditronix Medical AB, Sweden) and compared with the results of a PB model. Measurements have been performed for tests like non-standard SSD, irregularly shaped fields, oblique incidence and in phantoms with heterogeneities of air, bone and lung. MC calculations have been performed as well, to reveal possible errors in the measurements and/or possible inaccuracies in the interaction data used for the bone and lung substitute materials. Results show a good agreement between PSE calculated dose distributions and measurements. For all points the differences - in absolute dose - were generally well within 3% and 3 mm. However, the PSE model was found to be less accurate in large regions of low-density material and errors of up to 6% were found for the lung phantom. Results of the PB model show larger deviations, with differences of up to 6% and 6 mm and of up to 10% for the lung phantom; at shortened SSDs the dose was overestimated by up to 6%. The agreement between MC calculations and measurement was good. For the bone and the lung phantom maximum deviations of 4% and 3% were found, caused by uncertainties about the actual interaction data. In conclusion, using the phase space evolution model, absolute 3D dose distributions of 25 MeV electron beams can be calculated with sufficient accuracy in most cases. The accuracy is significantly better than for a pencil beam model. In regions of lung tissue, a Monte Carlo model yields more accurate results than the current implementation of the PSE model.

  17. Calculated neutron-induced cross sections for 52Cr from 1 to 20 MeV and comparisons with experiments

    Nuclear model codes were used to compute cross sections for neutron-induced reactions on 52Cr for incident energies from 1 to 20 MeV. The input parameters for the model codes were determined through analysis of experimental data in this energy region. Discussion of the models used, the input data, the resulting calculations, extensive comparisons to measured data, and comparisons to the Evaluated Nuclear Data File (ENDF/B-V) for Cr (MAT 1324) are included in this report. 103 refs., 67 figs., 12 tabs

  18. Calculations of Excitation Functions of Some Structural Fusion Materials for ( n, t) Reactions up to 50 MeV Energy

    Tel, E.; Durgu, C.; Aktı, N. N.; Okuducu, Ş.

    2010-06-01

    Fusion serves an inexhaustible energy for humankind. Although there have been significant research and development studies on the inertial and magnetic fusion reactor technology, there is still a long way to go to penetrate commercial fusion reactors to the energy market. Tritium self-sufficiency must be maintained for a commercial power plant. For self-sustaining (D-T) fusion driver tritium breeding ratio should be greater than 1.05. So, the working out the systematics of ( n, t) reaction cross sections is of great importance for the definition of the excitation function character for the given reaction taking place on various nuclei at different energies. In this study, ( n, t) reactions for some structural fusion materials such as 27Al, 51V, 52Cr, 55Mn, and 56Fe have been investigated. The new calculations on the excitation functions of 27Al( n, t)25Mg, 51V( n, t)49Ti, 52Cr( n, t)50V, 55Mn( n, t)53Cr and 56Fe( n, t)54Mn reactions have been carried out up to 50 MeV incident neutron energy. In these calculations, the pre-equilibrium and equilibrium effects have been investigated. The pre-equilibrium calculations involve the new evaluated the geometry dependent hybrid model, hybrid model and the cascade exciton model. Equilibrium effects are calculated according to the Weisskopf-Ewing model. Also in the present work, we have calculated ( n, t) reaction cross-sections by using new evaluated semi-empirical formulas developed by Tel et al. at 14-15 MeV energy. The calculated results are discussed and compared with the experimental data taken from the literature.

  19. Calculation and analysis of cross-sections for p+184W reactions up to 200 MeV

    Sun, Jian-Ping; Zhang, Zheng-Jun; Han, Yin-Lu

    2015-08-01

    A set of optimal proton optical potential parameters for p+ 184W reactions are obtained at incident proton energy up to 250 MeV. Based on these parameters, the reaction cross-sections, elastic scattering angular distributions, energy spectra and double differential cross sections of proton-induced reactions on 184W are calculated and analyzed by using theoretical models which integrate the optical model, distorted Born wave approximation theory, intra-nuclear cascade model, exciton model, Hauser-Feshbach theory and evaporation model. The calculated results are compared with existing experimental data and good agreement is achieved. Supported by National Basic Research Program of China, Technology Research of Accelerator Driven Sub-critical System for Nuclear Waste Transmutation (2007CB209903) and Strategic Priority Research Program of Chinese Academy of Sciences, Thorium Molten Salt Reactor Nuclear Energy System (XDA02010100)

  20. Production cross-sections of {sup 181-186}Re isotopes from proton bombardment of natural tungsten

    Lapi, S. [Simon Fraser University, 8888 University Drive, Burnaby BC, V5A 1S6 (Canada) and TRIUMF, Pet Group, 4004 Wesbrook Mall, Vancouver BC, V6T 2A3 (Canada)]. E-mail: slapi@sfu.ca; Mills, W.J. [Simon Fraser University, 8888 University Drive, Burnaby BC, V5A 1S6 (Canada); Wilson, J. [University of Alberta, 11560 University Avenue, Edmonton, AB, T6G 1Z2 (Canada); McQuarrie, S. [University of Alberta, 11560 University Avenue, Edmonton, AB, T6G 1Z2 (Canada); Publicover, J. [University of Victoria, 3800 Finnerty Road, Victoria, BC, V8W 5C2 (Canada); Schueller, M. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Schyler, D. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Ressler, J.J. [Simon Fraser University, 8888 University Drive, Burnaby BC, V5A 1S6 (Canada); Ruth, T.J. [Simon Fraser University, 8888 University Drive, Burnaby BC, V5A 1S6 (Canada); TRIUMF, Pet Group, 4004 Wesbrook Mall, Vancouver BC, V6T 2A3 (Canada)

    2007-03-15

    Cross-sections for the production of {sup 181}Re, {sup 182m}Re, {sup 182g}Re, {sup 183}Re, {sup 184}Re, and {sup 186}Re from proton bombardment of natural tungsten have been measured using the stacked foil technique for proton energies up to 17.6 MeV. Results are compared with the theoretical excitation functions as calculated by the EMPIRE II code (version 2.19) and experimental literature values. Results are in strong agreement with some of the previously reported literature as well at theoretical calculations for multiple reactions providing for more reliable estimates for the {sup 186}W(p, n){sup 186}Re reaction.

  1. Shielding Calculations for Industrial 5/7.5MeV Electron Accelerators Using the MCNP Monte Carlo Code

    High energy X-rays from accelerators are used to irradiate food ingredients to prevent growth and development of unwanted biological organisms in food, in order to extend the shelf life of products. High energy photons can cause food activation due to (D3,n) reactions. Until 2004, to eliminate the possibility of food activation, the electron energy was limited to 5 MeV X-rays for food irradiation. In 2004, the FDA approved the usage of up to 7.5 MeV, but only with tantalum and gold targets (1). Higher X-ray energy results an increased flux of X-rays in the forward direction, increased penetration, and higher photon dose rate due to better electron-to-photon conversion. These improvements could decrease the irradiation time and allow irradiation of larger packages, thereby providing higher production rates with lower treatment cost. Medical accelerators usually work with 6-18 MV electron energy with tungsten target to convert the electron beam to X-rays. In order to protect the patients, the accelerator head is protected with a heavy lead shielding; therefore, the bremsstrahlung is emitted only in the forward direction. There are many publications and standards that guide how to design optimal shielding for medical accelerator rooms. The shielding data for medical accelerators is not applicable for industrial accelerators, since the data is for different conversion targets, different X-Ray energies, and only for the forward direction. Collimators are not always in use in industrial accelerators, and therefore bremsstrahlung photons can be emitted in all directions. The bremsstrahlung spectrum and dose rate change as a function of the emission angle. The dose rate decreases from maximum in the forward direction (0°) to minimum at 180° by 1-2 orders of magnitude. In order to design and calculate optimal shielding for food accelerator rooms, there is a need to have the bremsstrahlung spectrum data, dose rates and concrete attenuation data in all emission directions

  2. Model Calculation of n + 6Li Reactions Below 20 MeV

    ZHANG Jing-Shang; HAN Yin-Lu

    2001-01-01

    Based on the unified Hauser-Feshbach and exciton model for light nuclei, the calculations of reaction cross sections and the double-differential cross sections for n + 6Li are performed. Since all of the first-particle emissions are from the compound nucleus to the discrete levels, the angular momentum coupling effect in pre-equilibrium mechanism must be taken into account. The fitting of the measured data indicates that the three-body break-up process needs to be involved, and the pre-equilibrium reaction mechanism dominates the reaction processes. In light nucleus reactions the recoil effect must be taken into account.``

  3. Calculation of excitation functions of the 54,56,57,58Fe(, ) reaction from threshold to 30 MeV

    Damewan Suchiang; J Joseph Jeremiah; B M Jyrwa

    2014-10-01

    The cross-sections for the formation of 54,56,57,58Co in the 54,56,57,58Fe(, ) reaction from threshold to 30 MeV protons have been theoretically calculated using the TALYS-1.4 nuclear model code, whereby we have studied major nuclear reaction mechanisms, including direct, preequilibrium and compound nuclear reaction. Subsequently, the level density and shell damping parameters have been adjusted and at the same time, the odd–even effects are well comprehended. The excitation functions have been compared with experimental nuclear data. It is observed that the theoretical cross-sections match fairly well. Proton-induced reaction cross-sections provide clues to understand the nuclear structure and offers a good testing ground for ideas about nuclear forces. In addition, complete information in this field is very much required for application in accelerator-driven subcritical system.

  4. Dose calculation for neutrons of thermal to 10 MeV

    In the ICRP publication 60 adopted in 1990, the drastic change was proposed regarding the definition of the dose used for radiation protection. The main changes were the introduction of radiation weighting factor, the definition of tissue equivalent dose, the change of tissue weighting factor and the change of the equation for defining radiation quality factor (the equation for Q-L relation). In the exposure to neutrons, all these changes exert influence. In the case of neutrons, the conservativeness of operational quantity in relation to the limit of exposure may break down. Effective dose is defined as the sum of weighted risks of the equivalent doses of 12 organs and tissues and the rest of tissues. Also it has been recommended to take the mass-weighted average value for 10 specified organs and tissues as the equivalent dose. As to the effective dose for neutrons, the calculating method, the effective dose for adults, the comparison of effective dose and effective dose equivalent, and the age dependence of effective dose are explained. It is difficult to directly measure effective dose which is the limiting quantity of exposure. Therefore, ICRU defined operational quantity for area monitoring and individual monitoring. The relation of effective dose with operational quantity is shown. (K.I.)

  5. Radiation field calculation of ventilation duct for 3-MeV electron irradiation accelerator

    Background: Ozone will be produced when the accelerator runs. Because ozone can cause corrosive damage to metal, ventilation duct has to be set in the irradiation room to discharge ozone. Purpose: Photons go into the ventilation duct, and then produce additional radiation. To do the quantitative assessment of radiation field at the outlet of duct, the simulate calculation of radiation doses at the outlet has been done. Methods: The Monte Carlo code of MCNP can analog the electronic and photon transport, so that using MCNP can solve the problem. Results: The result shows that the location and the number of backscattered interface of duct significantly affect the dosage rate while the size of duct doesn't. Increasing a backscatter interface can lower dosage rate attenuation about three orders of magnitude. The dosage rate under the target is two orders of magnitude than that in the comer. The setting project of duct is drawn and the ratio of length and depth has been optimized. The duct should be about 3 m long and 80 cm deep when the multi-tortuous duct is placed under the target, and U-shaped duct should be about 6 m long and l m deep when it is set at the comer of irradiation room. Conclusions: In order to reduce dosage rates and economic costs, the shape of duct and the location of duct are designed critically. And according to the actual situation, the project is flexible. (authors)

  6. Calculation and analysis of neutron induced reactions on 175,176Lu and NatLu in energy region 1 keV∼20 MeV

    A set of neutron optical potential parameters for 1 keV≤En≤20 MeV is obtained on the basis of the relevant experimental data, and all cross sections of neutron induced reaction on 175,176,NatLu are calculated. The calculated results are compared with experimental data. (7 figs.)

  7. Monte Carlo calculated stopping-power ratios, water/air, for clinical proton dosimetry (50-250 MeV)

    Calculations of stopping power ratios, water to air, for the determination of absorbed dose to water in clinical proton beams using ionization chamber measurements have been undertaken using the Monte Carlo method. A computer code to simulate the transport of protons in water (PETRA) has been used to calculate Sw,air-data under different degrees of complexity, ranging from values based on primary protons only to data including secondary electrons and high-energy secondary protons produced in nonelastic nuclear collisions. All numerical data are based on ICRU 49 proton stopping powers. Calculations using primary protons have been compared to the simple continuous slowing-down approximation (c.s.d.a.) analytical technique used in proton dosimetry protocols, not finding significant differences that justify elaborate Monte Carlo simulations except beyond the mean range of the protons (the far side of the Bragg peak). The influence of nuclear nonelastic processes, through the detailed generation and transport of secondary protons, on the calculated stopping-power ratios has been found to be negligible. The effect of alpha particles has also been analysed, finding differences smaller than 0.1% from the results excluding them. Discrepancies of up to 0.6% in the plateau region have been found, however, when the production and transport of secondary electrons are taken into account. The large influence of nonelastic nuclear interactions on proton depth-dose distributions shows that the removal of primary protons from the incident beam decreases the peak-to-plateau ratio by a large factor, up to 40% at 250 MeV. It is therefore emphasized that nonelastic nuclear reactions should be included in Monte Carlo simulations of proton beam depth-dose distributions. (author)

  8. Calculation for cross section of (p,n) reaction on sixteen targets in energy region up to 100 MeV

    A semiempirical method based on the evaporation and exciton models is developed to calculate the cross section of the (p,n) reaction, in the mass number region 30≤A≤140, and incident proton energy EP≤100 MeV, and the systematics of two parameters obtained. Using the formulas, the calculation for sixteen targets has been performed, the results of the calculation are in agreement with the measured data. (3 figs., 1 tab.)

  9. Intercomparisons of benchmark calculations for the transmission of quasi-monoenergetic neutrons generated by 43- and 68-MeV protons through iron and concrete shields

    To evaluate calculation codes and the nuclear data in the energy region from 20 MeV to 100 MeV, intercomparisons of benchmark calculations with the MORSE-CG, modified HETC-KFA2 and MCNP4A codes were carried out for the transmission of quasi-monoenergetic neutrons generated by 43- and 68-MeV protons through iron and concrete shields. The comparisons between the calculations and the experiments show that the spectra on the axis of the neutron beam calculated by the MORSE-CG and the MCNP4A codes with the DLC-119/HILO86 and HILO86R are in good agreement with those measured. The spectra calculated for the thin shields by the modified HETC-KFA2 code agree well with those measured, while those for the thick shields are higher than measured ones. The spectra at the off-axis positions calculated by the MORSE-CG code agree well with those measured, though the modified HETC-KFA2 code greatly underestimates the measured spectra. (author)

  10. Comment: 186 [Taxonomy Icon

    Full Text Available keru Nakazato (Database Center for Life Science) アゲハチョウ(ナミアゲハ) Papilio xuthus 標本風の写真もあるかと思うので探してみます。 (もしくは撮り直す) nakazato 2008/12/22 09:47:51 2010/01/14 19:54:38 ... ...Asian Swallowtail Papilio xuthus Papilio_xuthus_L.png 186.png Takeru Nakazato (Database Center for Life Scie...nce) licensed under CC Attribution2.1 Japan 撮影:仲里猛留(ライフサイエンス統合データベースセンター) Photo: Ta

  11. Reliability assessment of high energy particle induced radioactivity calculation code DCHAIN-SP 2001 by analysis of integral activation experiments with 14 MeV neutrons

    Reliability assessment for the high energy particle induced radioactivity calculation code DCHAIN-SP 2001 was carried out through analysis of integral activation experiments with 14-MeV neutrons aiming at validating the cross section and decay data revised from previous version. The following three kinds of experiments conducted at the D-T neutron source facility, FNS, in JAERI were employed: (1) the decay gamma-ray measurement experiment for fusion reactor materials, (2) the decay heat measurement experiment for 32 fusion reactor materials, and (3) the integral activation experiment on mercury. It was found that the calculations with DCHAIN-SP 2001 predicted the experimental data for (1) - (3) within several tens of percent. It was concluded that the cross section data below 20 MeV and the associated decay data as well as the calculation algorithm for solving the Beteman equation that was the master equation of DCHAIN-SP were adequate. (author)

  12. Calculations of neutron and proton induced reaction cross sections for actinides in the energy region from 10MeV to 1GeV

    Several nuclear model codes were applied to calculations of nuclear data in the energy region from 10MeV to 1GeV. At energies up to 100MeV the nuclear theory code GNASH was used for nuclear data calculation for neutrons incident for on 238U, 233-236U, 238-242Pu, 237Np, 232Th, 241-243Am and 242-247Cm. At energies from 100MeV to 1GeV the intranuclear cascade exciton model including the fission process was applied to calculations of protons and neutrons with 233U, 235U, 238U, 232Th, 232Pa, 237Np, 238Np, 239Pu, 241Am, 242Am and 242-248Cm. Determination of parameter systematics was a major effort in the present work that was aimed at improving the predictive capability of the models used. An emphasis was placed upon a simultaneous analysis of data for a variety of reaction channels for the nuclei considered, as well as of data that are available for nearby nuclei or for other incident particles. Comparisons with experimental data available on multiple reaction cross sections, isotope yields, fission cross sections, particle multiplicities, secondary particle spectra, and double differential cross sections indicate that the calculations reproduce the trends, and often the details, of the measurements data. (author) 82 refs

  13. Hauser-Feshbach calculations of neutron-induced reaction cross sections for 52Cr in 6-20 MeV neutron energy range

    Calculations of cross sections of neutron induced reactions for 52Cr in 6-20 MeV energy range have been performed using Hauser-Feshbach code developed by the author. The calculations include cross sections of (n,n'), (n.np), (n,2n), (n,p), (n,pn), (n,pγ), (n,α), (n,αγ) and (n, αn) reactions induced in 52Cr. The calculations have been compared with measurements and evaluations. (author). 30 refs, 11 figs, 2 tabs

  14. Calculations of an HPGe detector peak efficiency curve up to 11 MeV with EGS4 and GEANT4

    We determined an efficiency curve of an HPGe detector in the energy range of 0.3 - 11 MeV within 0.5% accuracy with the measured data of the 14N(n,γ)15N reaction and the aid of the Monte Carlo cords EGS4 and GEANT4. (author)

  15. Calculation of SF6-/SF6 and Cl-/CFCl3 electron attachment cross sections in the energy range 0-100 meV

    Chutjian, A.

    1982-01-01

    Electron attachment cross sections for the processes SF6-/SF6 and Cl-/CFCl3 are calculated in a local theory using a model in which diatomic-like potential energy curves for the normal modes are constructed from available spectroscopic data. Thermally populated vibrational and rotational levels are included. Good agreement is found with experimental cross sections in the energy range 5-100 meV for a particular choice of potential energy curve parameters.

  16. HETC-3STEP calculations of proton induced nuclide production cross sections at incident energies between 20 MeV and 5 GeV

    For the OECD/NEA code intercomparison, nuclide production cross sections of 16O, 27Al, natFe, 59Co, natZr and 197Au for the proton incidence with energies of 20 MeV to 5 GeV are calculated with the HETC-3STEP code based on the intranuclear cascade evaporation model including the preequilibrium and high energy fission processes. In the code, the level density parameter derived by Ignatyuk, the atomic mass table of Audi and Wapstra and the mass formula derived by Tachibana et al. are newly employed in the evaporation calculation part. The calculated results are compared with the experimental ones. It is confirmed that HETC-3STEP reproduces the production of the nuclides having the mass number close to that of the target nucleus with an accuracy of a factor of two to three at incident proton energies above 100 MeV for natZr and 197Au. However, the HETC-3STEP code has poor accuracy on the nuclide production at low incident energies and the light nuclide production through the fragmentation process induced by protons with energies above hundreds of MeV. Therefore, further improvement is required. (author)

  17. Calculation of the neutron induced fission cross-section of 233Pa up to 20 MeV

    Since very recently, direct measurements of the 233Pa(n,f) cross-section are available in the energy range from 1.0 to 8.5 MeV. This has stimulated a new, self-consistent, neutron cross-section evaluation for the n+233Pa system, in the incident neutron energy range 0.01-20 MeV. Since higher fission chances are involved also the lighter Pa-isotopes had to be re-evaluated in a consistent manner. The results are quite different compared to earlier evaluation attempts. Since 233Pa is a key isotope in the thorium based fuel cycle the quality of its reaction cross-sections is important for the modeling of future advanced fuel and reactor concepts. The present status of the evaluated libraries is that they differ by a factor of two in the absolute fission cross-section and also in the threshold energy value

  18. Calculation of neutron field generated at thick Li target bombarded with 10-40 MeV deuterons for energy selective neutron irradiation test facility

    Characteristics of neutrons generated from the lithium target bombarded with high energetic deuterons of 10-40 MeV have been calculated to determine the specification for the neutron irradiation material test facility (ESNIT) planned at Japan Atomic Energy Research Institute. The simple nuclear reaction model was applied to estimation of neutron flux distribution and energy spectrum and the results showed an agreement with the reported experiment within a factor of 2. The present calculation gives the basic spectrum data for estimation of damage parameters in test samples to evaluate the high energy neutron effect on them. (author)

  19. Study the sensitivity of dose calculation in prism treatment planning system using Monte Carlo simulation of 6 MeV electron beam

    Hardiansyah, D.; Haryanto, F. [Nuclear Physics and Biophysics Research Laboratory, Physics Department, Institut Teknologi Bandung (ITB) (Indonesia); Male, S. [Radiotherapy Division, Research Hospital of Hassanudin University (Indonesia)

    2014-09-30

    Prism is a non-commercial Radiotherapy Treatment Planning System (RTPS) develop by Ira J. Kalet from Washington University. Inhomogeneity factor is included in Prism TPS dose calculation. The aim of this study is to investigate the sensitivity of dose calculation on Prism using Monte Carlo simulation. Phase space source from head linear accelerator (LINAC) for Monte Carlo simulation is implemented. To achieve this aim, Prism dose calculation is compared with EGSnrc Monte Carlo simulation. Percentage depth dose (PDD) and R50 from both calculations are observed. BEAMnrc is simulated electron transport in LINAC head and produced phase space file. This file is used as DOSXYZnrc input to simulated electron transport in phantom. This study is started with commissioning process in water phantom. Commissioning process is adjusted Monte Carlo simulation with Prism RTPS. Commissioning result is used for study of inhomogeneity phantom. Physical parameters of inhomogeneity phantom that varied in this study are: density, location and thickness of tissue. Commissioning result is shown that optimum energy of Monte Carlo simulation for 6 MeV electron beam is 6.8 MeV. This commissioning is used R50 and PDD with Practical length (R{sub p}) as references. From inhomogeneity study, the average deviation for all case on interest region is below 5 %. Based on ICRU recommendations, Prism has good ability to calculate the radiation dose in inhomogeneity tissue.

  20. Study the sensitivity of dose calculation in prism treatment planning system using Monte Carlo simulation of 6 MeV electron beam

    Hardiansyah, D.; Male, S.; Haryanto, F.

    2014-09-01

    Prism is a non-commercial Radiotherapy Treatment Planning System (RTPS) develop by Ira J. Kalet from Washington University. Inhomogeneity factor is included in Prism TPS dose calculation. The aim of this study is to investigate the sensitivity of dose calculation on Prism using Monte Carlo simulation. Phase space source from head linear accelerator (LINAC) for Monte Carlo simulation is implemented. To achieve this aim, Prism dose calculation is compared with EGSnrc Monte Carlo simulation. Percentage depth dose (PDD) and R50 from both calculations are observed. BEAMnrc is simulated electron transport in LINAC head and produced phase space file. This file is used as DOSXYZnrc input to simulated electron transport in phantom. This study is started with commissioning process in water phantom. Commissioning process is adjusted Monte Carlo simulation with Prism RTPS. Commissioning result is used for study of inhomogeneity phantom. Physical parameters of inhomogeneity phantom that varied in this study are: density, location and thickness of tissue. Commissioning result is shown that optimum energy of Monte Carlo simulation for 6 MeV electron beam is 6.8 MeV. This commissioning is used R50 and PDD with Practical length (Rp) as references. From inhomogeneity study, the average deviation for all case on interest region is below 5 %. Based on ICRU recommendations, Prism has good ability to calculate the radiation dose in inhomogeneity tissue.

  1. Study the sensitivity of dose calculation in prism treatment planning system using Monte Carlo simulation of 6 MeV electron beam

    Prism is a non-commercial Radiotherapy Treatment Planning System (RTPS) develop by Ira J. Kalet from Washington University. Inhomogeneity factor is included in Prism TPS dose calculation. The aim of this study is to investigate the sensitivity of dose calculation on Prism using Monte Carlo simulation. Phase space source from head linear accelerator (LINAC) for Monte Carlo simulation is implemented. To achieve this aim, Prism dose calculation is compared with EGSnrc Monte Carlo simulation. Percentage depth dose (PDD) and R50 from both calculations are observed. BEAMnrc is simulated electron transport in LINAC head and produced phase space file. This file is used as DOSXYZnrc input to simulated electron transport in phantom. This study is started with commissioning process in water phantom. Commissioning process is adjusted Monte Carlo simulation with Prism RTPS. Commissioning result is used for study of inhomogeneity phantom. Physical parameters of inhomogeneity phantom that varied in this study are: density, location and thickness of tissue. Commissioning result is shown that optimum energy of Monte Carlo simulation for 6 MeV electron beam is 6.8 MeV. This commissioning is used R50 and PDD with Practical length (Rp) as references. From inhomogeneity study, the average deviation for all case on interest region is below 5 %. Based on ICRU recommendations, Prism has good ability to calculate the radiation dose in inhomogeneity tissue

  2. Evaluation of cross sections and calculation of kerma factors for neutrons up to 80 MeV on {sup 12}C

    Harada, M.; Watanabe, Y. [Kyushu Univ., Fukuoka (Japan); Chiba, S.; Fukahori, T.

    1997-03-01

    We have evaluated the cross sections for neutrons with incident energies from 20 to 80 MeV on {sup 12}C for the JENDL high-energy file. The total cross sections were determined by a generalized least-squares method with available experimental data. The cross sections of elastic and inelastic scattering to the first 2{sup +} were evaluated with the theoretical calculations. The optical potentials necessary for these calculations were derived using a microscopic approach by Jeukenne-Lejeune-Mahaux. For the evaluation of double differential emission cross sections (DDXs), we have developed a code system SCINFUL/DDX in which total 35 reactions including the 3-body simultaneous breakup process (n+{sup 12}C {yields} n+{alpha}+{sup 8}Be) can be taken into consideration in terms of a Monte Carlo method, and have calculated the DDXs of all light-emissions (A{<=}4) and heavier reaction products. The results for protons, deuterons, and alphas showed overall good agreement with experimental data. The code is also applicable for calculations of total and partial kerma factors. Total kerma factors calculated for energies from 20 to 80 MeV were compared with the measurements and the other latest evaluations from the viewpoints of medical application and nuclear heating estimation. (author)

  3. Calculated neutron-activation cross sections for E/sub n/ /le/ 100 MeV for a range of accelerator materials

    Activation problems associated with particle accelerators are commonly dominated by reactions of secondary neutrons produced in reactions of beam particles with accelerator or beam stop materials. Measured values of neutron-activation cross sections above a few MeV are sparse. Calculations with the GNASH code have been made for neutrons incident on all stable nuclides of a range of elements common to accelerator materials. These elements include B, C, N, O, Ne, Mg, Al, Si, P, S, Ar, K, Ca, Cr, Mn, Fe, Co, Ni, Cu, Zn, Zr, Mo, Nd, and Sm. Calculations were made for a grid of incident neutron energies extending to 100 MeV. Cross sections leading to the direct production of as many as 87 activation products for each of 84 target nuclide were tabulated on this grid of neutron energies, each beginning with the threshold for the product nuclide's formation. Multigrouped values of these cross sections have been calculated and are being integrated into the cross-section library of the REAC-2 neutron activation code. Illustrative cross sections are presented. 20 refs., 6 figs., 1 tab

  4. Calculation and recommendation of n + 142-148,150Nd reactions in the energy region up to 20 MeV

    The neutron data of 142-148,150Nd were calculated and recommended in the energy region 10-5 eV to 20 MeV. The data include total, elastic, (n, γ), total inelastic, discrete level and continuum inelastic, (n, 2n), (n, 3n), (n, p), (n, α), (n, t), (n, 3He), (n, n'p + pn'), (n,n'α + αn') cross sections. The angular distributions and the spectra of the secondary neutrons and the resonance parameters were also included

  5. Monte carlo calculations of fluence-to-dose equivalent conversion factors in finite slab phantom for thermal to 10 MeV neutrons

    Finite slab tissue equivalent phantom (ICRU slab) is rather practical phantom than the ICRU sphere since a large number of dosimeters can be calibrated. It is therefore the aim of this work to determine the conversion factors for the ICRU slab which might replace the ICRU sphere as a calibration phantom. By using the MCNP code, conversion factors are calculated in the ICRU slab resulting from external neutron irradiation with energies from thermal to 10 MeV. The depth-dose distributions in the ICRU slab are similar to those in the ICRU sphere. Resultly, the ICRU tissue equivalent finite slab phantom can be used for calibrating the individual dosimeter. (Author)

  6. SU-E-T-554: Monte Carlo Calculation of Source Terms and Attenuation Lengths for Neutrons Produced by 50–200 MeV Protons On Brass

    Ramos-Mendez, J; Faddegon, B [University of California San Francisco, San Francisco, CA (United States); Paganetti, H [Massachusetts General Hospital, Boston, MA (United States)

    2015-06-15

    Purpose: We used TOPAS (TOPAS wraps and extends Geant4 for medical physicists) to compare Geant4 physics models with published data for neutron shielding calculations. Subsequently, we calculated the source terms and attenuation lengths (shielding data) of the total ambient dose equivalent (TADE) in concrete for neutrons produced by protons in brass. Methods: Stage1: The Bertini and Binary nuclear models available in Geant4 were compared with published attenuation at depth of the TADE in concrete and iron. Stage2: Shielding data of the TADE in concrete was calculated for 50– 200 MeV proton beams on brass. Stage3: Shielding data from Stage2 was extrapolated for 235 MeV proton beams. This data was used in a point-line-source analytical model to calculate the ambient dose per unit therapeutic dose at two locations inside one treatment room at the Francis H Burr Proton Therapy Center. Finally, we compared these results with experimental data and full TOPAS simulations. Results: At larger angles (∼130o) the TADE in concrete calculated with the Bertini model was about 9 times larger than that calculated with the Binary model. The attenuation length in concrete calculated with the Binary model agreed with published data within 7%±0.4% (statistical uncertainty) for the deepest regions and 5%±0.1% for shallower regions. For iron the agreement was within 3%±0.1%. The ambient dose per therapeutic dose calculated with the Binary model, relative to the experimental data, was a ratio of 0.93±0.16 and 1.23±0.24 for two locations. The analytical model overestimated the dose by four orders of magnitude. These differences are attributed to the complexity of the geometry. Conclusion: The Binary and Bertini models gave comparable results, with the Binary model giving the best agreement with published data at large angle. Shielding data we calculated using the Binary model is useful for fast shielding calculations with other analytical models. This work was supported by

  7. Comparison between the calculated and measured dose distributions for four beams of 6 MeV linac in a human-equivalent phantom

    Reda Sonia M.

    2006-01-01

    Full Text Available Radiation dose distributions in various parts of the body are of importance in radiotherapy. Also, the percent depth dose at different body depths is an important parameter in radiation therapy applications. Monte Carlo simulation techniques are the most accurate methods for such purposes. Monte Carlo computer calculations of photon spectra and the dose ratios at surfaces and in some internal organs of a human equivalent phantom were performed. In the present paper, dose distributions in different organs during bladder radiotherapy by 6 MeV X-rays were measured using thermoluminescence dosimetry placed at different points in the human-phantom. The phantom was irradiated in exactly the same manner as in actual bladder radiotherapy. Four treatment fields were considered to maximize the dose at the center of the target and minimize it at non-target healthy organs. All experimental setup information was fed to the MCNP-4b code to calculate dose distributions at selected points inside the proposed phantom. Percent depth dose distribution was performed. Also, the absorbed dose as ratios relative to the original beam in the surrounding organs was calculated by MCNP-4b and measured by thermoluminescence dosimetry. Both measured and calculated data were compared. Results indicate good agreement between calculated and measured data inside the phantom. Comparison between MCNP-4b calculations and measurements of depth dose distribution indicated good agreement between both.

  8. Calculation and evaluation of cross-sections and kerma factors for neutrons up to 100 MeV on {sup 16}O and {sup 14}N

    Chadwick, M.B. [California Univ., Livermor, CA (United States). Lawrence Livermore National Lab.; Young, P.G.

    1997-03-01

    We present evaluations of the interaction of neutrons with energies between 20 and 100 MeV with oxygen and nitrogen nuclei, which follows on from our previous work on carbon. Our aim is to accurately represent integrated cross sections, inclusive emission spectra, and kerma factors, in a data library which can be used in radiation transport calculations. We apply the FKK-GNASH nuclear model code, which includes Hauser-Feshbach, preequilibrium, and direct reaction mechanisms, and use experimental measurements to optimize the calculations. We determine total, elastic, and nonelastic cross sections, angle-energy correlated emission spectra for light ejectiles with A {<=} 4 and gamma-rays, and average energy depositions. Our results for charged-particle emission spectra agree well with the measurements of Subramanian et al. We compare kerma factors derived from our evaluated cross sections with experimental data, providing an integral benchmarking of our work. (author). 52 refs.

  9. Neutron effective dose calculation behind concrete shielding of charge particle accelerators with energy up to 100 MeV

    The purpose of work is the comparison of results of calculations of effective neutron doses behind concrete shielding by a method Monte-Carlo and by phenomenological method. Data obtained by these two methods agree within factor 2 over considered range of neutron energies and shielding thickness. Comparison of the results shows that difference in shield thickness between calculated by Monte Carlo and phenomenological method is not exceeded half-value layer for neutron effective dose, that is from 10 cm to 30 cm for considered energies and thickness of shields. (authors)

  10. Calculation of Double-Differential Cross Sections of n+7Li Reactions Below 20 MeV

    ZHANG Jing-Shang; HAN Ying-Lu

    2002-01-01

    A new reaction model for light nuclei is proposed to analyze the measured data,especially for analysis of the double-differential cross sections of the outgoing particles.Many channels arc opened in the n + 7Li reaction below En< 20 MeV.The reaction mechanism is very complex,beside the sequential emissions there are also three-body breakup processes.Because of a strong recoil effect of light nucleus reactions,the energy balance is strictly taken into account.The comparisons of the calculated results with the double-differential measurements indicate that the model calculations are successful for the total outgoing neutrons.

  11. Biomolecule labelling by 186 Re

    The aim of this study is to develop and improve the existing radiolabelling techniques of peptides and monoclonal antibodies with 186 Re and 188 Re as potential agents for cancer targeted radiotherapy. We selected the following methods and techniques for direct labelling of peptides and monoclonal antibody: 1. Prereduction of -S-S- bridges of biomolecule to sulfhydryls using reducing agents: ascorbic acid, cysteine, active hydrogen, 2,3 dimercaptopropanol. The prereduction reactions are controlled by massic ratios of reduction agents/biomolecule, pH, temperature and time of incubation; 2. Reduction of 186 Re O4- stannous chloride in acid and alkaline pH; 3. Coupling reaction of 186 Re (red) with the biomolecule controlled by the time and temperature of incubation, the influence of pH regarding the binding of 186 Re to the biomolecules. The quality control was effected by chromatography techniques (paper and elution gel chromatography) on labeled biomolecule before and after purification. The elution gel chromatography was spectrophotometricaly monitored at 280 nm. In the same time the radioactivity of samples was measured using a gamma counter. All the results confirm in vitro stability of labeled biomolecule. The biological evaluation studies regarding accumulation and biological affinity will be controlled by scintigraphy method. Biodistribution studies will be effected to Walker tumor bearing animals at 4 and 24 hours after injections. (authors)

  12. Calculation of proton-induced reactions on Tellurium isotopes below 60 MeV for medical radioisotope production

    The 123Te(p,n)123I, 124Te(p,n)124I and 124Te(p,2n)123I reactions, among the many reaction channels opened, are the major reactions under consideration from a diagnostic purpose because reaction residuals as the gamma emitters are used for most radiopharmaceutical applications involving radioiodine. Based on the available experimental data, the absorption cross sections and elastic scattering angular distributions of the proton-induced nuclear reaction on Te isotopes below 60 NeV are calculated using the optical model code APMNK. The transmission coefficients of neutron, proton, deuteron, trition and alpha particles are calculated by CUNF code and are fed into the GNASH code. By adjusting level density parameters and the pair correction values of some reaction channels, as well as the composite nucleus state density constants of the pre-equilibrium model, the production cross sections and energy-angle correlated spectra of the secondary light particles, as well as production cross sections and energy distributions of heavy recoils and gamma rays are calculated by the statistical plus pre-equilibrium model code GNAH. The calculated results are analysed and compared with the experimental data taken from the EXFOR. The optimized global optical model parameters give overall agreement with the experimental data over both the entire energy range and all tellurium isotopes. (author)

  13. Calculating the neutron yield from thick targets irradiated by electrons with the energy upto 500 MeV

    The mathematical simulation technique used for calculating the photoneutron yield from thick targets made of different Materials is suggested. Cascade-evaporative nucleus model being a part of the IMITATOR program complex is used for calculations. Three groups of materials are investigated: light-oxygen and aluminium, medium- iron and nickel, heavy,tungsten and lead. Maximum thickness of targets consistuting 10 radiation length is determined on the basis of the experiment and represents the thickness at which in the investigated energy range secondary neutron flux ''saturation'' arises. The dependences of total neutron yield on electron beam energy and target material are obtained. The values of fast neutrons yield from thick targets, their spatial distribution and dependences on the energy of primary electrons and target thickness are determined. Anomalies of photoneutrons yield near magic and double magic nuclei are pointed out. A considerable drop of total yield of fast neutrons with increase of atomic number of target material is noted

  14. 21 CFR 186.1557 - Tall oil.

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tall oil. 186.1557 Section 186.1557 Food and Drugs... Substances Affirmed as GRAS § 186.1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap... consists mainly of tall oil resin acids and tall oil fatty acids. (b) In accordance with § 186.1(b)(1),...

  15. 49 CFR 572.186 - Abdomen assembly.

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Abdomen assembly. 572.186 Section 572.186... Dummy, 50th Percentile Adult Male § 572.186 Abdomen assembly. (a) The abdomen assembly (175-5000) is part of the dummy assembly shown in drawing 175-0000 including load sensors specified in §...

  16. 21 CFR 186.1797 - Sodium sulfate.

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium sulfate. 186.1797 Section 186.1797 Food and... Substances Affirmed as GRAS § 186.1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6... crystalline powder. It is prepared by the neutralization of sulfuric acid with sodium hydroxide. (b)...

  17. Description of the shape evolution in the yrast states of 186Pt

    186Pt was tested in the framework of IBM-1 and the X(3) model. The results show that 186Pt is located close to the shape phase transition point, but the B(E2) values little agree with the X(3) model. The shape evolution in the yrast states of 186Pt is also discussed in detail. TRS calculation exhibits a flat bottomed potential at low spin states, but a relatively deep minimum at high spin states. It suggests that a shape evolution from vibrational mode to rotational mode happens in 186Pt. The result is in agreement with the E-GOS calculation. (authors)

  18. New calculation for the neutron-induced fission cross section of 233Pa between 1.0 and 3.0 MeV

    The 233Pa(n,f) cross section, a key ingredient for fast reactors and accelerators driven systems, was measured recently with relatively good accuracy [F. Tovesson et al., Phys. Rev. Lett. 88, 062502 (2002)]. The results are at strong variance with accepted evaluations and an existing indirect experiment. This circumstance led us to perform a quite detailed and complete evaluation of the 233Pa(n,f) cross section between 1.0 and 3.0 MeV, where use of our newly developed routines for the parametrization of the nuclear surface and the calculation of deformation parameters and level densities (including low-energy discrete levels) were made. The results show good quantitative and excellent qualitative agreement with the experimental direct data obtained by Tovesson et al. [F. Tovesson et al., Phys. Rev. Lett. 88, 062502 (2002)]. Additionally, our methodology opens new possibilities for the analysis of subthreshold fission and above threshold second-chance fission for both 233Pa and its decay product 233U, as well as other strategically important fissionable nuclides

  19. Calculation of cross sections of discrete γ rays production in the (n,n'γ) reaction on chromium and nickel with neutron energy up to 10MeV

    Cross-sections for the production of de-excitation γ rays following inelastic neutron scattering have been calculated, using the statistical model, and are given for natural chromium and nickel for neutron incident energy up to 10MeV

  20. 21 CFR 186.1256 - Clay (kaolin).

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Clay (kaolin). 186.1256 Section 186.1256 Food and... Substances Affirmed as GRAS § 186.1256 Clay (kaolin). (a) Clay (kaolin) Al2O3.2SiO2.nH2O, Cas Reg. No. 1332-58-7) consists of hydrated aluminum silicate. The commercial products of clay (kaolin)...

  1. 21 CFR 186.1555 - Japan wax.

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Japan wax. 186.1555 Section 186.1555 Food and Drugs... Substances Affirmed as GRAS § 186.1555 Japan wax. (a) Japan wax (CAS Reg. No. 8001-39-6), also known as Japan... fruits of the oriental sumac, Rhus succedanea (Japan, Taiwan, and Indo-China), R. vernicifera...

  2. Identification of a new isotope 186Hf

    The new neutron-rich isotope 186Hf has been produced through a multinucleon transfer reaction by irradiation of natural tungsten targets with 60 MeV/u 18O projectiles. The 186Hf activities were separated radiochemically from the tungsten and reaction product mixture. The γ-ray singles spectra were measured with a high resolution HPGe detector. The new isotope 186Hf was identified based on the growth and decay of 737.5 keV γ rays from the β- decay of its daughter 186Ta. Its half-life has been determined to be 2.6 +- 1.2 min

  3. Present status of research on Re-186 radiopharmaceuticals at Radioisotope Production Center

    Mutalib, A. [Radioisotope Production Center, National Atomic Energy Agency Kawasan PUSPIPTEK, Serpong (Indonesia)

    1998-10-01

    Rhenium shows a close chemical similarity to technetium and is suitable for radiotherapy because the {beta}-emitting radionuclides {sup 186}Re (t{sub 1/2} 90 h, E{sub {beta}} = 1.1 MeV, E{sub {gamma}} = 137 keV) and {sup 188}Re (t{sub 1/2} = 17 h, E{sub {beta}} = 2.1 MeV). The {gamma}-emission associated with decay of {sup 186}Re is also useful in scintigraphy. The research on {sup 186}Re radiopharmaceuticals at Radioisotope Production Center has been carried out since April 1997. Interest in radioimmunotherapy (RIT) led us to the development of labeling antibodies with rhenium isotopes. Although there are several methods for coupling radiometal to antibody, we prefer an indirect labeling method in which a bifunctional chelating agent is used for coupling of {sup 186}Re to monoclonal antibodies. In this report we outline the study on the preparation of {sup 186}Re DMSA-TFP as precursor for labeling with monoclonal antibody. (author)

  4. Four-body continuum-discretized coupled-channels calculations: Application to 6He+64Zn at 13.6 MeV

    The recently developed four-body continuum-discretized coupled-channels (CDCC) method, making use of the binning procedure, is applied to the reaction 6He+64Zn at 13.6 MeV (around the Coulomb barrier). Excellent agreement with available elastic data is found.

  5. Measurement by film dosimetry and calculation of energy dose distributions for electron and photon irradiation of 42 MeV using the Alderson phantom for planning of pendulum irradiation of the mediastinum in the treatment of peripheral bronchial carcinomas

    The energy dose distribution in an Alderson phantom applying a radiation energy of 42 MeV has been determined by film dosimetry and computation; the results have been compared in order to verify both methods and to improve the irradiation of bronchial carcinoma by achieving the best possible protection of healthy tissue and of the spinal cord. The comparative evaluations have shown that there is a good agreement between the calculated results and those measured by film dosimetry. (orig.)

  6. Calculation of neutron cross sections for 90Zr, 208Pb and 209Bi in the energy range of 0.5-25 MeV by using the optical model potentials

    Neutron total cross sections and differential elastic scattering cross sections for the nuclides 90Zr, 208Pb and 209Bi were calculated using different global spherical optical potential (SOP) parameter sets at neutron energies from 0.5-25 MeV. Calculated cross sections for the corresponding nuclides were compared with their experimental data obtained by the EXFOR file to select the best fit parameter sets. It is found that the parameter sets of Ferer Rapaport for 90Zr and Bechetti and Greenless for 208Pb and 209Bi are the best fitted set to obtain the experimental data of total cross sections and angular distributions of these nuclides. (author)

  7. Tritons at energies of 10 MeV to 1 TeV: Conversion coefficients for fluence-to-absorbed dose, equivalent dose, effective dose, and gray equivalent, calculated using Monte Carlo radiation transport code MCNPX 2.7.C

    Conversion coefficients were calculated for fluence-to-absorbed dose, fluence-to-equivalent dose, fluence-to-effective dose and fluence-to-gray equivalent for isotropic exposure of an adult female and an adult male to tritons (3H+) in the energy range of 10 MeV to 1 TeV (0.01-1000 GeV). Coefficients were calculated using Monte Carlo transport code MCNPX 2.7.C and BodyBuilderTM 1.3 anthropomorphic phantoms. Phantoms were modified to allow calculation of effective dose to a Reference Person using tissues and tissue weighting factors from 1990 and 2007 recommendations of the International Commission on Radiological Protection (ICRP) and calculation of gray equivalent to selected tissues as recommended by the National Council on Radiation Protection and Measurements. At 15 of the 19 energies for which coefficients for effective dose were calculated, coefficients based on ICRP 2007 and 1990 recommendations differed by less than 3%. The greatest difference, 43%, occurred at 30 MeV. Published by Oxford Univ. Press on behalf of the US Government 2010. (authors)

  8. Activation cross-sections of deuteron induced nuclear reactions on rhenium up to 40 MeV

    Highlights: ► Excitation function measurement of deuteron induced reactions on rhenium up to 40 MeV. ► Model code calculations with EMPIRE-D, ALICE-D and TALYS (TENDL-2011). ► Integral production yield calculation. ► Thin layer activation (TLA) curves; 185Os and 186Re. -- Abstract: As a part of a thorough work of excitation functions on deuteron induced reactions, experimental cross-sections of 185,183m,183g,182Os and 188,186,184m,184g,183Re activation products on natRe were measured up to 40 MeV for the first time with the activation method using a stacked foil irradiation technique and high resolution γ-spectrometry. Comparison with the former results of other laboratories and with the predictions of the ALICE-IPPE and EMPIRE-3 model codes, modified for improved calculations for deuteron reactions, and with data in the TENDL-2011 library are also presented. Thick target yields were given deduced from our experimental cross-sections and compared with the few literature values. For practical applications (thin layer activation) also activity versus depth distributions were calculated for selected isotopes

  9. Calculation of equivalent dose index for electrons from 5,0 to 22,0 MeV by the Monte Carlo method

    The index of equivalent dose in depth and in a sphere surface of a soft tissue equivalent material were determined by Monte Carlo method for electron irradiations from 5,0 to 22.00 MeV. The effect of different irradiation geometries which simulate the incidence of onedirectional opposite rotational and isotropic beams was studied. It is also shown that the detector of wall thickness with 0.5g/cm2 and isotropic response com be used to measure index of equivalent dose for fast electrons. The alternative concept of average equivalent dose for radiation protection is discussed. (M.C.K.)

  10. To calculating the gamma radiation interaction coefficients by an interpolation method in the 0.02-2 MeV energy range

    Interpolation formula earlier used for determining linear coefficients of gamma radiation attenuation in a substance is applied for determining mass coefficients of attenuation without regard for coherent scattering and mass coefficients of interaction due to incoherent scattering on bound electrons as well as mass coefficients of energy absorption. It is concluded that approximation error for 0.02-2 MeV energy range doesn't exceed 1.5 % except for several points for which the difference constitutes 2.5-3 %

  11. Deuterons at energies of 10 MeV to 1 TeV: Conversion coefficients for fluence-to-absorbed dose, equivalent dose, effective dose and gray equivalent, calculated using Monte Carlo radiation transport code MCNPX 2.7.C

    Conversion coefficients were calculated for fluence-to-absorbed dose, fluence-to-equivalent dose, fluence-to-effective dose and fluence-to-gray equivalent for isotropic exposure of an adult female and an adult male to deuterons (2H+) in the energy range 10 MeV-1 TeV (0.01-1000 GeV). Coefficients were calculated using the Monte Carlo transport code MCNPX 2.7.C and BodyBuilderTM 1.3 anthropomorphic phantoms. Phantoms were modified to allow calculation of the effective dose to a Reference Person using tissues and tissue weighting factors from 1990 and 2007 recommendations of the International Commission on Radiological Protection (ICRP) and gray equivalent to selected tissues as recommended by the National Council on Radiation Protection and Measurements. Coefficients for the equivalent and effective dose incorporated a radiation weighting factor of 2. At 15 of 19 energies for which coefficients for the effective dose were calculated, coefficients based on ICRP 1990 and 2007 recommendations differed by < 3 %. The greatest difference, 47 %, occurred at 30 MeV. (authors)

  12. Helions at energies of 10 MeV to 1 TeV: Conversion coefficients for fluence-to-absorbed dose, equivalent dose, effective dose and gray equivalent, calculated using Monte Carlo radiation transport code MCNPX 2.7.C

    Conversion coefficients were calculated for fluence-to-absorbed dose, fluence-to-equivalent dose, fluence-to-effective dose and fluence-to-gray equivalent, for isotropic exposure of an adult male and an adult female to helions (3He2+) in the energy range of 10 MeV to 1 TeV (0.01-1000 GeV). Calculations were performed using Monte Carlo transport code MCNPX 2.7.C and BodyBuilderTM 1.3 anthropomorphic phantoms modified to allow calculation of effective dose using tissues and tissue weighting factors from either the 1990 or 2007 recommendations of the International Commission on Radiological Protection (ICRP), and gray equivalent to selected tissues as recommended by the National Council on Radiation Protection and Measurements. At 15 of the 19 energies for which coefficients for effective dose were calculated, coefficients based on ICRP 2007 and 1990 recommendations differed by less than 2%. The greatest difference, 62%, occurred at 100 MeV. Published by Oxford Univ. Press on behalf of the U.S. Government 2010. (authors)

  13. Dicty_cDB: SSE186 [Dicty_cDB

    Full Text Available SS (Link to library) SSE186 (Link to dictyBase) - - - Contig-U10248-1 SSE186P (Link to Original site) SS...E186F 194 SSE186Z 130 SSE186P 324 - - Show SSE186 Library SS (Link to library) Clone ID SS... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSE1-D/SSE186Q.Seq.d/ Representative seq. ID SS...E186P (Link to Original site) Representative DNA sequence >SSE186 (SSE186Q) /CSM/SS/SSE1-D/SSE1...ant alignments: (bits) Value SSL425 (SSL425Q) /CSM/SS/SSL4-B/SSL425Q.Seq.d/ 343 1e-93 SSH468 (SSH468Q) /CSM/SS/SSH4-C/SS

  14. (n,p, (n,2n, (n,d, and (n,α cross-section calculations of 16O with 0-40 MeV energy neutrons

    Ozdemir Omer Faruk

    2015-01-01

    Full Text Available Oxygen is one of the elements which interacts with emitted neutrons after fission reactions. Oxygen exists abundantly both in nuclear fuel (UO2 and moderators (H2O. Nuclear reactions of oxygen with neutrons are important in terms of stability of nuclear fuel and neutron economy. In this study, equilibrium and pre-equilibrium models have been used to calculate (n,p, (n,d, (n,2n and (n,α nuclear reaction cross-sections of 16O. In these calculations, neutron incident energy has been taken up to 40 MeV. Hybrid and Standard Weisskopf-Ewing Models in ALICE-2011 program, Weisskopf-Ewing and Full Exciton Models in PCROSS program, and Cascade Exciton Model in CEM03.01 program have been utilized. The calculated results have been compared with experimental and theroretical cross-section data which are obtained from libraries of EXFOR and ENDF/B VII.1.

  15. 38 CFR 18.6 - Compliance information.

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Compliance information... THE CIVIL RIGHTS ACT OF 1964 General § 18.6 Compliance information. (a) Cooperation and assistance... compliance reports at such times, and in such form and containing such information, as the responsible...

  16. Dosimetry and microdosimetry of 10–220 MeV proton beams with CR-39 and their verifications by calculation of reaction cross sections using ALICE, TALYS and GEANT4 codes

    High- and intermediate-energy protons are not able to directly form a track in a CR-39 etch detector (TED). Such detectors, however, can be used for the detection and dosimetry of the beams of these particles through the registration of secondary charged particles with sufficiently high values of linear energy transfer (LET). High-energy protons (72–220 MeV) and Intermediate-energy protons (10–30 MeV) with low LET values ranging from 1.1 down to 0.4 keV/μm and 5.87 down to 2.40 keV/μm, respectively are considered in this study. It seems to be sufficient to create secondary particles, although the LET values are low. This phenomenon can modify the characteristics of the energy transfer process due to these particles, which should be taken into account when such particles are used for radiobiology studies or for radiotherapy. The importance of these secondary particles was investigated experimentally by means of an LET spectrometer based on a chemically etched track detector in which the tracks of the primary protons are not revealed. Experiments were performed with proton beams available at the Nuclear Research Center for Agriculture and Medicine (NRCAM) in Karaj, Iran and at the National Cancer Center (NCC) in Seoul, Korea with protons of primary energies of about 10–30 MeV and 72–220 MeV respectively. The contribution of the secondary particle dose increases as the proton energy decreases. The origin of the secondary particles in interactions with protons having high and intermediate energies due to various nuclear reactions was calculated by the both ALICE and TALYS computer codes. The secondary microdosimetry doses were also calculated by GEANT4 code. There is large discrepancy between experimental and calculated results in low proton energies. It has been verified that there is a good correlation between the experimentally obtained results and the reaction cross sections predicted by ALICE and TALYS codes.

  17. Rhenium-186 direct labelling HIgG

    The aim of this study is to develop and improve existing radiolabelling techniques of peptides and monoclonal antibodies with 186 Re for achievement of potential agents for cancer targeted radiotherapy. There were selected methods and techniques for the direct labelling of intact HIgG by studding chemical and radiochemical processes of -S-S- bridges prereduction, reduction of 186ReO4- and coupling reaction of rhenium with HIgG. The -S-S- bridges prereduction of HIgG to sulfhydryls was effected using different reducing agents: ascorbic acid, 2,3 dimercaptopropanol, cysteine, active hydrogen. The prereduction reactions are controlled by masic ratios of HIgG/reduction agent, pH, temperature and time of incubation. A pH=4.5 and a 24 hours incubation time are in the advantage of the prereduction yield. The labelling with 186Re of prereduced HIgG with ascorbic acid or active hydrogen and 37 deg. C incubation in 22 hours releases 92% radiochemical purity. (author)

  18. Accelerator Production and Separations for High Specific Activity Rhenium-186

    Jurisson, Silvia S. [Univ. of Missouri, Columbia, MO (United States); Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2016-04-01

    Tungsten and osmium targets were evaluated for the production of high specific activity rhenium-186. Rhenium-186 has potential applications in radiotherapy for the treatment of a variety of diseases, including targeting with monoclonal antibodies and peptides. Methods were evaluated using tungsten metal, tungsten dioxide, tungsten disulfide and osmium disulfide. Separation of the rhenium-186 produced and recycling of the enriched tungsten-186 and osmium-189 enriched targets were developed.

  19. Dicty_cDB: SSC186 [Dicty_cDB

    Full Text Available SS (Link to library) SSC186 (Link to dictyBase) - - - - SSC186P (Link to Original site) SSC186F ... CP000901_2522( CP000901 |pid:none) Yersinia pestis Angola , complet... 228 5e-58 AM286415_1135( AM286415 |pid ...

  20. 21 CFR 133.186 - Sap sago cheese.

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sap sago cheese. 133.186 Section 133.186 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.186 Sap sago cheese. (a) Description. (1) Sap sago cheese is the food prepared by...

  1. Evaluation and calculation of activation cross sections for 151,153Eu(n,2n),(n,3n),(n,γ) and (n,x) reactions below 20 MeV

    The activation cross sections for 151,153Eu(n,2n),(n,3n), (n,γ) and some emission charged particle (n,x) reactions below 20 MeV were evaluated based on experimental and theoretical data. The results are compared with the experimental and other evaluated data from ENDF/B-6 and JENDL-3. The evaluated cross sections for 151,153Eu(n,2n)150,152Eu reactions are consistent with experimental data and better than the evaluated data from other nuclear libraries. The cross sections for 151,153Eu(n,γ)152,154Eu reactions were evaluated based on the new accurate measured and calculated data. The recommended cross sections are reliable

  2. The evaluation and calculation of production cross sections for 11C, 13N and 15O from 11B, 13C, 15N(p,n) and 16O(p,x)13N reactions up to 80 MeV

    The excitation function of 11B, 13C, 15N(p,n) and 16O(p,α) reactions were measured with the aid of either residual nucleus activity or outgoing neutron methods. In general, there are some experimental data in energy range from threshold to 30 Mev and extrapolation of experimental data up to 80 Mev. The excitation functions of 13C, 15N(p,n) and 16O(p,x)13N reactions were calculated by the code ALICE95 up to 80 Mev. The comparison between calculated cross sections of 13C, 15N(p,n) and 16O(p,x)13N reactions and experimental data from threshold to 80 Mev are given. (8 figs.)

  3. Fast-neutron interactions with 182W, 184W and 186W

    Neutron total cross sections of 182W, 184W and 186W are measured from approx. = 0.3 to 5.0 MeV at intervals of less than or equal to 50 keV to accuracies of 1 to 3%. Differential neutron elastic- and inelastic-scattering cross sections of the same three isotopes are measured at scattering angles in the range 20 to 1600 and at incident-neutron energy intervals of approx. = 100 keV from 1.5 to 4.0 MeV. Approximately thirty scattered-neutron groups are observed for each of the isotopes. Prominent of these are excitations attributed to collective rotational and vibrational bands. The experimental results are interpreted in terms of optical-statistical and coupled-channels models with particular attention to the direct excitation of ground-state-rotational and β- and γ-vibrational bands. The strengths of the direct interactions and the magnitudes of the collective deformations are inferred from the interpretations and compared with similar values previously reported elsewhere. The experimental results are used to deduce experimentally-based evaluated data sets for 182W, 184W and 186W over the energy range 0.1 - approx. = 5.0 MeV

  4. Dicty_cDB: SSI186 [Dicty_cDB

    Full Text Available um calcium-dependent cell adhesion molecule-1 (cadA) gene...gnificant alignments: (bits) Value ( P54657 ) RecName: Full=Calcium-dependent cell adhesion...l.tsukuba.ac.jp/CSM/SS/SSI1-D/SSI186Q.Seq.d/ Representative seq. ID SSI186Z (Link to Original si...endent cell adhesion molecule-1 DdCAD-1 (cadA) mRNA, complete cds. 1142 0.0 2 U20997 ...te) Representative DNA sequence >SSI186 (SSI186Q) /CSM/SS/SSI1-D/SSI186Q.Seq.d/ XXXXX

  5. Dicty_cDB: SLG186 [Dicty_cDB

    Full Text Available P PERKYSFWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesasxtxxxi *mynnnki*lflmvvdlyptik Homology vs CSM-cDNA Score E Sequences pr...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLG1-D/SLG186Q.Seq.d/ Representative seq. ID SLG18...6Z (Link to Original site) Representative DNA sequence >SLG186 (SLG186Q) /CSM/SL/SLG1-D/SLG186Q.Seq.d/ XXXXX...LASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesasxtxxxi *mynnnki*lflmvvdlyptik Translated...LG8-C/SLG871Q.Seq.d/ 1124 0.0 own update 2002.12.11 Homology vs DNA Score E Sequences producing significant

  6. A nuclear structure study of the proposed gamma-ray laser candidate nucleus 186Re

    We present results of theoretical nuclear structure model calculations for the gamma-ray laser candidate nucleus 186Re proposed by Collins. Our calculations of this odd-odd transitional nucleus are based on an axially-asymmetric (particle plus triaxial rotor) model for constructing the orbitals of the odd nucleons that couple under the influence of the residual neutron-proton interaction. We include pairing correlations in the determination of these orbitals by using the BCS approximation with newly determined pairing strengths. The matrix elements of the residual neutron-proton interaction are obtained using phenomenological spin-dependent δ function potentials of both surface and volume forms. We examine the sensitivity of the calculated low-excitation level structure of 186Re to the strength of these potentials. Calculated energy levels of 186Re will be presented and compared with experiment. The impact of our results on the proposed use of 186Re as a gamma-ray laser will be discussed. In addition, based upon these and other model calculations to be described, we assess the level of effort necessary in a full-scale theoretical search for a viable candidate nucleus for a gamma-ray laser. 17 refs., 1 fig., 3 tabs

  7. Measurements of 186Re production cross section induced by deuteron on tungsten target at ARRONAX facility

    Full text of publication follows. The ARRONAX cyclotron [Ref.1], acronym for 'Accelerator for Research in Radiochemistry and Oncology at Nantes Atlantique' is a new facility installed in Nantes, France. A dedicated program has been launched on production of innovative radionuclides for PET imaging and for β- and α targeted radiotherapy using proton or α particle. Since the accelerator is also able to deliver deuteron beams up to 35 MeV, we have reconsidered the possibility to use them to produce medical isotopes. Indeed, in some cases, the use of deuterons allows higher production yield than protons. In this study, we have focused on 186Re production using deuteron. This radionuclide is a β- emitter which has chemical properties close to the widely used 99mTc and has been used in clinical trials for palliation of painful bone metastases resulting from prostate and breast cancer [Ref.2]. Production cross section has been measured between 9 and 23 MeV using the ARRONAX deuteron beam and the stacked-foil technique [Ref.3]. A novelty in our work is the use of natTi monitor foils behind each natW target foil in order to record efficiently the deuteron incident flux and energies all over the stack relying on the IAEA recommended cross section [Ref.4] of the natTi(d,x)48V reaction. Typical experimental conditions consist in an irradiation time of 30 minutes in air with a beam intensity of 100 nA. Activity measurements are made using gamma spectrometry. Isotope of interest and contaminants created during irradiation are measured since a good optimization process is supposed to find the best compromise between production yield and purity of the final product. Our new sets of data will be compared with the existing ones [Refs.5, 6] and with results given by TALYS code calculations [Ref.7]. Production yield will be determined and the best production route, using proton or deuteron, identified. References: [1] F.Haddad et al., Eur. J. Med. Mol. Imaging (2008) 35

  8. Evaluation of The Use of Beta and Gamma Counter Apparatus in Determination of Radiochemical Purity 188/186Re-CTMP

    CTMP (1,4,8,11-tetraaza cyclo tetradecil-1,4,8,11-tetrametilenfosfonat) labeled 188/186Re is one of the radiopharmaceuticals being developed in PTNBR-BATAN. It is commonly used for palliative therapy of bone metastasis. 188/186Re can be yielded from Na188/186ReO4 and CTMP with addition SnCl2 as reductor. Radiochemical side products that can be generated from the reaction are 188/186ReO4 - and 188/186Re reducted. As radiopharmaceutical, 188/186Re-CTMP has fulfilled some standard qualifications, such as radiochemical purity >90 %. The paper chromatography method is was used to determine radiochemical purity. To obtain quantitative data from chromatography, therefore can be done by using radiation counter apparatus. 188/186Re is a beta radiation emitter radionuclide with energy 1.07 MeV (92%) and gamma radiation emitter with energy 137 keV (7%). As a consequence of these characteristics, so that radioactivity testing can be determined based on beta radiation emission by using Geiger Mueller (GM) beta counter, otherwise based on gamma radiation emission by using gamma counter NaI(Tl). The experiment showed there is similarity radiochemical purity with regression value 0.9951%. (author)

  9. Dicty_cDB: AFO186 [Dicty_cDB

    Full Text Available AF (Link to library) AFO186 (Link to dictyBase) - - - Contig-U11647-1 AFO186Z (Link to Original ... 2.2 1 X80176 |X80176.1 F.rubripes gene for D3-like dopamine ... receptor. 44 2.2 1 AC079103 |AC079103.2 Homo sapie ...

  10. 31 CFR 103.186 - Special measures against Burma.

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Special measures against Burma. 103.186 Section 103.186 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs Law...

  11. 33 CFR 110.186 - Port Everglades, Florida.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Port Everglades, Florida. 110.186... ANCHORAGE REGULATIONS Anchorage Grounds § 110.186 Port Everglades, Florida. (a) The anchorage grounds. The... entrance to Port Everglades, is an area bounded by a line connecting points with the following...

  12. Analysis of 6Li Scattering at 240 MeV Using Different Nuclear Potentials

    Al-Ghamdi, A. H.; Ibraheem, Awad A.

    2016-06-01

    Angular distributions of the elastic and inelastic scattering cross sections of 6Li projectile on different heavy ion target nuclei including the 24Mg, 28Si, 48Ca, 58Ni, 90Zr, and 116Sn at energy of 240 MeV have been analyzed by using two different folded potentials based on the CDM3Y6 and São Paulo potentials for the real part of the optical potential, while the imaginary parts have a phenomenological Woods-Saxon shape. Coupled channel calculations for the low-lying 2+ state at 1.369, 1.779, 3.832, 1.454, 2.186, and 1.29 MeV for 24Mg, 28Si, 48Ca, 58Ni, 90Zr, and 116Sn, respectively, have been carried out, and the best fit values for B(EL) with the above models have been extracted by fitting the inelastic scattering cross section and compared with the values of previous works. The total reaction cross section and real and imaginary volume integrals have also been investigated.

  13. Decay properties of /sup 186/Pb and the lead alpha-decay rate anomaly

    Toth, K.S.; Ellis-Akovali, Y.A.; Bingham, C.R.; Moltz, D.M.; Carter, H.K.; Mlekodaj, R.L.; Spejewski, E.H.; Sousa, D.C.

    1984-01-01

    Alpha-decay transitions between ground states of doubly-even nuclei are taken to represent unhindered decays. Reduced widths for these s-wave transitions behave in a regular fashion as a function of both neutron and atomic number. They are largest for nuclei two or four particles beyond a closed shell (with sharp minima at the shell) and they then decrease as the next closure is approached. The s-wave widths for /sup 186/ /sup 188/ /sup 190/ /sup 192/Pb, however, have been reported to behave anomalously, i.e., they purportedly increase by a factor of 30 between /sup 186/Pb (N = 104) and /sup 192/Ob (N = 110) instead of decreasing as one nears N = 126. Theoretical calculations have not reproduced this unusual behavior. The (electron-capture (EC) + ..beta../sup +/) strengths were deduced from K x-ray intensities. A number of corrections are involved in such determinations. We undertook the investigation of the (EC + ..beta../sup +/) decay schemes of these neutron-deficient lead isotopes, in conjunction with studies of their ..cap alpha..-decay properties, to obtain more reliable ..cap alpha..-branching ratios. Herein we present new information on /sup 186/Pb and discuss the partial ..cap alpha.. half-lives for /sup 192/Pb, /sup 190/Pb, /sup 188/Pb, and /sup 186/Pb together with ..cap alpha..-decay rates for even-even nuclei with Z greater than or equal to 78.

  14. Preparation and quality control of 186Re compounds

    The optimal conditions were investigated in order to label the methylendiphosphonate (MDP), hydroxyethylendiphosphonate (HEDP), pyrophosphonate (PYP) and ethylendiaminotetramethylenphosphoric (EDTMP) with 186Re. The biodistribution of these compounds in experimental animals were studied to determine the most suitable therapeutic agent for its eventual use as pain palliative in patients with bone metastases. The biodistribution assays were performed in Wistar rats, and the 186Re HEDP was finally chosen. (M.E.L.)

  15. The role of lysine 186 in HIV-1 integrase multimerization

    HIV-1 integrase (IN) catalyzes biochemical reactions required for viral cDNA insertion into host cell chromosomal DNA, an essential step in the HIV-1 replication cycle. In one of these reactions, the two ends of the linear viral cDNA are believed to be simultaneously ligated to chromosomal DNA by a tetrameric form of IN. The structure of the full-length IN tetramer is not known but a model consisting of the N-terminal domain and the catalytic core revealed basic residues 186 to 188 at the interface between the two IN dimers. We found that alteration of these residues, in particular changing IN lysine residue 186 to glutamate (K186Q), impairs IN oligomerization in the yeast two-hybrid system and decreases oligomeric forms of IN within virions. When expressed independently of other viral proteins in human cells, IN-K186Q did not concentrate in the nucleus as did wild-type IN. Co-expression of wild-type IN restored the multimerization defects of IN-K186Q, in both the two-hybrid system and in virions, and also rescued the nuclear targeting defects. Virions bearing IN-K186Q were not infectious in a single cycle of replication but when mixed virions containing two different IN mutants were produced, IN-K186Q was capable of complementing the catalytically inactive mutant IN-D116A. Our biochemical and functional data support the crystallographic model in which IN residue K186 lies at the interface between IN dimers and suggest that tetramerization is important, not only for concerted integration, but also for IN nuclear targeting

  16. Effects of MCI-186 upon neutrophil-derived active oxygens.

    Sumitomo, K; Shishido, N; Aizawa, H; Hasebe, N; Kikuchi, K; Nakamura, M

    2007-01-01

    Reactions of 3-methyl-1-phenyl-2-pyrazoline-5-one (MCI-186) with hypochlorous acid and superoxide were analysed by spectrophotometry and mass spectrometry. The results were applied to the neutrophil system to evaluate the scavenging activity of neutrophil-derived active oxygen species by MCI-186. MCI-186 reacted rapidly with hypochlorous acid (1 x 10(6) M(-1)s(-1)) to form a chlorinated intermediate, followed by a slow conversion to a new spectrum. MCI-186 consumed 3 moles of hypochlorous acid and did not react with superoxide. The newly synthesized fluorescence probes, 2-[6-(4'-amino)-phenoxy-3H-xanthen-3-on-9-yl]benzoic acid (APF) and 2-[6-(4'-hydroxy)phenoxy-3H-anthen-3-on-9-yl]benzoic acid (HPF) successfully detected neutrophil-derived active oxygens (Setsukinai K, Urano Y, Kakinuma K, Majima HJ, Nagano T. Development of novel fluorescence probes that can reliably detect reactive oxygen species and distinguish specific species. J Biol Chem 2003; 278: 3170-3175). The rate constants for the reaction of hypochlorous acid with MCI-186 and fluorescence probes was in the order of MCI-186 > APF > HPF. Fluorescence due to the oxidation of APF and HPF was observed with the stimulated neutrophils. The result that the intensity from APF oxidation was higher than that from HPF oxidation is compatible with reports that APF selectively reacts with hypochlorous acid. Fluorescence due to oxidation of both APF and HPF decreased when the reactions were carried out in the presence of a fluorescence probe and MCI-186 in a dose-dependent manner. These results indicate that MCI-186 effectively scavenges neutrophil-derived hypochlorous acid and other active oxygens. PMID:17705989

  17. Comparison of Bonner sphere responses calculated by different Monte Carlo codes at energies between 1 MeV and 1 GeV – Potential impact on neutron dosimetry at energies higher than 20 MeV

    Rühm, W; Pioch, C; Agosteo, S; Endo, A; Ferrarini, M; Rakhno, I; Rollet, S; Satoh, D; Vincke, H

    2014-01-01

    Bonner Spheres Spectrometry in its high-energy extended version is an established method to quantify neutrons at a wide energy range from several meV up to more than 1 GeV. In order to allow for quantitative measurements, the responses of the various spheres used in a Bonner Sphere Spectrometer (BSS) are usually simulated by Monte Carlo (MC) codes over the neutron energy range of interest. Because above 20 MeV experimental cross section data are scarce, intra-nuclear cascade (INC) and evaporation models are applied in these MC codes. It was suspected that this lack of data above 20 MeV may translate to differences in simulated BSS response functions depending on the MC code and nuclear models used, which in turn may add to the uncertainty involved in Bonner Sphere Spectrometry, in particular for neutron energies above 20 MeV. In order to investigate this issue in a systematic way, EURADOS (European Radiation Dosimetry Group) initiated an exercise where six groups having experience in neutron transport calcula...

  18. New transitions and feeding of the Jπ=(8+) isomer in 186Re

    Matters, D. A.; Fotiades, N.; Carroll, J. J.; Chiara, C. J.; McClory, J. W.; Kawano, T.; Nelson, R. O.; Devlin, M.

    2015-11-01

    The spallation neutron source at the Los Alamos Neutron Science Center Weapons Neutron Research facility was used to populate excited states in 186Re via (n ,2 n γ ) reactions on an enriched 187Re target. Gamma rays were detected with the GErmanium Array for Neutron Induced Excitations spectrometer, a Compton-suppressed array of 18 HPGe detectors. Incident neutron energies were determined by the time-of-flight technique and used to obtain γ -ray excitation functions for the purpose of identifying γ rays by reaction channel. Analysis of the singles γ -ray spectrum gated on the neutron energy range 10 ≤En≤25 MeV resulted in five transitions and one level added to the 186Re level scheme. The additions include the placement of three γ rays at 266.7, 381.2, and 647.7 keV which have been identified as feeding the 2.0 ×105yr , Jπ=(8+) isomer and yield an improved value of 148.2 (5 )keV for the isomer energy. These transitions may have astrophysical implications related to the use of the Re-Os cosmochronometer.

  19. Configuration mixing in the neutron-deficient $^{186-196}$Pb isotopes

    Hellemans, V; Heyde, K

    2008-01-01

    In this article we report the results of detailed interacting boson model calculations with configuration mixing for the neutron-deficient Pb isotopes. Calculated energy levels and $B(E2)$ values for $^{188-196}$Pb are discussed and some care is suggested concerning the current classification on the basis of level systematics of the $4_1^+$ and $6_1^+$ states in $^{190-194}$Pb. Furthermore, quadrupole deformations are extracted for $^{186-196}$Pb and the mixing between the different families (0p-0h, 2p-2h, and 4p-4h) is discussed in detail. Finally, the experimental and the theoretical level systematics are compared.

  20. Competition between fusion-fission and quasifission processes in the 30Si+182,184,186W systems

    The dynamics of fusion-fission processes in heavy-ion collisions has been extensively investigated, both theoretically and experimentally, in recent years. The time evolution of the composite system formed after interaction, and parameters on which the dynamics depends etc., are still not fully understood. Studies on dynamical processes in heavy ion collisions at the near-Coulomb-barrier energies have shown that complete fusion does not occur immediately in the case of massive nuclei collisions. Among various competing processes, quasifission (QF) is the dominant non-compound nuclear process. We, here report the di-nuclear system (DNS) model predictions of capture, fusion and quasi fission cross-sections for 30Si+182,184,186W systems in the centre-of-mass energy range 113 MeV to 163 MeV

  1. Probing intruder configurations in $^{186, 188}$Pb using Coulomb excitation

    Columb excitation measurements to study the shape coexistence, mixing and quadrupole collectivity of the low-lying levels in neutron-deficient $^{188}$Pb nuclei are proposed with a view to extending similar studies to the $^{186}$Pb midshell nucleus. The HIE-ISOLDE beam of $^{186,188}$Pb nuclei will be delivered to MINIBALL+SPEDE set-up for simultaneous in-beam $\\gamma$-ray and conversion electron spectroscopy. The proposed experiment will allow the sign of the quadrupole deformation parameter to be extracted for the two lowest 2$^{+}$ states in $^{188}$Pb. Moreover, the advent of SPEDE will allow probing of the bandhead 0$^{+}$ states via direct measurements of E0 transitions. Beam development is requested to provide pure and instense $^{186}$Pb beam.

  2. Formation, tidal evolution, and habitability of the Kepler-186 system

    Bolmont, Emeline; Raymond, Sean N.; Selsis, Franck; Hersant, Franck [Univ. Bordeaux, Laboratoire d' Astrophysique de Bordeaux, UMR 5804, F-33270 Floirac (France); Von Paris, Philip [Institut für Planetenforschung, Deutsches Zentrum für Luft- und Raumfahrt (DLR), Rutherfordstrasse 2, D-12489 Berlin (Germany); Quintana, Elisa V. [SETI Institute, 189 Bernardo Avenue, Suite 100, Mountain View, CA 94043 (United States); Barclay, Thomas, E-mail: bolmont@obs.u-bordeaux1.fr [NASA Ames Research Center, Moffett Field, CA 94035 (United States)

    2014-09-20

    The Kepler-186 system consists of five planets orbiting an early M dwarf. The planets have physical radii of 1.0-1.50 R {sub ⊕} and orbital periods of 4-130 days. The 1.1 R {sub ⊕} Kepler-186f with a period of 130 days is of particular interest. Its insolation of roughly 0.32 S {sub ⊕} places it within the surface liquid water habitable zone (HZ). We present a multifaceted study of the Kepler-186 system, using two sets of parameters which are consistent with the data and also self-consistent. First, we show that the distribution of planet masses can be roughly reproduced if the planets were accreted from a high surface density disk presumably sculpted by an earlier phase of migration. However, our simulations predict the existence of one to two undetected planets between planets e and f. Next, we present a dynamical analysis of the system including the effect of tides. The timescale for tidal evolution is short enough that the four inner planets must have small obliquities and near-synchronous rotation rates. The tidal evolution of Kepler-186f is slow enough that its current spin state depends on a combination of its initial spin state, its dissipation rate, and the stellar age. Finally, we study the habitability of Kepler-186f with a one-dimensional climate model. The planet's surface temperature can be raised above 273 K with 0.5-5 bars of CO{sub 2}, depending on the amount of N{sub 2} present. Kepler-186f represents a case study of an Earth-sized planet in the cooler regions of the HZ of a cool star.

  3. Candidate materials to prevent brittle fracture - (186)

    For heavy transport or dual purpose casks, selecting the appropriate materials for the body is a key decision. To get a Type B(U) approval, it is necessary to demonstrate that the mechanical strength of the material is good enough at temperature as low as -40 C so as to prevent the cask from any risk of brittle fracture in regulatory accident conditions. Different methods are available to provide such a demonstration and can lead to different choices. It should be noted also that the material compositions given by national or international standards display relatively wide tolerances and therefore are not necessarily sufficient to guarantee a required toughness. It is therefore necessary to specify to the fabricator the minimum value for toughness, and to verify it. This paper gives an overview of the different methods and materials that are used in several countries. Although the safety is strongly linked to the choice of the material, it is shown that many other parameters are important, such as the design, the fabrication process (multi layer, cast or forged body), the welding material and process, the ability to detect flaws, and the measured and/or calculated stress level, including stress concentration, in particular when bolts are used. The paper will show that relying exclusively on high toughness at low temperature does not necessarily deliver the maximum safety as compared with other choices. It follows that differences in approaches to licensing by different competent authorities may bias the choice of material depending on the country of application, even though B(U) licenses are meant to guarantee unilaterally a uniform minimum level of safety

  4. 27 CFR 555.186 - Seizure or forfeiture.

    2010-04-01

    ... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Marking of Plastic Explosives § 555.186 Seizure or forfeiture. Any plastic explosive that does not contain a detection agent in violation of 18 U... of this chapter for regulations on summary destruction of plastic explosives that do not contain...

  5. Systemic application of rhenium-186 hydroxyethylidenediphosphonate ({sup 186}Re HEDP) as an option for the treatment of chronic arthritis and arthropathy[Radiosynoviorthesis]; Systemische Applikation von Rhenium-186 Hydroxyethylidendiphosphonat ({sup 186}Re HEDP) als Therapieoption bei chronischen Arthritiden und Arthropathien

    Bucerius, J.; Biersack, H.J.; Palmedo, H. [Klinik und Poliklinik fuer Nuklearmedizin, Universitaetsklinikum Bonn (Germany); Wallny, T. [Orthopaedische Klinik l, Klinik fuer Orthopaedische Chirurgie, St. Bernhard-Hospital Kamp-Lintfort (Germany); Klinik und Poliklinik fuer Orthopaedie, Universitaetsklinikum Bonn (Germany); Brackmann, H.H. [Inst. fuer experimentelle Haematologie und Transfusionsmedizin, Universitaetsklinikum Bonn (Germany)

    2006-03-15

    Chronic arthritis is very common and is associated with a variety of systemic diseases whereas hemophilic arthropathy is one of the most common clinical manifestations of hemophilia, mainly of hemophilia type A. All of these polyarticular diseases are associated with progressive pain and increasing lack of mobility. Therapy is based on conservative treatment such as medication with non-steroidal anti-inflammatory drugs, selective therapy strategies such as intraarticular injections of e.g. radioactive substances (radiosynoviorthesis) or surgical interventions. However, in some cases, the disease does not respond to one of these treatment options or cannot be continued due to important side-effects. Systemic application of radioisotopes like {sup 186}Re HEDP has been successfully administered for pain palliation of osseous metastases. Today, only few data exist for systemic therapy with {sup 186}Re HEDP in patients suffering from benign polyarticular disease. In a prospective study with patients suffering from chronic arthritis a single systemic application of {sup 186}Re HEDP led to a reduction of disease activity in six of eight and to a reduction of the number of painful or swollen joints in five of eight included patients. In a further prospective study with 12 patients with hemophilic arthropathy, 19 of 36 (52.7%) most painful joints could be successfully treated with one systemic {sup 186}Re HEDP therapy. Furthermore, a reduction of global pain could be observed in those patients. However, further randomized studies with larger study populations are necessary in order to confirm this promising results. (orig.)

  6. 27 CFR 25.186 - Record of beer transferred.

    2010-04-01

    ... Ownership § 25.186 Record of beer transferred. (a) Preparation of invoice. When beer is transferred between breweries without payment of tax, the shipping brewer shall prepare a serially numbered invoice or commercial record, in duplicate, covering the transfer. The invoice will be marked “transfer without...

  7. Fisiognomica a Qumran: a proposito di 4Q186

    Catastini, Alessandro

    2010-06-01

    Full Text Available In a previous study, the Author singled out physiognomonic practice by Essenes according to Flavius Josephus’ source in Ant II, 119-161. In this article, the research is extended to the Qumranic manuscript 4Q186, a parchment carrying a text whose content is manifestly physiognomonic. In consequence of a comparison between this text and the so-called Two Spirits Treatise of 1QS, the Author argues that the expression רוח לו, utilised in 4Q186, points out the “typology” of the spirit of the individuals that are considered in this text.

    En un estudio previo, el autor había estudiado la práctica fisiognómica de los esenios a partir de la evidencia recogida por Flavio Josefo (Ant II, 119-161. En esta ocasión, la investigación se extiende al manuscrito 4Q186, cuyo texto tiene un contenido claramente fisiognómico. La comparación entre este texto y el denominado Tratado de los Dos Espíritus (1QS, lleva al autor a señalar que la expresión רוח לו utilizada en 4Q186 muestra la «tipología» del espíritu de los individuos de los que trata este texto.

  8. Alpha particle induced reactions on natCr up to 39 MeV: Experimental cross-sections, comparison with theoretical calculations and thick target yields for medically relevant 52gFe production

    Thin natCr targets were obtained by electroplating, using 23.75 μm Cu foils as backings. In five stacked foil irradiations, followed by high resolution gamma spectroscopy, the cross sections for production of 52gFe, 49,51cumCr, 52cum,54,56cumMn and 48cumV in Cr and 61Cu,68Ga in Cu were measured up to 39 MeV incident α-particle energy. Reduced uncertainty is obtained by simultaneous remeasurement of the natCu(α,x)67,66Ga monitor reactions over the whole energy range. Comparisons with the scarce literature values and results from the TENDL-2013 on-line library, based on the theoretical code family TALYS-1.6, were made. A discussion of the production routes for 52gFe with achievable yields and contamination rates was made

  9. Assessment of 186Re chelate-conjugated bisphosphonate for the development of new radiopharmaceuticals for bones

    Introduction: The preferable pharmacokinetics of rhenium-186 (186Re)-monoaminemonoamidedithiol-conjugated or 186Re-mercaptoacetyltriglycine-conjugated bisphosphonates (BPs) suggested that the molecular design would be applicable to other radionuclides such as 68Ga, 99mTc, 153Sm and 177Lu. In this study, a key factor affecting the pharmacokinetics of a chelate-conjugated BP was investigated to estimate the validity and the applicability of molecular design. Methods: Chemically inert and well-characterized tricarbonyl[186Re][(cyclopentadienylcarbonyl amino)-acetic acid]rhenium ([186Re]CpTR-Gly) was conjugated with 3-amino-1-hydroxypropylidene-1,1-bisphosphonate and purified by high-performance liquid chromatography (HPLC) to prepare [186Re](1-{3-[tricarbonyl(cyclopentadienylcarbonyl amino)-acetylamido]-1-hydroxy-1-phosphono-propyl}-phosphonic acid)rhenium ([186Re]CpTR-Gly-APD). Plasma stability, plasma protein binding, hydroxyapatite (HA) binding and the pharmacokinetics of [186Re]CpTR-Gly-APD were compared with those of 186Re 1-hydroxyethylidene-1,1-diphosphonate (HEDP). The effect of HEDP coadministration and preadministration on the pharmacokinetics of [186Re]CpTR-Gly-APD was also determined. Results: The HPLC-purified [186Re]CpTR-Gly-APD showed higher plasma stability, higher HA binding, higher bone accumulation and lower plasma protein binding than did 186Re-HEDP. However, HA binding of [186Re]CpTR-Gly-APD decreased to levels slightly higher than that of 186Re-HEDP at similar HEDP concentrations. Bone accumulation of [186Re]CpTR-Gly-APD also decreased to levels similar to that of 186Re-HEDP when [186Re]CpTR-Gly-APD was coinjected with HEDP equivalent to that in 186Re-HEDP. In contrast, HEDP pretreatment did not impair bone accumulation of the two 186Re-labeled compounds. However, a delay in blood clearance and an increase in renal radioactivity levels were observed particularly with 186Re-HEDP. Conclusions: Although 186Re-HEDP possessed HA binding and bone

  10. Dosimetric comparison of 4 MeV and 6 MeV electron beams for total skin irradiation

    In this study, dosimetric aspects of TSEI consisting of a 4 MeV beam with no spoiler were investigated in comparison to a nominal 6 MeV beam with spoiler, and the potential for clinical applications was evaluated. The TSEI technique is based on the Stanford technique, which utilizes a beam configuration of six-dual fields. MOSFETs were used to measure the optimal gantry angle, profile uniformity, and absolute dose at the calibration point. The depth dose curve of the central axis was measured in the treatment plane using EBT2 film. Photon contamination was measured as the dose at 5 cm depth in a solid water phantom relative to the maximum dose using a parallel plate ion chamber. A MOSFET dosimeter placed on the surface of a humanoid phantom, and EBT2 films inserted into a humanoid phantom were used to verify the TSEI commissioning. Dosimetric aspects of the 4 MeV TSEI beam, such as profile uniformity (±10%) and relative photon contamination (<0.001%), were comparable to those of a 6 MeV TSEI beam. The relative depth dose of the 4 MeV electrons was 81.4% at the surface and 100% at 0.4 cm. For the 6 MeV electrons, the relative depth dose was 93.4% at the surface and 100% from 0.2 cm to 0.4 cm. The calculated B-factor of the 4 MeV TSEI beam was 1.55, and 1.53 for the 6 MeV TSEI. 80% of the prescribed dose was obtained at 0.22 cm depth for the 4 MeV TSEI beam and 0.53 cm for the 6 MeV TSEI beam in the humanoid phantom measurement. The suggested 4 MeV beam for TSEI could be applied to shallow depth skin diseases and to electron boost as second treatment course

  11. Biodistribution and dosimetric evaluation of 186Re hydroxy ethylen diphosphate

    The pharmacokinetics and the dose of radiation absorbed in different body tissues by the administration of 186Re HEDP (hydroxyethylendiphosphate). The radiation dose in the standard man was established between 5,5 and 25 rad/mCi for red marrow, and red marrow and bone respectively; the radiation dose in metastases would be of 125 rad/mCi. It is concluded that this radiopharmaceutical is suitable for palliative treatment for pain with the mentioned patollogy. (M.E.L.)

  12. Alpha particle induced reactions on {sup nat}Cr up to 39 MeV: Experimental cross-sections, comparison with theoretical calculations and thick target yields for medically relevant {sup 52g}Fe production

    Hermanne, A.; Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel, Brussel 1090 (Belgium); Tárkányi, F.; Takács, S. [Institute of Nuclear Research, Hungarian Academy of Science, 4026 Debrecen (Hungary)

    2015-08-01

    Thin {sup nat}Cr targets were obtained by electroplating, using 23.75 μm Cu foils as backings. In five stacked foil irradiations, followed by high resolution gamma spectroscopy, the cross sections for production of {sup 52g}Fe, {sup 49,51cum}Cr, {sup 52cum,54,56cum}Mn and {sup 48cum}V in Cr and {sup 61}Cu,{sup 68}Ga in Cu were measured up to 39 MeV incident α-particle energy. Reduced uncertainty is obtained by simultaneous remeasurement of the {sup nat}Cu(α,x){sup 67,66}Ga monitor reactions over the whole energy range. Comparisons with the scarce literature values and results from the TENDL-2013 on-line library, based on the theoretical code family TALYS-1.6, were made. A discussion of the production routes for {sup 52g}Fe with achievable yields and contamination rates was made.

  13. Pox 186: an ultracompact galaxy with dominant ionized gas emission

    Guseva, N G; Izotov, Yu I; Noeske, K G; Fricke, K J

    2004-01-01

    We present a ground-based optical spectroscopic and HST U, V, I photometric study of the blue compact dwarf (BCD) galaxy Pox 186. It is found that the emission of the low-surface brightness (LSB) component in Pox 186 at radii 3'' the light of the LSB component is contaminated by the emission of background galaxies complicating the study of the outermost regions. The surface brightness distribution in the LSB component can be approximated by an exponential law with a scale length alpha < 120 pc. This places Pox 186 among the most compact dwarf galaxies known. The derived alpha is likely to be an upper limit to the scale length of the LSB component because of the strong contribution of the gaseous emission. The oxygen abundance in the bright HII region derived from the 4.5m Multiple Mirror Telescope (MMT) and 3.6m ESO telescope spectra are 12+log(O/H)= 7.76+/-0.02 and 7.74+/-0.01 (~ Zsun/15), respectively, in accordance with previous determinations. The helium mass fractions found in this region are Y=0.248...

  14. Development of a {sup 186}Re-HEDP formulation and radio pharmacokinetics comparison with {sup 153}Sm-EDTMP; Desarrollo de una formulacion de {sup 186}Re-HEDP y comparacion radiofarmacocinetica con el {sup 153}Sm-EDTMP

    Bribiesca C, A.I

    1998-12-01

    Because of the growing interest in the use of the beta emitters radiopharmaceuticals applied to therapy in different cancer cases, we developed a formulation of {sup 186} Re-HEDP (hydroxy ethylidene diphosphonate) as a pain palliative in osseous metastases. Besides serving like therapeutic agent, together with the {sup 153} Sm-EDTMP (ethylene diamine tetra methylene phosphonate), which has already been synthesized and proved, labels EHDP could be very useful like a diagnostic agent in the pursuit of the illness. The irradiation conditions for Rhenium-186 were established by ORIGIN 2 codes for TRIGA reactors. A pharmaceutical formulation was developed employing a factorial experimental design obtaining a complex with a radiochemical purity over 90 %. The complexes {sup 186} Re-HEDP {sup 153} Sm-EDTMP were intravenous administered in BALB-C mice sacrifying them in several intervals of time in order to determine the cumulated activity in each organ to perform absorbed dose calculation by MIRD methodology (Medical Internal Radiation Dose). Radio pharmacokinetic data demonstrated that both complexes follow a biexponential kinetic of first order behavior. In the case of the {sup 186} Re-HEDP the value of the {alpha} constant was 0.2789 and {beta} 0.0006 with an effective dose of 2.56 (mSv)/MBq , while for the complex {sup 153} Sm-EDTMP the values of {alpha} to and {beta} were 0.9012 and and 0.616 respectively and the effective dose was 0.262 (mSv)/MBq. In conclusion, radiopharmaceutical {sup 153} Sm-EDTMP, showed a greater bone uptake and a minor effective dose, for which it is a better radiopharmaceutical, respect to with the formulation of {sup 186} Re-HEDP. (Author)

  15. 40 CFR 96.186 - Withdrawal from CAIR NOX Annual Trading Program.

    2010-07-01

    ... Trading Program. 96.186 Section 96.186 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS CAIR NOX Opt-in Units § 96.186 Withdrawal from CAIR NOX Annual...

  16. 40 CFR 97.186 - Withdrawal from CAIR NOX Annual Trading Program.

    2010-07-01

    ... Trading Program. 97.186 Section 97.186 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR NOX Opt-In Units § 97.186 Withdrawal from CAIR NOX Annual Trading Program. Except as...

  17. 26 CFR 1.186-1 - Recoveries of damages for antitrust violations, etc.

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Recoveries of damages for antitrust violations, etc. 1.186-1 Section 1.186-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... (continued) § 1.186-1 Recoveries of damages for antitrust violations, etc. (a) Allowance of deduction....

  18. Development of a 186Re-HEDP formulation and radio pharmacokinetics comparison with 153Sm-EDTMP

    Because of the growing interest in the use of the beta emitters radiopharmaceuticals applied to therapy in different cancer cases, we developed a formulation of 186 Re-HEDP (hydroxy ethylidene diphosphonate) as a pain palliative in osseous metastases. Besides serving like therapeutic agent, together with the 153 Sm-EDTMP (ethylene diamine tetra methylene phosphonate), which has already been synthesized and proved, labels EHDP could be very useful like a diagnostic agent in the pursuit of the illness. The irradiation conditions for Rhenium-186 were established by ORIGIN 2 codes for TRIGA reactors. A pharmaceutical formulation was developed employing a factorial experimental design obtaining a complex with a radiochemical purity over 90 %. The complexes 186 Re-HEDP 153 Sm-EDTMP were intravenous administered in BALB-C mice sacrifying them in several intervals of time in order to determine the cumulated activity in each organ to perform absorbed dose calculation by MIRD methodology (Medical Internal Radiation Dose). Radio pharmacokinetic data demonstrated that both complexes follow a biexponential kinetic of first order behavior. In the case of the 186 Re-HEDP the value of the α constant was 0.2789 and β 0.0006 with an effective dose of 2.56 (mSv)/MBq , while for the complex 153 Sm-EDTMP the values of α to and β were 0.9012 and and 0.616 respectively and the effective dose was 0.262 (mSv)/MBq. In conclusion, radiopharmaceutical 153 Sm-EDTMP, showed a greater bone uptake and a minor effective dose, for which it is a better radiopharmaceutical, respect to with the formulation of 186 Re-HEDP. (Author)

  19. Estimation of continental 187Os/186Os values by using 187Os/186Os and 143Nd/144Nd ratios in marine manganese nodules

    Turekian, Karl K.; Luck, Jean-Marc

    1984-01-01

    The relationship between 187Os/186Os and 143Nd/144Nd in different manganese nodule fields is used to determine the 187Os/186Os ratio of the continental terrains bounding the major ocean basins. The Atlantic Ocean drainages yield 187Os/186Os of about 11; the Pacific Ocean, between 25 and 36; and the western Indian Ocean, 20. By assuming a two-component continental crust composed of “ultramafic rocks” (high Os concentration, low 187Os/186Os) and “granite” with only radiogenic 187Os produced in ...

  20. Electret dosemeter response to electrons with energy of 3 Mev, 7 Mev, 11 Mev

    The preliminary results obtained when electret ionization chambers are irradiated with electron of 3, 7, 11 Mev, from 12 mevatron accelerators using a external cop of polyethylene and nylon are presented. (C.G.C.)

  1. Dicty_cDB: SFE186 [Dicty_cDB

    Full Text Available ipllcs Frame B: ---syi*xxidhnkhrlrrgy*mhpk*hnailkyylemv*lkxfqldsy*slxixxlisx ynl*lvdelyxyyar Frame C: ---vifkxxltiinta...ence from clone RP11-14B2 on chromosome 13q21.1-21.3 Contains GSSs and STSs. 40 1...b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 28.0 %: nuclear 8.0 %: cytoskeletal 4.0 %: ...Golgi 4.0 %: mitochondrial 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFE1-D/SFE186Q.Seq.d/ Representative seq. ID SFE18

  2. Dicty_cDB: SHB186 [Dicty_cDB

    Full Text Available omucin complex (Muc4) gene, promoter and partial cds. 32 2.2 2 AC116984 |AC116984.2 Dictyosteli...equence from clone DKEY-15F12 in linkage group 20 Contains the 5' end of the gene for a novel protein similar to vert....12.20 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AE004437_1261( AE004437 |pid:none) Hal...SH (Link to library) SHB186 (Link to dictyBase) - - - Contig-U11234-1 - (Link to Original...lvlngxklxl*wvmvxxhvilvxapl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val

  3. The neutron capture cross sections of 186;187;188 Os and their application to Re/Os cosmochronometer

    Fujii, Kaori; Mastinu, P; Milazzo, P M

    2009-01-01

    The aim of this thesis is a fine determination of 186;187;188Os neutron capture cross sections, in order to remove principal nuclear physics uncertainties on the age of the universe determined using the Re/Os cosmochronometer. A general introduction including stellar nucleosynthesis, nuclear cosmochronometry,available neutron facilities and neutron reaction features is given. Dedicated measurements of the 186;187;188Os capture cross sections have been performed at the CERN neutron time-of- ight facility, n TOF, in the neutron energy range from 1 eV up to 1 MeV. The details of the measurement and the data treatment are reported. Using obtained capture yields, resolved resonance region analysis is completed. Resonance parameters have been extracted from a full R-matrix fit. A statistical analysis has been performed and the related averaged resonance parameters are derived. This information is crucial for a complete understanding and modelling in terms of the Hauser-Feshbach statistical model of the capture and ...

  4. Attaining 186-nm light generation in cooled beta-BaB(2)O(4) crystal.

    Kouta, H; Kuwano, Y

    1999-09-01

    The transparency range of beta-BaB(2)O(4) (BBO) was expanded by means of cooling, and the resulting absorption coefficient at 193.4 nm was reduced to 0.29cm(-1) at 91 K from 1.39cm(-1) at 295 K. Further, generation of light at 186.0 nm (the measurement limit in air) by type I sum-frequency generation (SFG) based on fundamental (744-nm) and third-harmonic (248-nm) light from a Ti:sapphire laser was confirmed for cooled BBO. Calculations based on observed data for SFG wavelengths and phase-matching angles indicate a potential for cooled BBO to generate wavelengths as low as 181.7 nm. PMID:18073993

  5. 50 MeV polarimeter

    A description is given of the construction, operation and calibration of the 50 MeV polarimeter which was used at the ZGS. The dependence of the observed counts on various parameters, including the beam polarization, beam intensity and the solid angle in the two polarimeter arms is also discussed

  6. Cross sections and analyzing powers of 15N(p,n)15O at 200 MeV and 494 MeV

    Differential cross sections and analyzing powers have been measured for the 15N(p,n)15 O(g.s.) reaction at bombarding energies of 200 MeV and 494 MeV. The 494 MeV data were obtained at the LAMPF Neutron Time-Of-Flight Facility on an 82 m flight path with a resolution of about 2.7 MeV. The 200 MeV data were obtained at IUCF on a 76m flight path with a resolution of about 1.1 MeV. At both energies, the measured analyzing power is small, the magnitude is less than .2 for momentum transfers of less than 1 fm-1. In contrast, both Relativistic and standard DWIA calculations predict a maximum of A=-.7 near q=0.7 fm-1. 53 refs., 44 figs

  7. Re-186-bleomycine: Radiopharmaceutic for diagnosis and therapy

    Bleomycine is an antibiotic used for chemotherapy of several neoplasms. Earlier studies with labelling of bleomycine (BLM) with different radionuclide were done. It was tested for different kind of tumours imaging. Due to previous encouraging imaging results with BLM-Tc-99m , BLM-Co-57 and BLM-In-111 authors decided to check the possibility and methods of labelling BLM with Re-186 to obtain radiopharmaceuticals potentially suitable for diagnosis and treatment of some neoplastic tumours. Different methods of labelling were investigated. The best one are electrolytic and with use of cationic-Sn complex modified by using of gentisic acid and incubation of the reaction mixture at 100 deg. C for 10 min. (author)

  8. Production study of high specific activity NCA Re-186g by proton and deuteron cyclotron irradiation

    Very high specific activity (AS) 186gRe could be produced by either proton or deuteron cyclotron irradiation on highly enriched 186W target in no-carrier-added (NCA) form, leading to a AS very close to the theoretical carrier free (CF) value of 6.88 GBq μg-1. Thick Target Yields (TTYs), obtained irradiating both thick metal W targets of natural isotopic composition and highly enriched powdered 186W targets, were measured at different particles energies taking into account high accuracy and precision. The evaluation of radionuclidic purities of 186gRe obtained activating highly enriched 186W by both p and d were also carried out and accurately compared. The thin-target excitation functions for all Re (A = 181, 182, 183, 184, 186 and their metastable levels), and W and Ta coproduced radionuclides will be presented elsewhere in deep details. (author)

  9. Production of 186Re and 188Re, and synthesis of 188Re-DTPA

    Production of radioactive rhenium isotopes 186Re and 188Re, and synthesis of 188Re-DTPA have been studied. For 186Re, a production method by the 185Re(n, γ) 186Re reaction in a reactor has been established. For 188Re, a production method by the double neuron capture reaction of 186W, which produces a 188W/188Re generator, has been established. For synthesis of 188Re-DTPA, the optimum conditions, including pH, the amounts of regents and so on, have been determined. (author)

  10. 浅析两系“龙凤胎”—x186%The Elementary Analysis of Two Lines "twins" - X186

    南钟浩

    2012-01-01

    2003年在01-124稻田里发现不育株36-20S后,先后两年南北两地高低温条件下未得到不育株种子,因而采用"逐代展开法"保留其不育基因。2011年9月,发现其杂交后代不育株率高达42%。利用冬季南滨变温幅度大的条件,观察x186不育株稻茬、可育株单株和同代原种不育株的育性。结果表明x186G1S、x186HS是温敏不育系,起点温度为21~22℃,x186G2S、x186-1S、x186-2S是反温敏不育系,临界温度为25~26℃。x186同时含有温敏型不育基因和反温敏不育基因,因而称作"龙凤胎"。同时选育育性类型截然不同的两系不育系,既拓宽时空,又便于制、繁种。反温敏不育系的选育及应用,将为两系法杂交粳稻育种的发展和杂交粳稻的推广应用带来变革,x186便是北方早粳稻区两系法育种的拐点。%The sterile lines 36-20S was found in 01-124 paddy fields in 2003 which had no sterile seeds in a two years test under the north-south and low-high temperature condition.In order to retain its sterile gene,the "generational expansion method" was used.The hybrid sterility rate was as high as 42% in Sep.2011.By using the broad temperature variation in the winter of Nanbin,the rice stubble of sterile rice line X186,fertile individuals and the fertility of the original sterile individuals of the same generation were observed.The results showed that X186G1S and x186HS were temperature sensitive.The starting temperature was 21-22 ℃.X186G2S,x186-1S and X186-2S were antitemperature sensitive sterile line.The critical temperature was 25~26℃.X186 was named as "twins" since it contains both temperature sensitive sterile gene and anti-temperature sensitive sterile gene.The development of the anti temperature sensitive line X186-1S eliminated the bottleneck of the two-line hybrid rice breeding in the northeast early Japonica rice district.

  11. Light-particle emission from the fissioning nuclei sup 1 sup 2 sup 6 Ba, sup 1 sup 8 sup 8 Pt and sup 2 sup 6 sup 6 sup , sup 2 sup 7 sup 2 sup , sup 2 sup 7 sup 8 110: theoretical predictions and experimental results 24.75.+i; 25.85.-w; 25.60.Pj; 25.70.-z; Nuclear reactions 98Mo(28Si ,X) , E=166,187,204 MeV; 107Ag(19F ,X) , E=128,148 MeV; 154Sm(34S ,X) , E=160,203 MeV; 172Yb(16O ,X) , E=138 MeV; 208Pb(58Ni ,X) , (64Ni ,X) , 232Th(40Ca ,X) , 238U(40Ar ,X) , E=66 -186 MeV; Calculated fusion, fission sigma(L) , prefission particle multiplicities; Deduced entrance channel effects; Comparisons with data

    Pomorski, K; Surowiec, A; Kowal, M; Bartel, J; Dietrich, K G; Richert, J; Schmitt, C; Benoit, B; De Goes-Brennard, E; Donadille, L; Badimon, C

    2000-01-01

    We present a comparison of our model treating fission dynamics in conjunction with light-particle ( n,p,alpha ) evaporation with the available experimental data for the nuclei sup 1 sup 2 sup 6 Ba, sup 1 sup 8 sup 8 Pt and three isotopes of the element Z=110 . The dynamics of the symmetric fission process is described through the solution of a classical Langevin equation for a single collective variable characterizing the nuclear deformation along the fission path. A microscopic approach is used to evaluate the emission rates for prefission light particles. Entrance-channel effects are taken into account by generating an initial spin distribution of the compound nucleus formed by the fusion of two deformed nuclei with different relative orientations.

  12. AVERAGE REACTION CROSS-SECTIONS FOR 74-MEV TO 112-MEV ALPHA-PARTICLES ON I-127 AND CS-133

    WARNER, RE; WILSCHUT, HW; RULLA, WF; FELDER, GN

    1991-01-01

    The average reaction cross section for 74- to 112-MeV alpha particles on I-127 and Cs-133 was measured by a new method using a magnetic spectrograph and a CsI scintillation detector. The result, sigma-R = 2220+/-50 mb, is in good agreement with optical model calculations and finite-range microscopic

  13. Station Black-Out Analysis with MELCOR 1.8.6 Code for Atucha 2 Nuclear Power Plant

    Analia Bonelli; Oscar Mazzantini; Martin Sonnenkalb; Marcelo Caputo; Juan Matias García; Pablo Zanocco; Marcelo Gimenez

    2012-01-01

    A description of the results for a Station Black-Out analysis for Atucha 2 Nuclear Power Plant is presented here. Calculations were performed with MELCOR 1.8.6 YV3165 Code. Atucha 2 is a pressurized heavy water reactor, cooled and moderated with heavy water, by two separate systems, presently under final construction in Argentina. The initiating event is loss of power, accompanied by the failure of four out of four diesel generators. All remaining plant safety systems are supposed to be avail...

  14. THE ZR-90(N, P)Y-90 REACTION AT E(N) = 98 MEV

    CONDE, H; OLSSON, N; RAMSTROM, E; RONNQVIST, T; ZORRO, R; BLOMGREN, J; HAKANSSON, A; TIBELL, G; JONSSON, O; NILSSON, L; RENBERG, PU; OSTERLUND, M; UNKELBACH, W; WAMBACH, J; VANDERWERF, SY; ULLMANN, J; WENDER, SA

    1992-01-01

    Double-differential cross sections of the Zr-90(n, p) reaction have been measured at 98 MeV in the angular range 0-degrees-30-degrees for excitation energies up to 40 MeV. The spectra have been interpreted in terms of direct and multistep reactions. The contributions from the latter have been calcul

  15. Response of BGO sectors to protons up to 170 MeV

    The response to monoenergetic protons of 24 cm long pyramidal BGO sectors, designed for a 4π spectrometer, was measured up to 173 MeV by scattering 200 MeV protons off a polyethylene target. The experimental results are compared with lower energy results and Monte Carlo calculations performed with a modified version of the GEANT code. (orig.)

  16. (3He,t) reaction at 80MeV on 90Zr and 208Pb

    An experiment using the 80MeV 3He beam of the ISN cyclotron at Grenoble has been done on a target of 90Zr and another one of 208Bi. The 90Zr and 208Pb IAS angular distributions are fitted by DWBA calculations. For the previously reported Gamow Teller transition centered in 90Nb at 8.4MeV, two components are observed. The first one of M1 type is centered at 7.2MeV, the other one of unknown polarity at 9.7MeV

  17. 19 CFR 122.186 - Presentation of Customs access seal by other person.

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Presentation of Customs access seal by other person. 122.186 Section 122.186 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Presentation of Customs access seal by other person. If an approved Customs access seal is presented by...

  18. Nuclear model calculations of long-lived isomer production in neutron reactions for fusion reactor technology

    Intense neutron fluxes within fusion reactors that are currently being designed will lead to the activation of structural components, and to assess and minimize this radioactivity, nuclear cross sections are needed for neutrons with energies up to 20 MeV. We describe research performed for the International Atomic Energy Agency (IAEA) Coordinated Research Programme on activation cross sections for fusion reactor technology, which has selected certain high-priority reactions for both experimental and theoretical study. Using statistical model codes, we have investigated excitation function cross sections for radionuclide production in the reactions 94Mo(n,p)94Nb, 109Ag(n,2n)108mAg, 151Eu(n,2n)150m Eu, 153Eu(n,2n)152g+m2Eu, 159Tb(n,2n)158Tb, 187Re(n,2n)186mRe, 179Hf(n,2n)178m2Hf, 193Ir(n,2n)192m2Ir. Using our calculated results for the excitation functions, along with calculations by other groups, the theoretical excitation functions have been normalized to experimental values at 14.5 MeV to produce evaluated excitation functions. These evaluations can be used within radiation transport and nuclide inventory codes to design, and assess the environmental impact of, fusion reactors. 23 refs., 4 figs., 1 tab

  19. Nuclear model calculations of activation cross sections for fusion reactor technology

    Intense neutron fluxes within fusion reactors that are currently being designed will lead to the activation of structural components. To assess and minimize this radioactivity, nuclear cross sections are needed for neutrons with energies up to 20 MeV. We describe research performed for the International Atomic Energy Agency (IAEA) Coordinated Research Programme on activation cross sections for fusion reactor technology, which has selected certain high-priority reactions for both experimental and theoretical study. Using statistical model codes, we have investigated: (1) excitation function cross sections for radionuclide production in the reactions 94Mo(n,p)94Nb, 109Ag(n,2n)108mAg, 151Eu(n,2n)150mEu, 153Eu(n,2n)152g+m2Eu, 159Tb(n,2n)158Tb, 187Re(n,2n)186mRe, 179Hf(n,2n)178m2Hf, 193Ir(n,2n)192m2Ir; and (2) the systematical dependence of isomeric ratios on isomer spin and incident-energy. Using our calculated results for the excitation functions, along with calculations by other groups, the theoretical excitation functions have been normalized to experimental values at 14.5 MeV to produce evaluated excitation functions. These evaluations can be used within radiation transport and nuclide inventory codes to design and assess the environmental impact of fusion reactors. (orig.)

  20. Radiation effects on MOS and bipolar devices by 8 MeV protons, 60 MeV Br ions and 1 MeV electrons

    The radiation effects of the metal-oxide-semiconductor (MOS) and the bipolar devices are characterised using 8 MeV protons, 60 MeV Br ions and 1 MeV electrons. Key parameters are measured in-situ and compared for the devices. The ionising and nonionising energy losses of incident particles are calculated using the Geant4 and the stopping and range of ions in matter code. The results of the experiment and energy loss calculation for different particles show that different incident particles may give different contributions to MOS and bipolar devices. The irradiation particles, which cause a larger displacement dose within the same chip depth of bipolar devices at a given total dose, would generate more severe damage to the voltage parameters of the bipolar devices. On the contrary, the irradiation particles, which cause larger ionising damage in the gate oxide, would generate more severe damage to MOS devices. In this investigation, we attempt to analyse the sensitivity to radiation damage of the different parameter of the MOS and bipolar devices by comparing the irradiation experimental data and the calculated results using Geant4 and SRIM code. (condensed matter: structure, thermal and mechanical properties)

  1. Neutron inelastic scattering studies for lead-204. [Threshold energy to 10 MeV, transitions, cross sections, angular distributions

    Smith, D.L.; Meadows, J.W.

    1977-12-01

    A 9.57-g sample of lead metal, enriched to 99.7 percent /sup 204/Pb, was used in an investigation of neutron inelastic scattering from this rare isotope at the Argonne National Laboratory Fast-Neutron Generator Facility. Neutron excitation of the 66.9-m isomeric state at 2.186 MeV in /sup 204/Pb was measured from near threshold to approximately 10 MeV using activation techniques. Cross sections and a value for the isomeric half life were derived from these data. Time-of-flight techniques were employed to measure spectra of promptly-emitted gamma rays from the /sup 204/Pb(n;n',..gamma..)/sup 204/Pb reaction at neutron energies less than or equal to 3 MeV. Cross sections and angular distributions were derived from these data for several of the stronger transitions. Other available fast-neutron data for this isotope are reviewed briefly.

  2. Dosimetry for the treatment of cystic craniopharyngioma through radiocolloids with {sup 186} Re; Dosimetria para el tratamiento de craneofaringiomas quisticos mediante radiocoloide con {sup 186} Re

    Rojas, E.L.; Al-dweri, F.M.O.; Lallena, A.M. [Depto. de Fisica Moderna, Universidad de Granada (Spain); Bodineau, C.; Galan, P. [Servicio de Radiofisica Hospitalaria, Hospital Regional Universitario ' Carlos Haya' , 29010 Malaga (Spain)

    2003-07-01

    The cystic craniopharyngioma (CQ) are histologically benign tumors that can affect important organs, as the hypothalamus or the optic nerve. They are treated introducing, inside the cyst, a radioactive colloid. The wall constitutes the white volume and the dosimetry is usually carried out starting from analytic formulas that only are valid in the case of an homogeneous media, uniform and infinite. In this work it is studied the dosimetry of the CQ by means of Monte Carlo simulation (MC), taking in account the different materials and interfaces that conform them. We present the obtained results for the radionuclide {sup 186} Re. We have used the Monte Carlo code Penelope and we follow 5x10{sup 6} histories in each simulation. We supposed a size of CQ of 1.75 cm of radio and a wall thickness of 1 mm and we have varied the constituent materials of the interior of the cyst and of the wall. The analytic calculations that we carry out show an excellent agreement with the MC results for an unique media (water), as much for the beta radiation as for those originated of the Rhenium disintegration. However, when it takes in account the gel that is introduced in the tumor for the treatment and we vary the constituent material of the wall, we find important differences. Of the analysis of our results we can conclude that the dosimetry for the treatment of CQ based in the usual analytic formulas overestimates the doses really deposited in the wall of the CQ. (Author)

  3. Preparation of 186Re complexes of dimercaptosuccinic acid hydroxy ethylidine diphosphonate

    99mTc(V)-DMSA and 99mTc-HEDP are widely used for imaging medullary carcinoma and bone, respectively. 186Re-HEDP is now well established as a therapeutic radiopharmaceutical for palliation of pain due to bone metastases. It is expected that 186/188Re(V)-DMSA could find application for treating medullary carcinoma. In the present paper we report the work carried out for the preparation of 186Re complexes of DMSA and HEDP and their bio-distribution studies in Wistar rats. 186Re was prepared by irradiation of natural Re metal at a flux of 3x1013 neutrons/cm2/s for seven days and processed after a cooling period of four days. The specific activity of 186Re formed was ∼35 mCi/mg. Complexes with RC purity >98% could be prepared in both the cases by carefully optimizing the reaction conditions. Bio-distribution studies carried out in rats revealed that pharmacological behaviour of 186Re(V)-DMSA was similar to that of 99mTc(V)-DMSA. 186Re-HEDP showed a bone uptake of ∼ 30% at 3 h post injection which remained almost constant for 48 h. (author)

  4. MCI-186 (edaravone), a novel free radical scavenger, protects against acute autoimmune myocarditis in rats.

    Nimata, Masaomi; Okabe, Taka-aki; Hattori, Miki; Yuan, Zuyi; Shioji, Keisuke; Kishimoto, Chiharu

    2005-12-01

    In this study, we tested the hypothesis that MCI-186 (3-methyl-1-phenyl-2-pyrazolin-5-one; edaravone), a novel free radical scavenger, protects against acute experimental autoimmune myocarditis (EAM) in rats by the radical scavenging action associated with the suppression of cytotoxic myocardial injury. Recent evidence suggests that oxidative stress may play a role in myocarditis. We administered MCI-186 intraperitoneally at 1, 3, and 10 mg.kg(-1).day(-1) to rats with EAM for 3 wk. The results were compared with untreated rats with EAM. MCI-186 treatment did not affect hemodynamics. MCI-186 treatment (3 and 10 mg.kg(-1).day(-1)) reduced the severity of myocarditis as assessed by comparing the heart-to-body weight ratio and pathological scores. Myocardial interleukin-1beta (IL-1beta)-positive cells and myocardial oxidative stress overload with DNA damage in rats with EAM given MCI-186 treatment were significantly less compared with those of the untreated rats with EAM. In addition, MCI-186 treatment decreased not only the myocardial protein carbonyl contents but also the myocardial thiobarbituric acid reactive substance products in rats with EAM. The formation of hydroxyl radicals in MCI-186-treated heart homogenates was decreased compared with untreated heart homogenates. Furthermore, cytotoxic activities of lymphocytes of rats with EAM treated with MCI-186 were significantly lower compared with those of the untreated rats with EAM. Hydroxyl radicals may be involved in the development of myocarditis. MCI-186 protects against acute EAM in rats associated with scavenging hydroxyl free radicals, resulting in the suppression of autoimmune-mediated myocardial damage associated with reduced oxidative stress state. PMID:16100244

  5. A Monte Carlo comparison of PGNAA system performance using 252Cf neutrons, 2.8-MeV neutrons and 14-MeV neutrons

    Naqvi, A. A.

    2003-10-01

    Monte Carlo simulations were carried out to compare performance of a 252Cf neutron and a 14-MeV neutron-based prompt γ-ray neutron activation analysis (PGNAA) system with that of the 2.8-MeV neutron-based PGNAA system at King Fahd University of Petroleum and Minerals (KFUPM), Dhahran, Saudi Arabia. Since the energy of neutron beam used in the KFUPM PGNAA system is very close to that produced by a DD neutron generator, performance comparison between a DD and a DT neutron generator-based PGNAA system is highly desired. For the sake of comparison, the calculations were carried out for the PGNAA system with geometry similar to the KFUPM PGNAA system. These calculations were required to determine improvement in performance of the KFUPM PGNAA system if its 2.8-MeV neutron source is replaced by a 252Cf neutron source or a 14-MeV neutron source. Results of the calculations revealed that the geometry of the 252Cf neutron and the 2.8-MeV neutron-based PGNAA system are not significantly different but the geometry of the 14-MeV neutron-based system is significantly different from that of the 2.8-MeV neutron-based PGNAA system. Accordingly, the prompt γ-ray yields from the 252Cf neutron and the 2.8-MeV neutron-based PGNAA system is comparable but prompt γ-ray yields from 14-MeV neutron-based PGNAA system are about three times smaller than that from the 2.8-MeV neutron-based PGNAA system. This study has shown that performance of the 252Cf neutron-based PGNAA system is comparable with that of the 2.8-MeV neutron-based PGNAA system but the performance of the 14-MeV neutron-based PGNAA system is poorer than that of the 2.8-MeV neutron-based PGNAA system.

  6. A Monte Carlo comparison of PGNAA system performance using {sup 252}Cf neutrons, 2.8-MeV neutrons and 14-MeV neutrons

    Naqvi, A.A. E-mail: aanaqvi@kfupm.edu.sa

    2003-10-01

    Monte Carlo simulations were carried out to compare performance of a {sup 252}Cf neutron and a 14-MeV neutron-based prompt {gamma}-ray neutron activation analysis (PGNAA) system with that of the 2.8-MeV neutron-based PGNAA system at King Fahd University of Petroleum and Minerals (KFUPM), Dhahran, Saudi Arabia. Since the energy of neutron beam used in the KFUPM PGNAA system is very close to that produced by a DD neutron generator, performance comparison between a DD and a DT neutron generator-based PGNAA system is highly desired. For the sake of comparison, the calculations were carried out for the PGNAA system with geometry similar to the KFUPM PGNAA system. These calculations were required to determine improvement in performance of the KFUPM PGNAA system if its 2.8-MeV neutron source is replaced by a {sup 252}Cf neutron source or a 14-MeV neutron source. Results of the calculations revealed that the geometry of the {sup 252}Cf neutron and the 2.8-MeV neutron-based PGNAA system are not significantly different but the geometry of the 14-MeV neutron-based system is significantly different from that of the 2.8-MeV neutron-based PGNAA system. Accordingly, the prompt {gamma}-ray yields from the {sup 252}Cf neutron and the 2.8-MeV neutron-based PGNAA system is comparable but prompt {gamma}-ray yields from 14-MeV neutron-based PGNAA system are about three times smaller than that from the 2.8-MeV neutron-based PGNAA system. This study has shown that performance of the {sup 252}Cf neutron-based PGNAA system is comparable with that of the 2.8-MeV neutron-based PGNAA system but the performance of the 14-MeV neutron-based PGNAA system is poorer than that of the 2.8-MeV neutron-based PGNAA system.

  7. Combined in-beam electron and gamma-ray spectroscopy of (184,186)Hg

    Scheck, M; Rahkila, P; Butler, P A; Larsen, A C; Sandzelius, M; Scholey, C; Carrol, R J; Papadakis, P; Jakobsson, U; Grahn, T; Joss, D T; Watkins, H V; Juutinen, S; Bree, N; Cox, D; Huyse, M; Uusitalo, J; Leino, M; Ruotsalainen, P; Nieminen, P; Srebrny, J; Van Duppen, P; Herzan, A; Greenlees, P T; Julin, R; Herzberg, R D; Hauschild, K; Pakarinen, J; Page, R D; Peura, P; Gaffney, L P; Kowalczyk, M; Rinta-Antila, S; Saren, J; Lopez-Martens, A; Sorri, J; Ketelhut, S

    2011-01-01

    By exploiting the SAGE spectrometer a simultaneous measurement of conversion electrons and gamma rays emitted in the de-excitation of excited levels in the neutron-deficient nuclei (184,186)Hg was performed. The light Hg isotopes under investigation were produced using the 4n channels of the fusion-evaporation reactions of (40)Ar and (148,150)Sm. The measured K- and L-conversion electron ratios confirmed the stretched E2 nature of several transitions of the yrast bands in (184,186)Hg. Additional information on the E0 component of the 2(2)(+) -> 2(1)(+) transition in (186)Hg was obtained.

  8. NMR-ON measurement s of 187WFe, 187,183,186ReNi, 186ReFe and 203PbFe

    The magnetic hyperfine splitting frequencies of 187WFe, 182Re(jπ = 2+)Ni, 186ReNi, 186ReFe, 186ReFe and 203PbFe in a zero external magnetic field have been determined by the NMR-ON method at about 7 mK as 225.56(6), 130.9(1), 98.17(4), 136.6(4), 1007.0(3) and 58.43(3) MHz, respectively. With the known g-factors of g(186Re, 1-) = 1.739(3) and g(203Pb, 5/2-) = 0.27456(20), the following hyperfine fields were deduced: BHF(186ReNi) = -103.05(35) kG; BHF(186ReFe) = -759.7(13) kG; BHF(203PbFe) = +279.18(25) kG. Taking hyperfine anomalies into account, the g-factor of 183Re was deduced as vertical strokeg(183Re, 5/2+)vertical stroke = 1.267(6). With the assumption of Knight shift factor K = 0, the g-factors of 182Re and 187W and the hyperfine field of 187WFe were determined as vertical strokeg(182Re, 2+)vertical stroke = 1.63(5), vertical strokeg(187W, 3/2-)vertical stroke = 0.414(10) and BHF(187WFe) = -714(18) kG. The large hyperfine anomaly was deduced to be 183W Δ 187W = -0.124(22). (orig.)

  9. Dosimetry for the treatment of cystic craniopharyngioma through radiocolloids with 186 Re

    The cystic craniopharyngioma (CQ) are histologically benign tumors that can affect important organs, as the hypothalamus or the optic nerve. They are treated introducing, inside the cyst, a radioactive colloid. The wall constitutes the white volume and the dosimetry is usually carried out starting from analytic formulas that only are valid in the case of an homogeneous media, uniform and infinite. In this work it is studied the dosimetry of the CQ by means of Monte Carlo simulation (MC), taking in account the different materials and interfaces that conform them. We present the obtained results for the radionuclide 186 Re. We have used the Monte Carlo code Penelope and we follow 5x106 histories in each simulation. We supposed a size of CQ of 1.75 cm of radio and a wall thickness of 1 mm and we have varied the constituent materials of the interior of the cyst and of the wall. The analytic calculations that we carry out show an excellent agreement with the MC results for an unique media (water), as much for the beta radiation as for those originated of the Rhenium disintegration. However, when it takes in account the gel that is introduced in the tumor for the treatment and we vary the constituent material of the wall, we find important differences. Of the analysis of our results we can conclude that the dosimetry for the treatment of CQ based in the usual analytic formulas overestimates the doses really deposited in the wall of the CQ. (Author)

  10. True absorption and scattering of 50 MeV pions

    The inclusive pion inelastic scattering and true absorption cross sections at 50 MeV were measured for π+ on natural Li, C, Fe, Nb, Bi and for π- on C, Fe, Bi. The results show that π- cross sections are much larger than π+, the difference being significantly larger than expected from a simple Coulomb calculation. In particular, in 12C the absorption of negative pions is about twice that of positive pions

  11. Radiochemical studies and pharmacological behaviour of 186Re complexes of phosphonate ligands

    This paper describes the synthesis and characterization of phosphonic acid derivatives and their radiochemical studies with 186Re for the development of bone seeking radiopharmaceuticals. These ligands, when tagged with therapeutic radionuclides such as 186Re, 188Re could localize in the bone selectively. A series of α-aminomethyl phosphonic acid derivatives were synthesized by a Mannich type reaction. All the ligands were crystallized to solid derivatives and subsequently characterized using 1H-NMR spectroscopy. The ligands were complexed with 186Re having a specific activity of ∼40 mCi/mg (∼1.5 GBq). Complexes with RC purity 95% and above could be prepared by varying the reaction conditions. By carefully optimizing the reaction and storage conditions, complexes which were stable for over 3-8 days could be prepared. Biodistribution studies carried out in rats revealed varying uptake (18-28% skeletal uptake at 3 h post injection) for these 186Re complexes. (author)

  12. Stability of 186Re- and 188Re-DMSAs and removal of impurity in the product

    Complex compound of 186Re- and 188Re with meso-2,3-dimercaptosuccinic acid (DMSA) is expected to be effective against cancerous disease. This compound is synthesized with high radiochemical yield by use of SnCl2 as reducing reagent. However, the product contains a large amount of SnCl2 which is harmful to humans body. The removal of tin impurity was tested with cation exchange resin. 186Re-DMSA complex was also obtained with high radiochemical yield by use of other harmless reducing agents (L-ascorbic acid, Na2-SO3, H3PO3). Synthesized 186Re-DMSA by use of SnCl2 was stable in sodium acetate buffer for 5 hours, while survival amount of 186Re-DMSA synthesized by other reducing agents decreased in a short time. (author)

  13. Design study for the conversion of the Oak Ridge Isochronous Cyclotron from an energy constant of K=90 to K=300 MeV

    A possible method of achieving a K = 300 MeV cyclotron by increasing the average magnetic field of the Oak Ridge Isochronous Cyclotron (ORIC) from 18.6 to 33.9 kG with superconducting coils was investigated. (K is defined by the equation E/u = K(Q/A)2, where E/u is the energy per nucleon, Q is the ion charge, and A the atomic mass.) (U.S.)

  14. Preliminary study on a compact MeV focused ion nanobeam system

    A compact MeV focused ion nanobeam system has been developed to evaluate the effectiveness of a MeV focused ion beam lens system combining keV double acceleration lenses and an acceleration tube. The double acceleration lenses were developed to form keV gaseous ion nanobeam at JAEA. Lens parameters of the acceleration tube were estimated by a calculation code because its tube functions as a part of a focusing lens system. The magnification of a MeV lens system with the acceleration lenses and the acceleration tube was subsequently calculated using the lens parameters. The capability of the 2 MeV focused ion beam with 100 nm in diameter was demonstrated from the beam size calculation using the magnification. (author)

  15. The fusion-fission process in the reaction {sup 34}S+{sup 186}W near the interaction barrier

    Harca, I. M. [Flerov Laboratory of Nuclear Reactions, Joint Institute for Nuclear Research, (FLNR JINR) Dubna, Russia and Faculty of Physics, University of Bucharest - P.O. Box MG 11, RO 77125, Bucharest-Magurele (Romania); Dmitriev, S.; Itkis, J.; Kozulin, E. M.; Knyazheva, G.; Loktev, T.; Novikov, K. [Flerov Laboratory of Nuclear Reactions, Joint Institute for Nuclear Research, (FLNR JINR) Dubna (Russian Federation); Azaiez, F.; Gottardo, A.; Matea, I.; Verney, D. [IPN, CNRS/IN2P3, Univ. Paris-Sud, 91405 Orsay (France); Chubarian, G. [Cyclotron Institute, Texas A and M University, College Station, TX 77843-3366 (United States); Hanappe, F. [Universite Libre de Bruxelles (ULB), Bruxelles (Belgium); Piot, J.; Schmitt, C. [GANIL, CEA/DSM-CNRS/IN2P3, Bd Henri Becquerel, BP 55027, F-14076 Caen Cedex 5 (France); Trzaska, W. H. [Accelerator Laboratory of University of Jyväskylä (JYFL), Jyväskylä (Finland); Vardaci, E. [Dipartamento di Scienze Fisiche and INFN (INFN-Na), Napoli (Italy)

    2015-02-24

    The reaction {sup 34}S+{sup 186}W at E{sub lab}=160 MeV was investigated with the aim of diving into the features of the fusion-fission process. Gamma rays in coincidence with binary reaction fragments were measured using the high efficiency gamma-ray spectrometer ORGAM at the TANDEM Accelerator facility of I.P.N., Orsay, and the time-of-flight spectrometer for fission fragments (FF) registration CORSET of the Flerov Laboratory of Nuclear Reactions (FLNR), Dubna. The coupling of the ORGAM and CORSET setups offers the unique opportunity of extracting details for characterizing the fusion-fission process and gives information regarding production of neutron-rich heavy nuclei. The FF–γ coincidence method is of better use then the γ – γ coincidence method when dealing with low statistic measurements and also offers the opportunity to precisely correct the Dopler shift for in-flight emitted gamma rays. Evidence of symmetric and asymmetric fission modes were observed in the mass and TKE distributions, occurring due to shell effects in the fragments. Coincident measurements allow for discrimination between the gamma rays by accepting a specific range within the mass distribution of the reaction products. Details regarding the experimental setup, methods of processing the acquisitioned data and preliminary results are presented.

  16. Capture cross section measurements of 186,187,188Os at n-TOF: the resolved resonance region

    The neutron capture cross sections of 186,187,188Os have been measured at the CERN neutron time-of-flight facility, n-TOF, in the neutron energy range from 1 eV up to 1 MeV. In this contribution, we report the results of the analysis of the resolved resonance region (RRR). Resonance parameters have been extracted from a full R-matrix fit of the capture yields with the SAMMY code. A statistical analysis has been performed and the related average resonance parameters are derived. This information is crucial for a complete understanding and modeling in terms of the Hauser-Feshbach statistical model of the capture and inelastic reaction channels, required for the evaluation of the stellar reaction rates of these isotopes. Maxwellian average cross sections for the range of temperatures relevant for s-process nucleosynthesis have been derived from the combined information of the experimental data in the resolved and unresolved resonance regions. A brief account of the implications of this analysis in the estimation of the s-process component of the 187Os abundance and the related impact on the estimates of the time-duration of the galactic nucleosynthesis through the Re/Os clock is given. (authors)

  17. Capture cross section measurements of {sup 186,187,188}Os at n-TOF: the resolved resonance region

    Fujii, K.; Mosconi, M.; Milazzo, P.M.; Domingo-Pardo, C.; Kappeler, F.; Mengoni, A.; Abbondanno, U.; Aerts, G.; Alvarez, H.; A lvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, H.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Moreau, C.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    The neutron capture cross sections of {sup 186,187,188}Os have been measured at the CERN neutron time-of-flight facility, n-TOF, in the neutron energy range from 1 eV up to 1 MeV. In this contribution, we report the results of the analysis of the resolved resonance region (RRR). Resonance parameters have been extracted from a full R-matrix fit of the capture yields with the SAMMY code. A statistical analysis has been performed and the related average resonance parameters are derived. This information is crucial for a complete understanding and modeling in terms of the Hauser-Feshbach statistical model of the capture and inelastic reaction channels, required for the evaluation of the stellar reaction rates of these isotopes. Maxwellian average cross sections for the range of temperatures relevant for s-process nucleosynthesis have been derived from the combined information of the experimental data in the resolved and unresolved resonance regions. A brief account of the implications of this analysis in the estimation of the s-process component of the {sup 187}Os abundance and the related impact on the estimates of the time-duration of the galactic nucleosynthesis through the Re/Os clock is given. (authors)

  18. Neutron scattering and reactions on 59Co from 1 to 20 MeV

    The paper presents a complete analysis of all the interactions of neutrons with 59Co in the energy range 1-20 meV, excluding the resonance region at very low energies. Optical model calculations, compound nucleus calculations and Weisskopf-Ewing calculations are given. (U.K.)

  19. Carrier effect on radiolabeling the polynuclear pentavalent rhenium-186 complex of dimercaptosuccinic acid at alkaline pH: 186Re(V)-DMS

    Radiolabeling with rhenium (Re-186, Re-188), a tumor agent to resemble the pentavalent polynuclear technetium complex of dimercaptosuccinic acid (99mTc[V]-DMS) has been reported for radiotherapeutical use. Nevertheless, despite the periodic analogies between both radiometals, differences in the redox potential and the carrier concentration have made the radiolabeling of the rhenium counterpart difficult. In the present study, the effect of the carrier contained in the reactor-produced Re-186 was estimated as an important factor relevant to the Re-186 radiolabeling of DMS at an alkaline pH. Great effect of the carrier Re with an inverse correlation with the stannous ion was an interesting phenomenon relevant for an assumption on the Sn participation in the complex . Under strict control of various labeling parameters, the 186Re(V)-DMS was made available with high yield (93-97%) at an alkaline pH and at room temperature. The great effect of carrier offers support to the polymeric or polynuclear nature of the rhenium complex of DMS as depicted in the drug design basis of its parent Tc(V)-DMS. The biodistribution studies of Re(V)-DMS showed mimetic characteristics with its parent Tc(V)-DMS drug

  20. Challenges associated with Re-186: from 'carrier-free' 99mTc(V)-DMS to 'carrier' containing 186Re(V)-DMS

    Efforts on radiolabeling with rhenium (Re-186, Re-188), a tumor agent to resemble the pentavalent polynuclear technetium complex of dimercaptosuccinic acid [99mTc(V)-DMS] have been reported, for radiotherapeutical use. Nevertheless, in spite of the periodic analogies between both radiometals, differences in the redox potential and the carrier concentration have made the radiolabelling of the rhenium counterpart difficult. Based on the drug-design bases set for the Tc-complex, the present work is centred on the study of the carrier effect on the radiolabelling of the pentavalent DMS complex of both radiometals at an alkaline pH. Gathered data indicated very interesting effect of the carrier present in either the Tc-99m eluate or the reactor produced Re-186; although no effect of the carrier present in the generator eluate on the Tc-complex radiolabelling was detected, the great dependence of ligand and reducing agent on the Re amount present (two to four order higher than Tc) as carrier was noticeable in the Re-complex labelling. Under a good control of the above parameters, 186Re(V)-DMS was liable to be labeled with high yield (93-97%) at alkaline pH and room temperature. The mice biodistribution (Ehrlich Ascites Tumor bearing animals) of 186Re(V)-DMS superimposed that of 99mTc(V)-DMS in most tissue except the excretory organs. The interesting effect of radiometal carrier on the biological behavior of 99mTc(V)-DMS and 186Re(V)-DMS will be discussed. (author)

  1. Dose determination of 600 MeV proton irradiated specimens

    The calculation method for the experimental determination of the atomic production cross section from the γ activity measurements are presented. This method is used for the determination of some isotope production cross sections for 600 MeV proton irradition in MANET steel, copper, tungsten, gold and titanium. The results are compared with some calculation. These values are used to determine the dose of specimens irradiated in the PIREX II facility. The results are discussed in terms of the irradiation parameters. A guide for the use of the production cross section determined in the dosimetry experiment are given. (author) tabs., refs

  2. Polarization Observables in Deuteron Photodisintegration below 360 MeV

    Glister, J; Lee, B W; Gilman, R; Sarty, A J; Strauch, S; Higinbotham, D W; Piasetzky, E; Allada, K; Armstrong, W; Arrington, J; Beck, A; Benmokhtar, F; Berman, B L; Boeglin, W; Brash, E; Camsonne, A; Calarco, J; Chen, J P; Choi, Seonho; Chudakov, E; Coman, L; Craver, B; Cusanno, F; Dumas, J; Dutta, C; Feuerbach, R; Freyberger, A; Frullani, S; Garibaldi, F; Hansen, J -0; Holmstrom, T; Hyde, C E; Ibrahim, H; Ilieva, Y; de Jager, C W; Jiang, X; Jones, M K; Kang, H; Kelleher, A; Khrosinkova, E; Kuchina, E; Kumbartzki, G; LeRose, J J; Lindgren, R; Markowitz, P; Beck, S May-Tal; McCullough, E; Meekins, D; Meziane, M; Meziani, Z -E; Michaels, R; Moffit, B; Norum, B E; Oh, Y; Olson, M; Paolone, M; Paschke, K; Perdrisat, C F; Potokar, M; Pomatsalyuk, R; Pomerantz, I; Puckett, A; Punjabi, V; Qian, X; Qiang, Y; Ransome, R; Reyhan, M; Roche, J; Rousseau, Y; Saha, A; Sawatzky, B; Schulte, E; Shabestari, M; Shahinyan, A; Shneor, R; Sirca, S; Slifer, K; Solvignon, P; Song, J; Sparks, R; Subedi, R; Urciuoli, G M; Wang, K; Wojtsekhowski, B; Yan, X; Yao, H; Zhan, X; Zhu, X

    2010-01-01

    High precision measurements of induced and transferred recoil proton polarization in d(polarized gamma, polarized p})n have been performed for photon energies of 277--357 MeV and theta_cm = 20 degrees -- 120 degrees. The measurements were motivated by a longstanding discrepancy between meson-baryon model calculations and data at higher energies. At the low energies of this experiment, theory continues to fail to reproduce the data, indicating that either something is missing in the calculations and/or there is a problem with the accuracy of the nucleon-nucleon potential being used.

  3. Polarization observables in deuteron photodisintegration below 360 MeV

    Glister, Jacqueline; Lee, Byungwuek; Gilman, R; Sarty, Adam; Strauch, Steffen; Higinbotham, Douglas; Piasetzky, Eliazer; Allada, Kalyan; Armstrong, Whitney; Arrington, John; Beck, Arie; Benmokhtar, Fatiha; Berman, Barry; Boeglin, Werner; Brash, Edward; Camsonne, Alexandre; Calarco, John; Chen, Jian-Ping; Choi, Seonho; Chudakov, Eugene; Coman, Luminita; Craver, Brandon; Cusanno, Francesco; Dumas, Jonathan; Dutta, Chiranjib; Feuerbach, Robert; Freyberger, Arne; Frullani, Salvatore; Garibaldi, Franco; Hansen, Jens-Ole; Holmstrom, Timothy; Hyde, Charles; Ibrahim, Hassan; Ilieva, Yordanka; De Jager, Cornelis; Jiang, Xiaodong; Jones, Mark; Kang, Hoyoung; Kelleher, Aidan; Khrosinkova, Elena; Kuchina, Elena; Kumbartzki, Gerfried; LeRose, John; Lindgren, Richard; Markowitz, Pete; Beck, S. May-Tal; McCullough, Emily; Meekins, David; Meziane, Mehdi; Meziane, Zein-Eddine; Michaels, Robert; Moffit, Bryan; Norum, Blaine; Oh, Yongseok; Olson, Michael; Paolone, Michael; Paschke, Kent; Perdrisat, Charles; Potokar, Milan; Pomatsalyuk, Roman; Pomerantz, Ishay; Puckett, Andrew; Punjabi, Vina; Qian, Xin; Qiang, Yi; Ransome, Ronald; Reyhand, Meral; Roche, Julie; Rousseau, Yannick; Saha, Arunava; Sawatzky, Bradley; Schulte, Elaine; Hashemi Shabestari, Mitra; Shahinyan, Albert; Shneor, R; Sirca, Simon; Slifer, Karl; Solvignon, Patricia; Song, JeongSeog; Sparks, Rachel; Subedi, Ramesh; Urciuoli, Guido; Wang, Kebin; Wojtsekhowski, Bogdan; Yan, Xinhu; Yao, Huan; Zhan, Xiaohui

    2011-03-01

    High precision measurements of induced and transferred recoil proton polarization in d(polarized gamma, polarized p})n have been performed for photon energies of 277--357 MeV and theta_cm = 20 degrees -- 120 degrees. The measurements were motivated by a longstanding discrepancy between meson-baryon model calculations and data at higher energies. At the low energies of this experiment, theory continues to fail to reproduce the data, indicating that either something is missing in the calculations and/or there is a problem with the accuracy of the nucleon-nucleon potential being used.

  4. Further Analysis of Neutron Double-Differential Cross Section of n + 16O at 14.1 MeV and 18 MeV

    DUAN Jun-Feng; YAN Yu-Liang; WANG Ji-Min; SUN Xiao-Jun; ZHANG Jing-Shang

    2005-01-01

    By using a new reaction model for light nuclei, the double-differential cross section of total outgoing neutron with LUNF code for n + 16O reactions at En = 14.1 MeV and 18 MeV have been calculated and analyzed. In this paper the opened reaction channels, which have contribution to emitting the neutrons, are listed in detail. To improve the fitting results the direct inelastic scattering mechanism is involved. The calculating results agree fairly well with the experimental data at En = 14.1 MeV and the deviation from calculated results and experimental data in low energy region at En = 18 MeV has been analyzed. Since the possibility of 5He has been affirmed theoretically [J.S. Zhang,Sci. Chin. G 47 (2004) 137], so 5He emission from n + 16O reaction is taken into account, which plays an important role at the region of the outgoing neutron energy εn < 3 MeV in total outgoing neutron energy-angular spectrum. The calculated results indicate that the pre-equilibrium mechanism dominates the whole reaction processes, and the recoil effect in light nuclear reactions is essentially important.

  5. Antioxidant MCI-186 inhibits mitochondrial permeability transition pore and upregulates Bcl-2 expression.

    Rajesh, Katare Gopalrao; Sasaguri, Shiro; Suzuki, Ryoko; Maeda, Hironori

    2003-11-01

    Reperfusion after a period of ischemia is associated with the formation of reactive oxygen species (ROS) and Ca2+ overload resulting in the opening of a nonspecific pore in the inner membrane of the mitochondria, called the mitochondrial permeability transition pore (PTP), leading to cell damage. Although endogenous antioxidants are activated because of oxidative stress following ischemia, their levels are not high enough to prevent reperfusion injury. Hence there is always a need for exogenous supplement of antioxidants, especially after acute ischemia. Here we demonstrated the effects of the antioxidant 3-methyl-1-phenyl-2-pyrazolin-5-one (MCI-186) in preventing reperfusion injury of the heart by inhibition of PTP opening. Ischemia (30 min) by left coronary artery (LCA) occlusion and reperfusion (120 min) in Wistar rats after pretreatment with MCI-186 (10 mg/kg iv) infusion starting from 30 min before LCA occlusion resulted in 1) less area of myocardial infarction (19.2% vs. 61.6%), 2) well-maintained myocardial ATP content (P < 0.03 vs. control), 3) decreased mitochondrial swelling and reduced cytochrome c release, 4) increased expression of BCl-2, 5) lower prevalence of apoptotic cells (14.3% vs. 2.9%), and 6) reduced DNA fragmentation in the MCI-186-treated group. These cytoprotective effects of MCI-186 were inhibited on opening PTP before MCI-186 treatment with the PTP activators lonidamine (10 mg/kg iv) or atractyloside (5 mg/kg iv) but failed to inhibit the protective effects exerted by another antioxidant, allopurinol, suggesting that the PTP inhibiting property is specific for MCI-186. These results demonstrate that the radical scavenger MCI-186, by inhibiting the opening of the PTP, prevents necrosis and cytochrome c release and hence pathological apoptosis. PMID:12816747

  6. Production of the omega meson in the pd --> 3He omega reaction at 1450 MeV and 1360 MeV

    Schonning, K; Bashkanov, M; Berlowski, M; Bogoslawsky, D; Calén, H; Clement, H; Demirors, L; Ekström, C; Fransson, K; Geren, L; Gustafsson, L; Höistad, B; Ivanov, G; Jacewicz, M; Jiganov, E; Johansson, T; Keleta, S; Khakimova, O; Khemchandani, K P; Kren, F; Kullander, Sven; Kupsc, A; Kuzmin, A; Lindberg, K; Marciniewski, P; Morosov, B; Oelert, W; Pauly, C; Petren, H; Petukhov, Yu P; Povtorejko, A; Ruber, R J M Y; Scobel, W; Shafigullin, R; Shwartz, B; Skorodko, T; Sopov, V; Stepaniak, J; Tegner, P -E; Engblom, P Thorngren; Tikhomirov, V; Turowiecki, A; Wagner, G J; Wilkin, C; Wolke, M; Zabierowski, J; Zartova, I; Zlomanczuk, Yu

    2009-01-01

    The production of $\\omega$ mesons in the $pd \\to{}^3$He$ \\omega$ reaction has been studied at two energies near the kinematic threshold, $T_p=1450$ MeV and $T_p=1360$ MeV. The differential cross section was measured as a function of the $\\omega$ cm angle at both energies over the whole angular range. Whereas the results at 1360 MeV are consistent with isotropy, strong rises are observed near both the forward and backward directions at 1450 MeV. Calculations made using a two-step model with an intermediate pion fail to reproduce the shapes of the measured angular distributions and also underestimate the total cross sections.

  7. Shielding measurements for a 230 MeV proton beam

    Energetic secondary neutrons produced as protons interact with accelerator components and patients dominate the radiation shielding environment for proton radiotherapy facilities. Due to the scarcity of data describing neutron production, attenuation, absorbed dose, and dose equivalent values, these parameters were measured for 230 MeV proton bombardment of stopping length Al, Fe, and Pb targets at emission angles of 0 degree, 22 degree, 45 degree, and 90 degree in a thick concrete shield. Low pressure tissue-equivalent proportional counters with volumes ranging from 1 cm3 to 1000 cm3 were used to obtain microdosimetric spectra from which absorbed dose and radiation quality are deduced. Does equivalent values and attenuation lengths determined at depth in the shield were found to vary sharply with angle, but were found to be independent of target material. Neutron dose and radiation length values are compared with Monte Carlo neutron transport calculations performed using the Los Alamos High Energy Transport Code (LAHET). Calculations used 230 MeV protons incident upon an Fe target in a shielding geometry similar to that used in the experiment. LAHET calculations overestimated measured attenuation values at 0 degree, 22 degree, and 45 degree, yet correctly predicted the attenuation length at 90 degree. Comparison of the mean radiation quality estimated with the Monte Carlo calculations with measurements suggest that neutron quality factors should be increased by a factor of 1.4. These results are useful for the shielding design of new facilities as well as for testing neutron production and transport calculations

  8. Progress on theoretical calculation

    The calculation program NPPD-2 of neutron reaction data in the energy region from 10-11 to 20 MeV has been researched with extending the energy from 5 to 20 MeV. In this program, the cascade γ-de-excitations of the compound nucleus and residual nucleus are described by means of the Troubetzkoy's statistical model and the conservation relations of angular momentum and parity are are considered. This program may be used for the calculations of the natural element, with the number of isotopes less than 10. The program has been finished and the calculations for oxygen are being done in order to test the program. The reaction channels in n + 40Ca, which considered in NPPD-2, are presented

  9. Induced photonuclear interaction by Rhodotron-TT200 10 MeV electron beam

    Farshid Tabbakh; Mojtaba Mostajab Aldaavati; Mahdieh Hoseyni; Khadijeh Rezaee Ebrahim Saraee

    2012-02-01

    In this paper the photonuclear interaction induced by 10 MeV electron beam generating high-intensity neutrons is studied. Since the results depend on the target material, the calculations are performed for Pb, Ta and W targets which have high , in a simple geometry. MCNPX code has been used to simulate the whole process. Also, the results of photon generation has been compared with the experimental results to evaluate the reliability of the calculation. The results show that the obtained neutron flux can reach up to 1012 n/cm2 /s with average energies of 0.9 MeV, 0.4 MeV and 0.9 MeV for these three elements respectively with the maximum heat deposited as 3000 W/c3,4500 W/c3 and 6000 W/c3.

  10. Two body photodisintegration of the deuteron from 100 to 800 MeV

    The total and the differential cross sections for the D(γ,p)n reaction have been measured over the photon energy range 100-800 MeV at the 855 MeV MAMI Microtron in Mainz. The data are presented in the form of thirty-five angular distributions at c.m. proton angles between 30 deg-160 deg in 10 deg intervals and at photon energies in steps of 20 MeV. Previous experimental work is reassessed in the light of the present results and the results compared with some recent theoretical calculations. (author)

  11. Investigation of 186Re via radiative thermal-neutron capture on 185Re

    Matters, D. A.; Lerch, A. G.; Hurst, A. M.; Szentmiklósi, L.; Carroll, J. J.; Detwiler, B.; Révay, Zs.; McClory, J. W.; McHale, S. R.; Firestone, R. B.; Sleaford, B. W.; Krtička, M.; Belgya, T.

    2016-05-01

    Partial γ -ray production cross sections and the total radiative thermal-neutron capture cross section for the 185Re(n ,γ ) 186Re reaction were measured using the Prompt Gamma Activation Analysis facility at the Budapest Research Reactor with an enriched 185Re target. The 186Re cross sections were standardized using well-known 35Cl(n ,γ )36Cl cross sections from irradiation of a stoichiometric natReCl3 target. The resulting cross sections for transitions feeding the 186Re ground state from low-lying levels below a cutoff energy of Ec=746 keV were combined with a modeled probability of ground-state feeding from levels above Ec to arrive at a total cross section of σ0=111 (6 ) b for radiative thermal-neutron capture on 185Re. A comparison of modeled discrete-level populations with measured transition intensities led to proposed revisions for seven tentative spin-parity assignments in the adopted level scheme for 186Re. Additionally, 102 primary γ rays were measured, including 50 previously unknown. A neutron-separation energy of Sn=6179.59 (5 ) keV was determined from a global least-squares fit of the measured γ -ray energies to the known 186Re decay scheme. The total capture cross section and separation energy results are comparable to earlier measurements of these values.

  12. Reactor calculation benchmark PCA blind test results

    Further improvement in calculational procedures or a combination of calculations and measurements is necessary to attain 10 to 15% (1 sigma) accuracy for neutron exposure parameters (flux greater than 0.1 MeV, flux greater than 1.0 MeV, and dpa). The calculational modeling of power reactors should be benchmarked in an actual LWR plant to provide final uncertainty estimates for end-of-life predictions and limitations for plant operations. 26 references, 14 figures, 6 tables

  13. The Pb-208(n,p)Tl-208 reaction at E-n=97 MeV

    Ringbom, A; Hakansson, A; Tibell, G; Zorro, R; Blomgren, J; Conde, H; Rahm, J; Olsson, N; Ramstrom, E; Ronnqvist, T; Jonsson, O; Nilsson, L; Renberg, PU; vanderWerf, SY; Lenske, H

    1997-01-01

    Double-differential cross sections of the Pb-208(n,p) reaction have been measured at 97 MeV in the angular range 0 degrees-30 degrees for excitation energies up to 40 MeV. The experimental proton spectra have been compared with calculated spectra obtained with a statistical multistep direct reaction

  14. The dosimetry of 3 MeV and 14 MeV neutrons with the ferrous sulphate solution

    The aim of the present work is to determine the G value of a standard ferrous sulphate solution for neutrons with mean energies of 3 MeV and 14 MeV. The number of the transformed Fe ions is evaluated by means of a spectrophotometrical procedure and the absorbed energy is determined by applying the ionometrical method. Especial attention is payed to the calculation of the mean total dose in the irradiated sample taking radiation attenuation into account. For this purpose the spatial distribution of absorbed energy within the probe is determined. Further, it is investigated how the fraction of the γ component in the total absorbed dose varies in the sample, in order to evaluate its mean value, which is needed for the final determination of the G value for the neutron component. (orig.)

  15. Developing the 186 Re radiolabelling procedures of peptides and monoclonal antibodies

    Mono and poli-clonal antibodies are the most recent candidate molecules for the radiopharmaceutical preparation used in radioimmunotherapy and radiodiagnostic. Our study presents results in 186 Re direct labelling of HIgG (Human Immunoglobulin G) poli-clonal antibody. The steps in labelling process are: 1. pre-reduction -S-S- bridges of HIgG molecule with ascorbic acid in pH = 3.5 - 4.5; 2. preparation of the reducing system for 186 ReO4 - in presence of Sn2+ ions excess and 3. coupling 186 Re (red) to -SH groups of biomolecules. The specific reactions of each step above are controlled by: incubation time and temperature, pH, molar ratio 186 Re: HIgG. 186 Re-HIgG samples were purified by gel elution chromatography method and the quality control was performed by chromatography techniques. To labelled of HIgG we effected the pre-reduction of -S-S- bridges of biomolecules to sulfhydryls using the following reducing agents: ascorbic acid, cysteine, active hydrogen, 2,3 dimercaptopropanol. The pre-reduction reactions are controlled by mass ratios of reduction agent/biomolecule, pH, temperature and time of incubation. HIgG was the biomolecule used in the pre-reduction reactions. The specific parameters for each systems are presented. The stannous chloride was used as reducing agent in two systems, SnCl2 : 0.05 N HCl and SnCl2: 20 mg/ml citric acid. The coupling reaction of 186 Re (red) with the biomolecule has been controlled by time and incubation temperature and the influence of pH regarding the binding of 186 Re to the biomolecule. 186 Re-HIgG was obtained by: i) incubation at the room temperature, 1 hour time of HIgG in thiol form and 186 Re in reducing form and ii) incubation of HIgG in thiol form, at 37 deg C and 22 hours time, with adding after pre-reduction of SnCl2 and Na 186 ReO4. Quality control was effected by chromatography techniques (paper and gel chromatography) on labelled biomolecule before and after purification. The elution gel chromatography was

  16. Separation and identification of new neutron-rich isotope 186Hf

    A new neutron-rich nuclide 186Hf is produced and identified by bombardment of natural tungsten samples with 60 MeV/u 18O beams using rapid radiochemical separation method and γ spectroscopic measurement technique for the first time. The half-life of the new neutron-rich isotope 186Hf is determined to be (2.6 +- 1.2) min by a radioactive series decay analytical program to fit the growth and decay curve. The chemical yield of element hafnium is more than 60% and the decontamination factor of tantalum is higher than 102 in the chemical separation

  17. Scattering of MeV neutrons from elemental iron

    Neutron elastic- and inelastic-scattering cross sections of elemental iron are measured from 1.5 to 4.0 MeV with incident-neutron resolutions of < or approx. = to 50 keV and at incident-neutron energy intervals of < or approx. = to 50 keV. Cross sections for the excitation of observed levels at 0.853, 1.389, 2.097, 2.579, 2.677, 2.974 and 3.152 MeV are determined. The observed elastic- and inelastic-scattering angular distributions fluctuate strongly with incident energy. The experimental results are averaged over broad energy intervals and interpreted in terms of spherical optical-statistical and coupled-channels models including consideration of direct-vibrational excitations. The importance of a comprehensive data base in such energy-averaged interpretations and of the direct-vibrational excitations is stressed. The present measured and calculated results, combined with those reported in the literature, are used to formulate an evaluated scattered-neutron data file in the ENDF format extending from 1.0 to 4.0 MeV. 41 references

  18. Reaction mechanism of light nuclei below 20 MeV

    The light nuclei are the elements in 1p shell. At the incident neutron energies below 20 MeV, the reaction mechanism could be classified as follows: 1. one particle emission, 2. sequential two particles emission, 3. the two cluster separation, when the residual are 8Be, 5He, 5Li, 4. three body break-up process, when the residual nuclei are 10Be, 6He. The Legendre expansion coefficients of the double differential cross section of outgoing particles in each type reaction mechanism are set up for the model calculating. The double differential cross section of secondary particle emission is calculated for light nuclei reaction and calculation formulation is also given. The problem on energy balance in light nuclear reaction is discussed

  19. A 600 MeV cyclotron for radioactive beam production

    The magnetic field design for a 600 MeV proton cyclotron is described. The cyclotron has a single stage, a normal conducting magnet coil and a 9.8 m outside yoke diameter. It has 8 sectors, with a transition to 4 sectors in the center region. The magnetic field design was done using 1958 Harwell rectangular ridge system measurements and was compared with recent 3-dimensional field calculations with the program TOSCA at NSCL. The center region 4--8 sector transition focussing was also checked with TOSCA

  20. 14MeV facility and research in IPPE

    Review of experimental facility and research, performed at 14MeV incident neutron energy in the Institute of Physics and Power Engineering, are given. These studies cover the next topics: double differential neutron emission cross sections (DDX), neutron-gamma coincidence experiments (n, n'γ) and neutron leakage spectra for spherical assemblies (benchmark). The paper contains description and main parameters of pulsed neutron generator KG-0.3, fast neutron time of flight spectrometer, measuring and data reduction procedures, review of experimental data. Results of experiments are compared with other data; evaluated data files BROND-2, ENDF/B6, JENDL-3; basic theoretical and transport model calculations. (author)

  1. 14-MeV neutron streaming through shield gaps

    Monte Carlo calculations have been performed to determine the neutron streaming through straight and single-bend gaps for three different shield thicknesses. A uniform plane source emitting 14-MeV neutrons with a cosine angular distribution was used in the analyses. The results obtained are discussed in terms of how they might be used in the early stages of a shield design to obtain approximate solutions to design questions. These results have direct implications regarding neutron-streaming problems that will be encountered in the shielding analyses of tokamak fusion reactors which are constructed from pie-shaped shield/vacuum chamber segments

  2. Absorbed dose distributions in patients with bone metastases from hormone refractory prostate cancer treated with Re-186 HEDP

    Full text of publication follows. Aim: intravenous administration of Re-186 hydroxyethylidene-diphosphonate (HEDP) is used for metastatic bone pain palliation in hormone refractory prostate cancer patients. Dosimetry for bone seeking radionuclides is challenging due to the complex structure with osteoblastic, osteolytic and mixed lesions. The aim of this study was to perform image-based patient-specific 3D convolution dosimetry to obtain a distribution of the absorbed doses to each lesion and estimate inter- and intra-patient variations. Materials and methods: 28 patients received a fixed 5 GBq activity of Re-186 HEDP followed by peripheral blood stem cell rescue at 14 days in a phase II trial. A FORTE dual-headed gamma camera was used to acquire sequential Single-Photon-Emission Computed Tomography (SPECT) data of the thorax and pelvis area at 1, 4, 24, 48 and 72 hours following administration. The projection data were reconstructed using filtered-back projection and were corrected for attenuation and scatter. Voxelised cumulated activity distributions were obtained with two different methods. First, the scans were co-registered and the time-activity curves were obtained on a voxel-by-voxel basis. Second, the clearance curve was obtained from the mean number of counts in each individual lesion and used to scale the uptake distribution taken at 24 hours. The calibration factors required for image quantification were obtained from a phantom experiment. An in-house developed EGSnrc Monte Carlo code was used for the calculation of dose voxel kernels for soft-tissue and cortical/trabecular bone used to perform convolution dosimetry. Cumulative dose-volume histograms were produced and mean absorbed doses calculated for each spinal and pelvic lesion. Results: preliminary results show that the lesion mean absorbed doses ranged from 25 to 55 Gy when the medium was soft tissue and decreased by 40% if bone was considered. The use of the cumulated activity distribution

  3. 9 CFR 381.186 - Cooperation of States and other jurisdictions in Federal programs.

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Cooperation of States and other... Cooperation With States and Territories; Certification of State and Territorial Programs as at Least Equal to Federal Program § 381.186 Cooperation of States and other jurisdictions in Federal programs. Under...

  4. 42 CFR 413.186 - Payment exception: Self-dialysis training costs in pediatric facilities.

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Payment exception: Self-dialysis training costs in....186 Payment exception: Self-dialysis training costs in pediatric facilities. (a) Qualification. To qualify for an exception to the prospective payment rate based on self-dialysis training costs,...

  5. 27 CFR 17.186 - Transfer of distilled spirits to other containers.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Transfer of distilled... TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DRAWBACK ON TAXPAID DISTILLED SPIRITS USED IN MANUFACTURING NONBEVERAGE PRODUCTS Miscellaneous Provisions § 17.186 Transfer of...

  6. Preparation of [186Re]Re-DMSA and its bio-distribution studies

    99mTc(V)-DMSA is widely used for imaging medullary carcinoma and hence 186/188Re(V)-DMSA is suggested as a potential agent for treating medullary carcinoma. In the present paper, we report the work carried out for the preparation of [186Re]Re(V)-DMSA and it's bio-distribution studies in Wistar rats. The complex was prepared by reducing 186Re (100 μg, 0.54 μM, ∼150 MBq) in the presence of DMSA (2 mg, 11 μM) with stannous chloride (0.4 mg, 2.2 μM) in acidic medium at pH 2. The reaction was taken to completion by heating the complex in a boiling water bath for 30 min. Bio-distribution studies carried out revealed that pharmacological behaviour of 186Re(V)-DMSA is similar to that of 99mTc(V)-DMSA except that the kidney uptake is marginally higher. The kidney uptake reduced significantly when the pH of the complex was adjusted to 8 prior to injection. The in vitro stability studies of this complex suggest that the product formed is stable and could be used for clinical trials

  7. Effect of MCI-186 on ischemia-induced changes in monoamine metabolism in rat brain.

    Oishi, R; Itoh, Y; Nishibori, M; Watanabe, T; Nishi, H; Saeki, K

    1989-11-01

    We examined the effects of MCI-186 (3-methyl-1-phenyl-2-pyrazolin-5-one), a novel free radical scavenger and an inhibitor of ischemia-induced brain edema, on monoamine metabolism in the brains of both normal and ischemic rats. In normal rats, 3 mg/kg i.v. MCI-186, a dose that prevents ischemic brain edema, had no significant effect on brain concentrations of dopamine, norepinephrine, 5-hydroxytryptamine, or their metabolites. After the injection of 5 microliters of 3% polyvinyl acetate into the left internal carotid artery, concentrations of 3,4-dihydroxyphenylacetic acid and homovanillic acid markedly increased, but that of norepinephrine decreased, in the left telencephalon of embolized rats compared with control rats injected with vehicle; the concentration of 5-hydroxyindoleacetic acid also increased slightly. These effects were maximal 2 hours after embolization. The turnover rate of dopamine between 6 and 8 hours after embolization was significantly higher but that of norepinephrine was slightly lower than that in vehicle-treated rats. When rats were treated with 3 mg/kg i.v. MCI-186 immediately after the injection of polyvinyl acetate, the embolization-induced changes in monoamine metabolism were less marked. Our results suggest that MCI-186 attenuates ischemia-induced changes in brain monoamine metabolism, probably due to its free radical scavenging action, although it has no marked effect in normal rats. PMID:2815191

  8. Neutron Energy Spectra from Neutron Induced Fission of 235U at 0.95 MeV a of 238U at 1.35 and 2.02 MeV

    The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 ± 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 ± 0.03 MeV at 1.35 MeV and 1.29 ± 0.02 MeV at 2.02 MeV

  9. 12 CFR 303.186 - Exemptions from insurance requirements for a state branch of a foreign bank.

    2010-01-01

    ... manner in which deposits will be solicited; (iv) How the activity will maintain or improve the... state branch of a foreign bank. 303.186 Section 303.186 Banks and Banking FEDERAL DEPOSIT INSURANCE.... A complete letter application shall include the following information: (i) The kinds of...

  10. Inelastic proton scattering at 30--40 MeV from 12C

    Elastic and inelastic proton differential cross sections for excitation of the following levels of 12C: 21+(4.43 MeV), 41+(14.08 MeV), 02+(7.65 MeV), and 31-(9.64 MeV) have been measured at three incident energies between 30 and 40 MeV. The data have been described by coupled channel calculations and form factors obtained by coupling surface vibrations to static deformations. The reproduction of the 02+ state data, if this state is assumed to be a β-vibrational state, requires a quadrupole β-vibrational amplitude which is 57% of the static quadrupole deformation and a mixing of the breathing mode of the nucleus with an amplitude that would correspond to about 1% of the E0 energy weighted sum rule. For the 31- state it is found that the performed calculations are sensitive to the K projection, with the angular distribution of the 31- state being better fitted assuming K/sup π/ = 3- band. Coupled channel calculations using microscopic form factors obtained from wave functions generated using the resonating group method have also been performed and are compared to the experimental data

  11. Three recent TDHF calculations

    Three applications of TDHF are discussed. First, vibrational spectra of a post grazing collision 40Ca nucleus is examined and found to contain many high energy components, qualitatively consistent with recent Orsay experiments. Second, the fusion cross section in energy and angular momentum are calculated for 16O + 24Mg to exhibit the parameters of the low l window for this system. A sensitivity of the fusion cross section to the effective two body potential is discussed. Last, a preliminary analysis of 86Kr + 139La at E/sub lab/ = 505 MeV calculated in the frozen approximation is displayed, compared to experiment and discussed

  12. 大地震的18.6年周期%The 18.6-year periodicity of great earthquakes

    杜品仁; 赵俊猛; 高祥林

    2011-01-01

    Dividing the world into 15 study areas and using the earthquake catalogue of Mw≥7. 0 during 1900~2009, we make a statistical analysis of the relationship between seismicity of each area and the period of lunar nodal motion. The result shows that among the 15 areas, 10 areas exhibit an 18. 6-year cycle of great earthquakes in statistical sense, which consists of a 12. 4-year active section and a 6. 2-year quiet section. In the eastern, northern, southern and western areas of the Circum-Pacific seismic belt, such a periodicity is present and their active sections have certain regularity. In terms of seismic events during the sixth cycle (1991~2009), this study has tested the stability and applicability of the 18. 6-year periodicity derived from earlier five cycles (1900- 1990). It is found that most of periodicities are stable in the regions with such characters. The possible mechanisms of the 18. 6-year periodicity are as follows: (1) Earthquakes are modulated by the 18. 6-year tide via day and half-day tides. (2) Effect of fluid tide in upper mantle (tide within the Earth). And (3) earthquakes are dictated by 18. 6-year tide through variation of Earth rotation.%将全球分为15个研究区,用1900~2009年Mw≥7.0地震目录,统计分析了各区大地震与月球交点运动周期的关系,得出15个研究区中有10个区,大地震存在统计意义上的18.6a周期:活跃段为12.4a,平静段为6.2a;环太平洋地震带北、南、西、东4大区的大地震,不仅有这样的周期,而且其地震活跃段的时间存在一定规律.用第6个18.6 a(1991~2009年)期间的大地震,检验据前5个18.6 a(1900~1990年)地震目录所得18.6 a周期的稳定性和实用性,发现有这种周期的地区多数的周期性是稳定的.大地震18.6 a周期的可能成因有:(1)18.6 a潮波通过调制日潮和半日潮调制大地震;(2)上地幔内流体的潮汐(地内潮)作用;(3)18.6 a潮波通过影响地球自转变化调制大地震.

  13. Palliative effect of Re-186 HEDP in different cancer patients with bone metastases

    The clinical picture of bone metastases is manifested by pain and loss of mechanical stability. Standard treatment options for bone metastases include external beam radiotherapy and the use of analgesics. Due to a large number of lesions in many patients, the use of radionuclide therapy with beta emitters may be preferable. Re-186 hydroxyethydilene diphosphonate (Re-186 HEDP) is one of the radiopharmaceuticals suitable for palliative treatment of metastatic bone pain. The aim of this study was to investigate palliative and side effects of Re-186 HEDP in pts with different type of cancers. Material and method: Thirty one (17 male, 14 female) patients with cancer (10 prostate, 10 breast, 4 rectum, 5 lung, 2 nasopharynx) and bone metastases were included in the study. Therapy was started with a fixed dose of 1295 MBq of Re-186 HEDP. If necessary, the same dose was repeated at least 3 times after an interval of 10-12 weeks A total of 40 standard doses (1295 MBq Re HEDP, Mallinckrodt, Holland) were given; 6 pts received repeated doses (3 doses in 3 pts, 2 doses in 3 pts). The pts with bone marrow suppression were excluded from the study. The pain relief was assessed with ECOG and Karnofsky status index. All pts were evaluated with standard evaluation forms filled daily a maximum of 10 weeks. Results: The respond rate was found as 87.5% in pts with breast and prostate Ca, 75% in pts with rectum Ca, 50% in pts with nasopharynx Ca and 20% in pts with lung Ca. The overall response rate was 67.5%. The palliation period varied between 6 to 10 weeks. The mean palliation period was 8.1 ± 1.3 weeks. Maximal palliation effect was observed between the 3rd and the 7th weeks. Any serious side effects were not seen except mild haematologic toxicity. Discussion and conclusion: It is concluded that Re-186 HEDP is a highly effective agent in the palliation of metastatic bone pain in pts with prostate, breast, rectum cancer, mildly effective in pts with nasopharynx cancer, but not

  14. <600> MeV synchro-cyclotron

    1971-01-01

    One of the 14 pancakes of the new magnet coils for the 600 MeV synchro-cyclotron which were wound and coated with epoxy resin on the CERN site. These new coils will replace the present ones which have been in use for more than 14 years but are now showing signs of deteriorations.

  15. MeV fullerene impacts on mica

    Doebeli, M.; Scandella, L. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Ames, F. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-09-01

    Hillock heights on mica irradiated with MeV C{sub 60} ions have been investigated systematically. Results show that the small range of secondary particles along the track plays a crucial role in defect production. (author) figs., tab., refs.

  16. Proton scattering from 4He at 500 MeV

    We calculate the optical potential for the scattering of 500 MeV protons from 4He using first-order Brueckner theory and compare with experimental data. The real part of the calculated potential has a 'wine bottle' shape in agreement with recent phenomenological analyses. The agreement with experiment is good for scattering angles less than 700. We also analyse the same data using the Dirac equation. The fits to the data over a wide angular range are very good. We find ambiguities in the relativistic potentials as several sets of parameters fit the data almost equally well. In all cases the real vector and scalar potentials exhibit central minima. The 'Schroedinger equivalent' potentials again have 'wine bottle' shapes. We discuss the similarities between the two approaches. (orig.)

  17. {sup 186}Re-Etidronate. Efficacy of palliative radionuclide therapy for painful bone metastases

    Han, S. H.; De Klerk, J. M. H.; Tan, S.; Van Rijk, P. P. [University Medical Center, Dept. of Nuclear Medicine, Utrecht (Netherlands); Zonnenberg, B. A. [University Medical Center, Oncology Section, Dept. of Internal Medicine, Utrecht (Netherlands)

    2001-03-01

    Pain palliation with bone-seeking radiopharmaceuticals is an effective treatment modality in patients with advanced metastatic bone cancer. Several studies have shown encouraging clinical results of palliative therapy using {sup 186}Re-HEDP, with an overall reported response rate of {+-} 71% for painful osseous metastasize prostate and breast cancer patients. {sup 186}Re-HEDP is a very potential isotope with numerous advantageous characteristics for this purpose. Myelosuppressive toxicity is limited and reversible, which makes repetitive treatment safe. However, individual studies are difficult to compare, and are hampered by the numerous and different methods used to assess clinical responses. Standardized clinical response assessment using the objective multi-dimensional pain evaluation model should therefore be implemented.

  18. Calculation of electron and isotopes dose point kernels with FLUKA Monte Carlo code for dosimetry in nuclear medicine therapy

    Mairani, A; Valente, M; Battistoni, G; Botta, F; Pedroli, G; Ferrari, A; Cremonesi, M; Di Dia, A; Ferrari, M; Fasso, A

    2011-01-01

    Purpose: The calculation of patient-specific dose distribution can be achieved by Monte Carlo simulations or by analytical methods. In this study, FLUKA Monte Carlo code has been considered for use in nuclear medicine dosimetry. Up to now, FLUKA has mainly been dedicated to other fields, namely high energy physics, radiation protection, and hadrontherapy. When first employing a Monte Carlo code for nuclear medicine dosimetry, its results concerning electron transport at energies typical of nuclear medicine applications need to be verified. This is commonly achieved by means of calculation of a representative parameter and comparison with reference data. Dose point kernel (DPK), quantifying the energy deposition all around a point isotropic source, is often the one. Methods: FLUKA DPKS have been calculated in both water and compact bone for monoenergetic electrons (10-3 MeV) and for beta emitting isotopes commonly used for therapy ((89)Sr, (90)Y, (131)I, (153)Sm, (177)Lu, (186)Re, and (188)Re). Point isotropic...

  19. The 31P(3He,d)32S reactions at 25MeV

    The 31P(3He,d)32S reaction was investigated at 25 MeV incident energy. One hundred and eleven levels up to an excitation energy of 12.5 MeV were observed using a split-pole magnetic spectrograph. The experimental angular distributions were analyzed with the distorted-wave Born approximation. The optical model parameters used in the DWBA calculations were obtained from a fit to elastic 3He scattering data taken on 31P at 25 MeV. Gamov functions were used as form factors for the transfered proton in the case of unbound states. Values of the transfered orbital angular momenta l and spectroscopic strengths were obtained for sixty levels, with many odd-parity levels being observed above 9 MeV excitation. Spin and parity assignments were made upon the basis of the l-values obtained from the shapes of the angular distributions and upon comparison with the results of other reactions. Isospin assignments were made by comparison with 32P levels. Except for the lsub(P)=1, T=0 transfers, most of the observed spectroscopic strength is concentrated into a few levels. The existence of a T-mixed doublet of levels, Jsup(π)=1-, is suggested in the 11 MeV region of excitation. The excitation energies and spectroscopic strengths are compared with results of a recent shell-model calculation

  20. The measurement of (n,2n) cross section for 23Na at 13.3 to 18.5 MeV

    The (n,2n) cross-section for 23Na has been measured by the activation method in the energy range 13.3 to 18.5 MeV. Monoenergitic neutrons were obtained from T(d,n)4He reaction with 2.3 MeV deuteron energy. The induced specific activities were detected by a coincidence counting setup. For comparison existed data and theoretical calculation from 12∼20 MeV are also given

  1. Expression of serine proteinase P186 of Arthrobotrys oligospora and analysis of its nematode-degrading activity.

    Zhao, Hailong; Qiao, Jun; Meng, Qingling; Gong, Shasha; Chen, Cheng; Liu, Tianli; Tian, Lulu; Cai, Xuepeng; Luo, Jianxun; Chen, Chuangfu

    2015-12-01

    The nematode-trapping fungi possess a unique capability of predating and invading nematodes. As a representative nematode-trapping fungus, Arthrobotrys oligospora has been widely used to study the interactions between nematode-trapping fungi and their hosts. Serine proteinase is one of the important virulence factors during process of invasion of the nematode-trapping fungi into nematodes. In this study, using reverse transcription polymerase chain reaction, we amplified the gene sequence of serine proteinase 186 from A. oligospora, cloned it into pPIC9K vector and expressed it in the yeast Pichia pastoris. The expressed recombinant serine proteinase186 (reP186) was purified via Ni-affinity chromatography. The in vitro nematode-degrading activity of reP186 was analyzed. Sodium dodecyl sulfate polyacrylamide gel electrophoresis and Western blot analysis revealed that reP186 with molecular weight of 33 kDa was successfully obtained. ReP186 was capable of degrading a series of protein substrates including casein, gelatin, bovine serum albumin, denatured collagen and nematode cortical layer. The reP186 exhibited the maximal activity at pH 8.0 and 55 °C and was highly sensitive to the inhibitor, phenylmethanesulfonylfluoride. Treatment of Caenorhabditis elegans and Haemonchus contortus with reP186 for 12, 24 and 36 h, respectively, resulted in 62, 88 and 100 % of killing rates for C. elegans, and 52, 65 and 84 % of killing rates for H. contortus, respectively, indicating a relatively strong nematode-degrading bioactivity of reP186. PMID:26419902

  2. Protective effects of MCI-186 on cerebral ischemia: possible involvement of free radical scavenging and antioxidant actions.

    Watanabe, T; Yuki, S; Egawa, M; Nishi, H

    1994-03-01

    The anti-ischemic effects and a possible mechanism of a new antistroke agent, 3-methyl-1-phenyl-pyrazolin-5-one (MCI-186), were studied. Preischemic treatment with MCI-186 (3 mg/kg i.v.) facilitated the recovery of electrocorticographic activity and prolonged survival time in global complete ischemia of rats; MCI-186 (1 and 3 mg/kg i.v.) also mitigated dysfunction of the blood-brain barrier and energy failure in hemispheric embolization of rats. Postischemic treatment with MCI-186 (3 mg/kg i.v.) decreased cortical infarction in focal embolization of rats. MCI-186 (0.6-2.4 mM) inhibited the OH.-induced hydroxylation of salicylate (maximal inhibition, 40.2%), but at 100 microM it did not influence O2- generation. MCI-186 inhibited the formation of linoleic acid-conjugated dienes caused by OH. (IC50 = 32.0 microM). Also, concurrent administration of MCI-186 (3-100 mg/kg i.v.) ameliorated hyperglycemia, hyperlipopeoxidemia and degranulation of beta-cells in alloxan (40 mg/kg i.v.)-treated rats. In addition, MCI-186 inhibited iron-dependent peroxidation in rat brain homogenates and mitochondrial homogenates (IC50 = 15.0 and 2.3 microM, respectively) and prevented iron-dependent peroxidative disintegration of mitochondrial membranes (IC50 = 39.0 microM). These findings suggest that MCI-186 has potent anti-ischemic actions and that its mechanism may be closely associated with beneficial antioxidant activities. PMID:8138971

  3. Analyzing power measurements in πd elastic scattering at 50 MeV

    Measurements of the vector analyzing power in πd elastic scattering at 50 MeV are found to agree well with model calculations that include the full πN P11 potential and disagree when this is omitted or suppressed

  4. Evaluation of complete neutron data for n + 169Tm reactions below 20 MeV

    A complete set of neutron nuclear data, including cross sections, angular distributions, and secondary neutron spectra, of n+169Tm reactions below 20 MeV were evaluated based on available experimental data and theoretically calculated results. The data are given in ENDF/B-6 format

  5. Energy-dependent phase shift analysis of pion-nucleon scattering below 400 MeV

    An analytic function of energy is fit to the available S, P, and D wave πN phase shifts of various goups below 400 MeV. This global average, which reproduces well most of the experiment cross sections, is anticipated to be useful in pion-nucleus and pion-nucleon interaction calculations

  6. The neutron-deuteron elastic scattering angular distribution at 95 MeV

    The neutron-deuteron elastic scattering differential cross section has been measured at 95 MeV incident neutron energy, with the Medley setup at TSL in Uppsala. The neutron-proton differential cross section has also been measured for normalization purposes. The data are compared with theoretical calculations to investigate the role of three-nucleon force effects

  7. Analyzing power measurements in πd elastic scattering at 50 MeV

    Measurements of the vector analyzing power in πd elastic scattering at 50 MeV are found to agree well with model calculations that include the full πN P11 potential and disagree when this is omitted or suppressed. (Author) (10 refs., 3 figs.)

  8. The neutron-deuteron elastic scattering angular distribution at 95 MeV

    Mermod, Philippe

    2004-04-01

    The neutron-deuteron elastic scattering differential cross section has been measured at 95 MeV incident neutron energy, with the Medley setup at TSL in Uppsala. The neutron-proton differential cross section has also been measured for normalization purposes. The data are compared with theoretical calculations to investigate the role of three-nucleon force effects.

  9. Single Particle Strengths and Mirror States in $^{15}$N$-^{15}$O below 12.0 MeV

    Mertin, C E; Crisp, A M; Keeley, N; Kemper, K W; Momtyuk, O; Roeder, B T; Volya, A

    2014-01-01

    New $^{14}$N(d,p) angular distribution data were taken at a deuteron bombarding energy of 16 MeV to locate all narrow single particle neutron states up to 15 MeV in excitation. A new shell model calculation is able to reproduce all levels in $^{15}$N up to 11.5 MeV and is used to characterize a narrow single particle level at 11.236 MeV and to provide a map of the single particle strengths. The known levels in $^{15}$N are then used to determine their mirrors in the lesser known nucleus $^{15}$O. The 2s$_{1/2}$ and 1d$_{5/2}$ single particle centroid energies are determined for the $^{15}$N$-^{15}$O mirror pair as: $^{15}$N $(\\text{2s}_{1/2}) = 8.08$ MeV, $^{15}$O $(\\text{2s}_{1/2}) = 7.43$ MeV, $^{15}$N $(\\text{1d}_{5/2}) = 7.97$ MeV, and $^{15}$O $(\\text{1d}_{5/2}) = 7.47$ MeV. These results confirm the degeneracy of these orbits and that the $^{15}$N$-^{15}$O nuclei are where the transition between the $\\text{2s}_{1/2}$ lying below the $\\text{1d}_{5/2}$ to lying above it, takes place. The $\\text{1d}_{3/2}$...

  10. 14 MeV proton activation analysis

    A fast nuclear nondestructive method for protein analysis using the 14 MeV proton activation has been developed. The total nitrogen content was measured through the reaction: 14N (p,n) 14O, (Tsub(1/2)=71 s). The 14O activity was detected by means of its characteristic 2.312 MeV gamma-ray line with a NaI(Tl) detector. For a fast determination of a large number of samples a mechanized sistem reacting a rate of one sample per minute has been developed. The laboratory electronics comprises a multichannel analyser, a PDP computer and an electronic module comtroller. Comparison of the results obtained by the method described and the classical Kjeldal technique for samples of various cereal grains (soya bean seads, wheat, barley and corn) showed good correlation. A problem of the analysis of the whole protein region on corn and soya-bean seads, where this region is thicker (0,2 - 2 mm), is mentioned. In this case flour was proposed to be used to obtain a protein homogeneous sample and the irradiaton dose for a sample was about 33,000 Gy, mainly (99%) from protons (27 s x 100 nA x 14 MeV)

  11. Analysis of Neutron Double-Differential Cross Sections for n + 12C Reaction Below 30 MeV

    2007-01-01

    Based on the light nucleus reaction model (Nucl. Sci. Eng. l33 (1999) 218), four aspects (neutron incident energy region, reaction channel analysis, the renewed level schemes and the optical model parameters) of n+12 C reaction are improved to calculate total outgoing neutron double-differential cross sections with modified LUNF code below 30 MeV. The calculated results agree fairly well with the experimental data at En = 14.1 MeV and 18 MeV. The analysis shows that the pre-equilibrium mechanism, which is exactly considered the conservation of energy, momentum and parity, dominates the whole reaction process. The contribution of the neutron emission from 5He to total energyangular spectra is also considered properly. This modified LUNF code will be a useful tool to set up the file of neutron double-differential cross sections below 30 MeV in the neutron evaluation nuclear data library.

  12. Station Black-Out Analysis with MELCOR 1.8.6 Code for Atucha 2 Nuclear Power Plant

    A description of the results for a Station Black-Out analysis for Atucha 2 Nuclear Power Plant is presented here. Calculations were performed with MELCOR 1.8.6 YV3165 Code. Atucha 2 is a pressurized heavy water reactor, cooled and moderated with heavy water, by two separate systems, presently under final construction in Argentina. The initiating event is loss of power, accompanied by the failure of four out of four diesel generators. All remaining plant safety systems are supposed to be available. It is assumed that during the Station Black-Out sequence the first pressurizer safety valve fails stuck open after 3 cycles of water release, respectively, 17 cycles in total. During the transient, the water in the fuel channels evaporates first while the moderator tank is still partially full. The moderator tank inventory acts as a temporary heat sink for the decay heat, which is evacuated through conduction and radiation heat transfer, delaying core degradation. This feature, together with the large volume of the steel filler pieces in the lower plenum and a high primary system volume to thermal power ratio, derives in a very slow transient in which RPV failure time is four to five times larger than that of other German PWRs.

  13. Structure of Os - Pt nuclei and g factors of 186-192Os isotopes at low spins

    Employing a pairing + quadrupole model interaction, especially suitable for the Os - Pt region, the ground state structure of these nuclei is investigated following a selfconsistent Hartree-Fock-Bogolyubov (HFB) approach. Effects of the inclusion of hexadecapole degrees of freedom in the Hamiltonian are also studied. All the osmium isotopes considered here come out to be prolate in shape in the ground state. 186Pt is triaxial with γ=12 deg. and with the increasing mass number they gradually go over to the oblate shape at A=190 itself. In view of recent experimental data on g factors of osmium isotopes which show interesting variations as a function of mass number as well as spin, we have calculated these following the methods of variation after exact angular momentum projection of axial HFB wave functions and the cranked HFB theory. The observed trend of the variation of g factor at I=2 with the mass number is reproduced with very minor adjustments of the force constants of the Hamiltonian in both the approaches. However, the variation of g factor with spin, which is sensitive to the interplay between collective and the single particle degrees of freedom, can be understood only in the cranking approach. (author). 52 refs, 8 figs, 6 tabs

  14. 人ZP3 186S突变蛋白在毕赤酵母X33细胞中的表达%Expression of human ZP3 186S protein in Pichia pastoris X33

    王弘珺; 李质馨; 田洪艳; 徐冶; 朱辛为; 林冬静; 窦肇华

    2010-01-01

    目的:利用毕赤酵母表达人ZP3 186S蛋白(23~348氨基酸),为临床相关疾病的诊断提供实验材料.方法:经PCR获得编码人ZP3(23~348氨基酸)的基因,构建表达载体pPICZα-hZP3.将ZP3 186位点精氨酸突变为丝氨酸构建pPICZα-hZP3 186S质粒.转染毕赤酵母X33细胞,用高浓度Zeocin筛选转染细胞,甲醇诱导目的蛋白分泌,通过SDS-PAGE和Western blot鉴定人ZP3 186S蛋白.结果:pPICZα-hZP3 186S表达质粒经测序正确,并在毕赤酵母X33中能够高效表达.结论:毕赤酵母能够分泌性表达重组人ZP3 186S蛋白(23~348氨基酸),进一步研究其生物学活性为研制不孕症诊断试剂和免疫避孕疫苗提供实验材料.

  15. Labelling of biorelated compounds and monoclonal antibodies with 188-Re,186-Re and 99mTc

    Some bio-related compounds were labelled with 188Re and 186Re 188Re was obtained from 188W/188Re generator which was produced by neutron irradiation of enriched 186WO3 target (99.79%) in JRR-2 and 186Re was supplied by Production Div., Department of Radioisotopes, JAERI, Japan. Rhenium labelling involved reduction of perrhenate with SnCl2.2H20 in HCI. Bio-related compounds citrate and gluconate were then labelled with reduced rhenium. The labelling yield of labelled compounds as determined by thin-layer chromatography were greater than 98% and 94% for 188Re-citrate and gluconate, respectively. Monoclonal antibodies (mouse,lgG2A and lgG;Fab'2, human lgG2A; anti-hepatoma and IgG) were also successfully labelled with 188Re, 186Re, and 99mTc by direct method using citrate and glucoheptonate as transchelating agents

  16. Biodistribution and Clearance Test 186Re(V) - DMS A in Normal White Rats (A Strain of Wistar)

    186Re(V) - DMS A is a β-emitting radiopharmaceutical for medullary thyroid carcinoma therapy. Biodistribution and clearance tests of 186Re(V) - Dmsa was done by wet destruction method using concentrate liquid of nitric acid in the organ, blood and urine of normal white rats. Biodistribution test showed a smaller accumulation of activity per gram normal organ of the thyroid (1.80 ± 0.58% at 30 minutes after intravenous injection. The higher accumulation of activity was apparent in kidney, and then followed by lung and liver. Clearance test of 186Re(V) - DMS A showed a short enough blood clearance time with 2.75 ± 0.30% of the activity remained in the blood at 30 minutes after injection. The urine clearance of 186Re(V) - DMS A with in 24 hours after injection was 2.29 ± 0.91% of the activity per ml urine

  17. Application of rhenium 186 radiosynovectomy in elbow diffuse pigmented villonodular synovitis: Case report with multiple joint involvement

    After surgical therapy of diffuse pigmented villonodular synovitis (DPVNS), recurrence is seen in almost half of the patients. The effectiveness of radiosynovectomy (RSV)in preventing recurrence and complaints of DPVNS is well known. Elbow involvement in DPVNS is a very rare condition; therefore, RSV in elbow hasn't been experienced widely. The aim of this case report is to show the effectiveness of RSV with rhenium 186 (Re 186)sulfide colloid. We applied Re 186 sulfide colloid to the elbow joint of DPVNS patients six weeks after arthroscopic synovectomy. As a result, the patient did not have any complaints, and our findings are compatible with residue or recurrence on magnetic resonance imaging (MRI)in sixth and twentieth month controls after administration. We concluded that Re 186 is an effective adjuvant therapy for the prevention of recurrence and complaints

  18. Application of rhenium 186 radiosynovectomy in elbow diffuse pigmented villonodular synovitis: Case report with multiple joint involvement

    Koca, Go Khan; Ozsoy, Ha Kan; Atilgan, Hasan Ikbal; Demirel, Koray; Dincel, Veysel Ercan; Korkmaz, Meliha [Ankara Training and Research Hospital, Ankara (Turkmenistan)

    2012-09-15

    After surgical therapy of diffuse pigmented villonodular synovitis (DPVNS), recurrence is seen in almost half of the patients. The effectiveness of radiosynovectomy (RSV)in preventing recurrence and complaints of DPVNS is well known. Elbow involvement in DPVNS is a very rare condition; therefore, RSV in elbow hasn't been experienced widely. The aim of this case report is to show the effectiveness of RSV with rhenium 186 (Re 186)sulfide colloid. We applied Re 186 sulfide colloid to the elbow joint of DPVNS patients six weeks after arthroscopic synovectomy. As a result, the patient did not have any complaints, and our findings are compatible with residue or recurrence on magnetic resonance imaging (MRI)in sixth and twentieth month controls after administration. We concluded that Re 186 is an effective adjuvant therapy for the prevention of recurrence and complaints.

  19. Shielding considerations for the 750-MeV electron accelerator at the University of Illinois

    This report summarizes some of the calculations that were carried out to provide shielding data for the 750-MeV electron accelerator under construction at the University of Illinois. All of the results described herein were obtained for a 300-MeV and/or 750-MeV electron beam. All calculations deal with doses produced by the particle beam during operation and do not include secondary radiation sources, i.e., induced radioactivity. The dose equivalents were obtained as a function of shield thickness so that various accident scenatios could be considered, i.e., various percentages of beam loss during operation. The calculated results that were considered included: (1) the earth shielding thickness (and iron door) surrounding the accelerator vault, (2) the earth shielding thickness around the beam transport tunnel, (3) an estimate of the thickness and composition of the movable shielding door in the general purpose electron beam experimental area, (4) the shield thickness around the beam dump in the bremsstrahlung irradiation facility, (5) skyshine dose from some of the experimental areas, and (6) dose rates inside and outside the tagged photon facility. The programs and cross section data bases used in the calculations, as well as the source neutron spectra calculations, are presented. The results of the dose calculations are presented and discussed

  20. Focussed MeV ion beam implanted waveguides

    Von Bibra, M.L.; Roberts, A.; Nugent, K.; Jamieson, D.N. [Melbourne Univ., Parkville, VIC (Australia). School of Physics

    1996-12-31

    Single mode buried optical waveguides have been fabricated in fused silica by MeV proton implantation using a focussed hydrogen ion beam. The technique has the potential to direct write waveguide devices and produce multi-layered structures, without the need for intermediate steps such as mask fabrication or layered depositions. A micron resolution Confocal Raman Spectrometer has been used to map the distribution of atomic vacancies that forms the waveguiding region. The results are compared with theoretical calculations. Losses of 3 dB cm{sup -1} have been measured in unannealed samples, which decreases to less than 0.5 dB cm{sup -1} after annealing at 500 degrees Celsius. We describe methods for determining the refractive index distribution of single mode buried waveguides from their output intensity distributions via an inversion of the scalar wave equation. (authors). 5 figs.

  1. Proton-proton bremsstrahlung at 280 MeV

    A proton-proton bremsstrahlung experiment has been carried out at TRIUMF using a 280-MeV polarized proton beam impinging on a liquid-hydrogen target. All three outgoing particles were detected: the higher-energy proton in a magnetic spectrometer, the lower-energy proton with plastic scintillators, and the photon in lead-glass Cherenkov detectors. The experiment shows the first unambiguous evidence for off-shell effects in the free nucleon-nucleon interaction, in that the analyzing powers disagree strongly with the predictions of the soft-photon approximation (which incorporates only on-shell information) but are consistent with the results of calculations using the Bonn and Paris potentials

  2. Semi-empirical systematics of (n, He-3) cross sections for 14.6 MeV neutrons

    A new semi-empirical formula for the calculation of the (n, He-3) cross section at 14.6 MeV neutron energy is obtained. It is based on the evaporation model. The new formula with three parameters is found to give a better fit to the data than the previous comparable formulae. - Highlights: • We develop a new semi empirical formula, and calculate the (n, He-3) cross section. • The (n, He-3) reaction cross section is calculated for 14.6 MeV neutrons. • This formula is based on Weisskopf and Ewing evaporation statistical model. • The analytical expression is obtained with three free parameters

  3. Extrapolated neutron activation cross sections for dosimetry to 44 MeV

    Thirty-one neutron activation cross sections have been extrapolated to 44 MeV for dosimetry applications at high-energy, accelerator-based neutron sources. All cross sections have undergone integral testing in Be(d,n) fields at E/sub d/ = 14, 16, and 40 MeV. The integral activities for most of the reactions agree within 10% with calculations based on time-of-flight measurements of the flux spectra. Tests show that at least 25 of the cross sections can be used with the SAND II code to unfold neutron spectra with differential errors of 10 to 30% in the neutron energy range from 2 to 30 MeV

  4. Study on nuclear transmutation of nuclear waste by 14 MeV neutrons

    The object of this study is to clarify the possibility of 14 MeV neutrons to decrease the radioactivity of nuclear waste, especially fission products such as Cs, Sr, Tc, and I. Simulations were performed for several fission products by Monte-Carlo code and burnup calculation code. In comparison to the spectra of thermal reactor and fast reactor, it was found that D-T neutron of 14 MeV is preferable and has the possibility to reduce the radioactivity of fission products such as Cs, Sr, Tc, and I with the magnitude of the flux more than 5 × 1015 [no./cm2/sec] for 1000 days irradiation period. This investigation reveals the possibility and the superiority of 14 MeV neutron than thermal and fast neutron spectra to annihilate the fission products. (author)

  5. Mass spectra and fusion cross sections for 20Ne + 24Mg interaction at 55 MeV and 85 MeV

    Inclusive γ-spectra from the 20Ne + 24Mg interaction have been measured using 55 and 85 MeV 20Ne beams accelerated at the CYCLONE cyclotron of Louvain-la-Neuve. The identification of γ lines allows the determination of mass spectra in the region 12<=A<=43. Experimental results are compared with statistical model calculations. The total reaction and fusion cross sections are extracted. Cross sections for inelastic scattering, few nucleon transfers and deep inelastic scattering are estimated. (author)

  6. The effectiveness of different interventional methods for partial fallopian tube obstruction: an analysis of 186 cases

    Objective: To evaluate selective salpingo-catheterization recanalization therapy in treating partial fallopian tube obstruction through comparing its clinical effectiveness with that of non-interventional radiology methods. Methods: During the period from January 2008 to October 2010, a total of 186 infertility women with partial fallopian tube obstruction, which was confirmed with hysterosalpingography, were encountered in authors' hospital. This study protocol was approved by our hospital ethics committee, and informed consent was obtained from all patients. According of different treatment methods, 186 patients were divided into two groups. Patients (n=78) in group A received non-interventional radiology methods, including hydrotubation, enema, laparoscopy, physical therapy and traditional Chinese medication, while patients (n=108) in group B received selective salpingo-catheterization recanalization therapy. All 186 patients were followed up for more than six months. Close observation on the pregnancy incidence after different treatments and fallopian tube patency was carried out. The clinical findings were documented. The results were statistically analyzed by using paired 'x2' test. Results: Half a year after different procedures, in group A the pregnancy rate was 12.82% (n=10), and different degrees of fallopian tube obstruction were found in 31.58% patients. Whereas in group B, during the same period of observation, the pregnancy rate was 58.33% (n=63), and partial occlusion in cornual region was seen in one patient (0.47%). Significant difference in both pregnancy rate and fallopian tube occlusion rate existed between two groups (P<0.05). Conclusion: Because of its minimal invasiveness, high effectiveness and safety, the selective salpingography together with fallopian tube recanalization procedures are well accepted by the patients. The selective salpingo-catheterization recanalization therapy is superior to non-interventional radiology methods in

  7. 186Re-HEDP for metastatic bone pain in breast cancer patients

    Two-thirds of patients with metastatic cancer suffer from pain. Pain originating from skeletal metastases is the most common form of cancer-related pain. Bone pain, often exacerbated by pressure or movement, limits the patient's autonomy and social life. Pain palliation with bone-seeking radiopharmaceuticals has proven to be an effective treatment modality in patients with metastatic bone pain. These bone-seeking radiopharmaceuticals are extremely powerful in treating scattered painful bone metastases, for which external beam radiotherapy is impossible because of the large field of irradiation. 186Re-hydroxyethylidene diphosphonate (HEDP) is a potentially useful radiopharmaceutical for this purpose, having numerous advantageous characteristics. Bone marrow toxicity is limited and reversible, which makes repetitive treatment safe. Studies have shown encouraging clinical results of palliative therapy using 186Re-HEDP, with an overall response rate of ca. 70% in painful bone metastases. It is effective for fast palliation of painful bone metastases from various tumours and the effect tends to last longer if patients are treated early in the course of their disease. 186Re-HEDP is at least as effective in breast cancer patients with painful bone metastases as in patients with metastatic prostate cancer. It is to be preferred to radiopharmaceuticals with a long physical half-life in this group of patients, who tend to have more extensive haematological toxicity since they have frequently been pretreated with bone marrow suppressive chemotherapy. This systemic form of radionuclide therapy is simple to administer and complements other treatment options. It has been associated with marked pain reduction, improved mobility in many patients, reduced dependence on analgesics, and improved performance status and quality of life. (orig.)

  8. Equivalent-spherical-shield neutron dose calculations

    Neutron doses through 162-cm-thick spherical shields were calculated to be 1090 and 448 mrem/h for regular and magnetite concrete, respectively. These results bracket the measured data, for reinforced regular concrete, of /approximately/600 mrem/h. The calculated fraction of the high-energy (>20 MeV) dose component also bracketed the experimental data. The measured and calculated doses were for a graphite beam stop bombarded with 100 nA of 800-MeV protons. 6 refs., 2 figs., 1 tab

  9. A novel copper(II) coordination at His186 in full-length murine prion protein

    Watanabe, Yasuko [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Hiraoka, Wakako [Laboratory of Biophysics, School of Science and Technology, Meiji University, Kawasaki 214-8571 (Japan); Igarashi, Manabu; Ito, Kimihito [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Shimoyama, Yuhei [Soft-Matter Physics Laboratory, Graduate School of Emergent Science, Muroran Institute of Technology, Muroran 050-8585 (Japan); Horiuchi, Motohiro [Laboratory of Prion Diseases, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Yamamori, Tohru; Yasui, Hironobu; Kuwabara, Mikinori [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Inagaki, Fuyuhiko [Laboratory of Structural Biology, Graduate School of Pharmaceutical Sciences, Hokkaido University, Sapporo 060-0812 (Japan); Inanami, Osamu, E-mail: inanami@vetmed.hokudai.ac.jp [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan)

    2010-04-09

    To explore Cu(II) ion coordination by His{sup 186} in the C-terminal domain of full-length prion protein (moPrP), we utilized the magnetic dipolar interaction between a paramagnetic metal, Cu(II) ion, and a spin probe introduced in the neighborhood of the postulated binding site by the spin labeling technique (SDSL technique). Six moPrP mutants, moPrP(D143C), moPrP(Y148C), moPrP(E151C), moPrP(Y156C), moPrP(T189C), and moPrP(Y156C,H186A), were reacted with a methane thiosulfonate spin probe and a nitroxide residue (R1) was created in the binding site of each one. Line broadening of the ESR spectra was induced in the presence of Cu(II) ions in moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) but not moPrP(D143R1). This line broadening indicated the presence of electron-electron dipolar interaction between Cu(II) and the nitroxide spin probe, suggesting that each interspin distance was within 20 A. The interspin distance ranges between Cu(II) and the spin probes of moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) were estimated to be 12.1 A, 18.1 A, 10.7 A, and 8.4 A, respectively. In moPrP(Y156R1,H186A), line broadening between Cu(II) and the spin probe was not observed. These results suggest that a novel Cu(II) binding site is involved in His186 in the Helix2 region of the C-terminal domain of moPrP{sup C}.

  10. Doubly Decoupled Structure in Odd-Odd 178-186Ir Nuclei

    张玉虎; H. Kusakari; M. Sugawara; T. Komatsubara; T. Havakawa; M. Oshima; Y. Toh; J. Katakura; Y. Hatsukawa; M. Matsuda; N. Shinohara; T. Ishii

    2001-01-01

    High-spin states in 178'180Ir have been studied via the 152'154Sm(31P, 5nγ) reactions through excitation functions, x-γ and γ-γ-t coincidence measurements. A doubly decoupled band has been identified in each of the isotopes.The level spacings for such structures in odd-odd 178-186Ir have been inspected and thus a regular level staggering as a function of the neutron number is revealed. This particular phenomenon may be associated with bandmixing at lower excitation energies.

  11. Tidal evolution in multiple planet systems: application to Kepler-62 and Kepler-186

    Bolmont, Emeline; Leconte, Jérémy; Correia, Alexandre; Quintana, Elisa

    2014-01-01

    A large number of observed exoplanets are part of multiple planet systems. Most of these systems are sufficiently close-in to be tidally evolving. In such systems, there is a competition between the excitation caused by planet-planet interactions and tidal damping. Using as an example two multiple planet systems, which host planets in the surface liquid water habitable zone (HZ): Kepler-62 and Kepler-186, we show the importance and effect of both planetary and stellar tides on the dynamical evolution of planets and on the climate of the HZ planets.

  12. A novel copper(II) coordination at His186 in full-length murine prion protein

    To explore Cu(II) ion coordination by His186 in the C-terminal domain of full-length prion protein (moPrP), we utilized the magnetic dipolar interaction between a paramagnetic metal, Cu(II) ion, and a spin probe introduced in the neighborhood of the postulated binding site by the spin labeling technique (SDSL technique). Six moPrP mutants, moPrP(D143C), moPrP(Y148C), moPrP(E151C), moPrP(Y156C), moPrP(T189C), and moPrP(Y156C,H186A), were reacted with a methane thiosulfonate spin probe and a nitroxide residue (R1) was created in the binding site of each one. Line broadening of the ESR spectra was induced in the presence of Cu(II) ions in moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) but not moPrP(D143R1). This line broadening indicated the presence of electron-electron dipolar interaction between Cu(II) and the nitroxide spin probe, suggesting that each interspin distance was within 20 A. The interspin distance ranges between Cu(II) and the spin probes of moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) were estimated to be 12.1 A, 18.1 A, 10.7 A, and 8.4 A, respectively. In moPrP(Y156R1,H186A), line broadening between Cu(II) and the spin probe was not observed. These results suggest that a novel Cu(II) binding site is involved in His186 in the Helix2 region of the C-terminal domain of moPrPC.

  13. Estimating variation within the genes and inferring the phylogeny of 186 sequenced diverse Escherichia coli genomes

    Kaas, Rolf Sommer; Rundsten, Carsten Friis; Ussery, David;

    2012-01-01

    creating better phylogenies, for determination of molecular clocks and for improved typing techniques. Results We find 3,051 gene clusters/families present in at least 95% of the genomes and 1,702 gene clusters present in 100% of the genomes. The former 'soft core' of about 3,000 gene families is perhaps...... 186 sequenced E. coli genomes. The core-gene tree displays high confidence and divides the E. coli strains into the observed MLST type clades and also separates defined phylotypes. Conclusion The results of comparing a large and diverse E. coli dataset support the theory that reliable and good...

  14. Discovery and Classification of the z=1.86 SLSNe: DES15E2mlf

    Pan, Y.-C.; Foley, R. J.; Galbany, L.; Gonzalez-Gaitan, S.; Forster, F.; Hamuy, M.; Prieto, J. L.; Yuan, F.; Tucker, B. E.; Lidman, C.; Martini, P.; Gshwend, Julia; Moller, A.; Zhang, B.; Desai, S.; Paech, K.; Smith, R. C.; Schubnell, M.; Kessler, R.; Lasker, J.; Scolnic, D.; Brout, D. J.; Gladney, L.; Sako, M.; Wolf, R. C.; Brown, P. J.; Krisciunas, K.; Suntzeff, N.; Nichol, R.; Papadopoulos, A.; Childress, M.; D'Andrea, C.; Prajs, S.; Smith, M.; Sullivan, M.; Maartens, R.; Gupta, R.; Kovacs, E.; Kuhlmann, S.; Spinka, H.; Ahn, E.; Finley, D. A.; Frieman, J.; Marriner, J.; Wester, W.; Aldering, G.; Kim, A. G.; Thomas, R. C.; Barbary, K.; Bloom, J. S.; Goldstein, D.; Nugent, P.; Perlmutter, S.; Casas, R.; Castander, F. J.

    2015-12-01

    We report the spectroscopic classification of DES15E2mlf as a superluminous supernova (SLSN) discovered by the Dark Energy Survey (ATEL #4668). DES15E2mlf was discovered on 7 November 2015 at R.A. = 00:41:33.40, Decl = -43:27:17.2 with r = 24.1 mag. We obtained spectra using GMOS on Gemini-South (520-990nm) on 06 December 2015 which indicated a redshift of z = 1.86 from Mg II 2800 absorption.

  15. Neutron total and scattering cross sections of 6Li in the few MeV region

    Neutron total cross sections of 6Li are measured from approx. 0.5 to approx. 4.8 MeV at intervals of approx. 10 scattering angles and at incident-neutron intervals of approx.< 100 keV. Neutron differential inelastic-scattering cross sections are measured in the incident-energy range 3.5 to 4.0 MeV. The experimental results are extended to lower energies using measured neutron total cross sections recently reported elsewhere by the authors. The composite experimental data (total cross sections from 0.1 to 4.8 MeV and scattering cross sections from 0.22 to 4.0 MeV) are interpreted in terms of a simple two-level R-matrix model which describes the observed cross sections and implies the reaction cross section in unobserved channels; notably the (n;α)t reaction (Q = 4.783 MeV). The experimental and calculational results are compared with previously reported results as summarized in the ENDF/B-V evaluated nuclear data file

  16. 72 MeV proton cyclotron for boron neutron capture therapy in Slovakia

    A cyclotron complex named CYLAB is being built at the Slovak Institute of Metrology. The main equipment, a cyclotron producing 72 MeV protons and light and heavy ions up to 129Xe20+, will be manufactured by the Joint Institute for Nuclear Research in Dubna. Medicine, physics, and metrology will be the main CYLAB application fields. The 66 MeV p-Be reaction will be used for fast neutron therapy, the spallation reactions of 72 MeV p on a tungsten target will be used in neutron capture therapy, and 72 MeV, 100 nA protons will be used in eye therapy. The medical applications of CYLAB are described with emphasis on boron neutron capture therapy (BNCT) and the gantry built for it, based on the 72 MeV/50 μA proton cyclotron. Theoretical calculations showed that in comparison with the equipment with a conventional configuration of moderators, reflectors, filters and shielding, significant improvements in epithermal neutron production will emerge, leading to a higher RBE dose rate at a 7 cm depth of the brain. (P.A.)

  17. Feasibility study of measuring the 238U fission rates by neutrons of 14 MeV in specifical experiment condition

    Using uranium fission chambers of minitype slab in the case of 14 MeV neutrons penetrating through the special experiment model, the pure 238U absolute fission rates are measured. Comparing the measurement results with and without reflect shell, the reflect coefficient of shell is gained. The calculate results are compared with experiment results, to prove the model calculate method and parameter. (author)

  18. Thermoluminescence response of Ge-, Al- and Nd- doped optical fibers by 6 MeV - electron and 6 MeV - photon irradiations

    In this paper, we report the prediction of thermoluminescence responses of Neodymium-doped SiO2 optical fibre with various dose ranges from 0.5 Gy to 4.0 Gy by 6 MeV - electron irradiations without requirement for experimental measurements. A technique has been developed to calculate prediction of 6 MeV - electron response of Neodymium-doped SiO2 optical fibre by observing the measured TL response of 6 MV - photon and the ratio of known measured photon/electron yield ratio distribution for Ge-doped, Al-doped optical fibre and standard TLD 100 dosimeter. The samples were kept in gelatin capsule an irradiated with 6 MV - photon at the dose range from 0.5 Gy to 4.0 Gy. Siemens model Primus 3368 linear accelerator located at Hospital Sultan Ismail, Johor Bahru has been used to deliver the photon beam to the samples. We found the average response ratio of 6 MV - photon and 6 MeV - electron in Ge-doped, Al-doped optical fibre and standard TLD-100 dosimeter are 0.83(3). Observing the measured value of 6 MV - photon irradiation this average ratio is useful to find the prediction of thermoluminescence responses by 6 MeV - electron irradiation of Neodymium-doped SiO2 optical fibre by the requirement for experimental measurements with various dose ranges from 0.5 Gy to 4.0 Gy by 6 MV - photon irradiations.

  19. Measurement of (n,Xn) reaction cross sections at 96 MeV; Measure des sections efficaces (n,Xn) a 96 MeV

    Sagrado Garcia, Melle Inmaculada C. [Ecole Doctorale: SINEM, U.F.R. de Sciences, Universite de Caen/Basse-Normandie, Esplanade Paix14000 Caen (France)

    2006-10-15

    Nucleon induced reactions in the 20-200 MeV energy range are intensively studied since a long time. The evaporation and the pre-equilibrium processes correspond to an important contribution of the production cross section in these reactions. Several theoretical approaches have been proposed and their predictions must be tested. The experimental results shown in this work are the only complete set of data for the (n,Xn) reactions in this energy range. Neutron double differential cross section measurements using lead and iron targets for an incident neutron beam at 96 MeV were carried out at TSL Laboratory in Uppsala, Sweden. The measurements have been performed for the first time with an energy threshold of 2 MeV and for a wide angular range (15 angle - 98 angle). Neutrons have been detected using two independent setups, DECOI and DEMON and CLODIA and SCANDAL, in order to cover the whole energy range (2-100) MeV. The angular distributions, the differential cross sections and the total inelastic production cross sections have been calculated using the double differential cross sections. The comparison between the experimental data and the predictions given by two of the most popular simulation codes, GEANT3 and MCNPX, have been performed, as well as the comparison with the predictions of the microscopic simulation model DYWAN, selected for its treatment of nucleon-nucleon reactions. (author)

  20. Prediction of the correct measured activity of 186Re and 188Re from reactor produced natural rhenium using an artificial neural network

    To optimize the cost effectiveness of 186Re and 188Re production, which have recently been used as radio pharmaceuticals for therapeutic purposes, we designed an artificial neural network (ANN) to evaluate the activity of combined 186Re + 188Re. One of the production ways is the (n,γ) reaction of natural rhenium which leads to combined 186Re + 188Re. Using the counted activity of 186Re + 188Re mixtures by a well type isotope calibrator, the precise activity of 186Re and 188Re is obtained by the ANN. A back-propagation ANN was trained using 30 activities of mixed 186Re + 188Re. The performance of the ANN was tested by Early-Stopping validation method, and the ANN was optimized with respect to its architecture. The response of the ANN shows significant precision that may be used for medical application of 186Re + 188Re mixtures.

  1. Production and therapeutic application of rhenium isotopes, rhenium-186 and rhenium-188: Radioactive pharmaceuticals of the future

    Vučina Jurij L.

    2003-01-01

    Full Text Available Introduction In contemporary nuclear medicine, alpha, pure beta or beta-gamma emitters are used for targeted therapy. Use of pure and combined alpha/beta emitters in oncology, endocrinology, rheumatology and, a short while ago, interventional cardiology, has refined as an important alternative to more common therapeutic regimens. Two radioisotopes of rhenium, rhenium-186 and rhenium-188, are of particular interest. Production of Rhenium-186 and Rhenium-188 Rhenium-186 is routinely produced in nuclear reactors by direct neutron activation of metallic rhenium enriched with 185Re via 185Re(n,186Re nuclear reaction. For production of 188Re the target is 186W. 188W is produced by double neutron capture which gives 188Re due to beta decay. Separation of 188Re is performed in generators by column chromatography, extraction or by gel technology. The best results are obtained using chromatographic 188W/188Re generator in which 188W is adsorbed on aluminum. Rhenium-188 is eluted in saline solution. Radiopharmaceuticals labeled with rhenium radioisotopes and their clinical applications There are several fields of applications of radiopharmaceuticals labeled with 186,188Re. For bone pain palliation the most often used are 186Re-HEDP and 188Re-DMSA. For synovectomy, 186Re-sulphide in kit form is already commercially available. Endovascular radiation therapy is performed by using 188Re-perrhenate or 188Re-MAG3. Labeling of peptides and antibodies with 188Re is also reported. Application of rhenium radioisotopes depends on their specific activity. Rhenium-186,188 of low specific activity can be used only for labeling of particles or diphosphonates. However, labeling of peptides or antibodies can be performed only by using 188Re of high specific activity. Conclusion 188Re is expected to have wide applications after development of a chromatographic 188W/188Re generator. One of the advantages of rhenium is its chemical similarity with technetium. So technetium

  2. A Survey of HIV Antibody Test among 186 Drug Addicts%186例药物滥用者HIV抗体检测现状调查

    张官柏; Annette Kobusingye; 王静; 杨茂彬; 达勇; 刘玉华; 孙新会

    2004-01-01

    目的:了解药物滥用人群中HIV抗体检测率,检测情况及阻碍人们进行检测的原因.方法:采用自制调查表,在戒毒机构中随机抽取186人进行问卷调查.结果:药物滥用人群中HIV检测率为21.5%,自愿、咨询检测者更少;他们掌握一定的HIV/AIDS相关知识,但却普遍认为自己感染HIV危险不大;未主动寻求HIV抗体检测的因素中,主要有:认为自己不会感染HIV、因为药物滥用.结论:药物滥用人群中HIV抗体检测率较低;阻碍因素主要有:认为自己不会感染、因为药物滥用;在HIV抗体检测中,应该提倡自愿咨询检测(VCT)服务,而不是强制检测.

  3. Laparoscopic finding of female infertility-a study of 186 cases at a tertiary care hospital

    Objective: To study the various causes of female infertility, diagnosed at laparoscopy. Study Design: Descriptive study. Place and Duration of Study: The study was conducted at Military Hospital Rawalpindi, Pakistan from April 2008 to December 2010. Patients and Methods: A series of 186 patients, having either primary or secondary infertility admitted through gynae outpatient department undergoing diagnostic laparoscopy and meeting inclusion criteria were studied. The data was collected prospectively and analysed in the form of frequency and percentages by using SPSS version 10. Results: Amongst the cohort of 186 patients, 148 (79.6%) had primary and 38 (20.4%) had secondary infertility. Their ages ranged from 20 to 43 years. Mean age of study participants was 30.14 +- 4.04 years. Mean duration of infertility was 9.5 years. No laparoscopic abnormality was found in 51 (27.9%), while there were abnormal findings in 135 (72.6%) patients. Conclusion: Commonest etiological factor was tubal blockade in both types of infertility. Other factors were endometriosis, pelvic adhesions and fibroids. Laparoscopy is minimally invasive yet a reliable procedure for visualization of internal architecture of the female pelvis. (author)

  4. Photodisintegration of the isotopes 186,188,189,190,192Os: Similarities and distinctions

    In addition to the results obtained earlier for the isotopes 188,189Os, experimental data on the photodisintegration of the isotopes 186,190,192Os are analyzed on the basis of specially introduced objective criteria of reliability of data on the cross sections for partial photoneutron reactions. It is found that the (γ, 1n), (γ, 2n), and (γ, 3n) cross sections for each isotope satisfy differently or, on the contrary, do not satisfy the data-reliability criteria. In many cases, the multiplicity transition functions specified as the ratios Fi = σ(γ, in)/σ(γ, xn) of the cross sections for the (γ, in) partial reactions to the neutron-yield reaction cross section σ(γ, xn) = σ(γ, 1n) + 2σ(γ, 2n) + 3σ(γ, 3n) +... have values that are physically unreliable by definition. It is shown that ambiguities in the dependence of significant systematic uncertainties in experimentally determined neutron multiplicities on the measured kinetic energies is the reason for this. The dependence of these uncertainties on the energy spectra of neutrons is analyzed. For the isotopes 186,190,192Os, new evaluated data satisfying the data-reliability criteria are obtained for the cross sections for partial and total photoneutron reactions

  5. Home Sweet Home?: Determining Habitability From the Eccentricities of Kepler-186

    McTier, Moiya; Kipping, David M.

    2016-01-01

    In the search for habitable exoplanets, astronomers' primary criterion has historically been that the planet's equilibrium temperature be suitable for liquid water. Equilibrium temperature is often determined assuming a circular orbit and, therefore, a constant star-planet separation, especially for low-mass transiting exoplanets. Using photometric data from the first Kepler mission, we analyze the transit light curves of Kepler 186, an exoplanetary system located approximately 150pc from Earth. In this poster, we report new lower limits on the eccentricities of the system found using the astrodensity profiling method and discuss how those values effect habitabilty. We also report other orbital, stellar, and planetary properties, which are consistent with, though slightly more precise than, the values reported in Quintana et al, 2014. We assert that, with an eccentricity of 0.092, a semimajor axis of 0.35 AU, and a radius of 1.06 Earth radii, Kepler 186f is an Earth-sized exoplanet that spends its entire orbit in the habitable zone of its star.

  6. Transitions, cross sections and neutron binding energy in 186Re by Prompt Gamma Activation Analysis

    Lerch, A. G.; Hurst, A. M.; Firestone, R. B.; Revay, Zs.; Szentmiklosi, L.; McHale, S. R.; McClory, J. W.; Detwiler, B.; Carroll, J. J.

    2014-03-01

    The nuclide 186Re possesses an isomer with 200,000 year half-life while its ground state has a half-life of 3.718 days. It is also odd-odd and well-deformed nucleus, so should exhibit a variety of other interesting nuclear-structure phenomena. However, the available nuclear data is rather sparse; for example, the energy of the isomer is only known to within + 7 keV and, with the exception of the J?=1- ground state, every proposed level is tentative in the ENSDF. Previously, Prompt Gamma Activation Analysis (PGAA) was utilized to study natRe with 186,188Re being produced via thermal neutron capture. Recently, an enriched 185Re target was irradiated by thermal neutrons at the Budapest Research Reactor to build on those results. Prompt (primary and secondary) and delayed gamma-ray transitions were measured with a large-volume, Compton-suppressed HPGe detector. Absolute cross sections for each gamma transition were deduced and corrected for self attenuation within the sample. Fifty-two primary gamma-ray transitions were newly identified and used to determine a revised value of the neutron binding energy. DICEBOX was used to simulate the decay scheme and the total radiative thermal neutron capture cross section was found to be 97+/-3 b Supported by DTRA (Detwiler) through HDTRA1-08-1-0014.

  7. ETAII 6 MEV PEPPERPOT EMITTANCE MEASUREMENT

    Paul, A C; Richardson, R; Weir, J

    2004-10-18

    We measured the beam emittance at the ETAII accelerator using a pepper-pot diagnostic at nominal parameters of 6 MeV and 2000 Amperes. During the coarse of these experiments, a ''new tune'' was introduced which significantly improved the beam quality. The source of a background pedestal was investigated and eliminated. The measured ''new tune'' emittance is {var_epsilon}= 8.05 {plus_minus} 0. 53 cm - mr or a normalized emittance of {var_epsilon}{sub n} = 943 {plus_minus} 63 mm - mr In 1990 the ETAII programmatic emphasis was on free electron lasers and the paramount parameter was whole beam brightness. The published brightness for ETAII after its first major rebuild was J = 1 - 3 x 10{sup 8} A/(m - rad){sup 2} at a current and energy of 1000-1400 Amperes and 2.5 MeV. The average normalized emittance derived from table 2 of that report is 864 mm-mr corresponding to a real emittance of 14.8 cm-mr.

  8. Contribution to the recognition of odd nuclei 'critical' with A next to 186

    The excited states of 185Au, 187Au, 185Pt and 187Pt, were studied. The decays of 187Hg, 185Hg, 187Au and 185Au were analysed, together with the following reactions: 175Lu(16O,4n)187Au at 95 MeV, 175Lu(16O,6n)185Au between 75 and 117 MeV, 176Yb(16O,5n)187Pt at 90MeV and 174Yb(16O,5n)185Pt at 95 MeV. The level schemes were established: collective structure built on high-j states issued from the hsup(9/2) and hsup(11/2) subshells in the gold nuclei and the isup(13/2) subshell in the Pt nuclei are pointed out. These structures are interpreted in the framework of the 'quasi-particle + asymmetric rotor' coupling model. Different deformation states are observed in the odd-mass gold nuclei with A187Pt and 185Pt is revealed. Furthermore the evolution from spherical to deformed shapes involves triaxial shapes

  9. Determination of full-energy peak efficiency at the center position of a through-hole-type clover detector between 0.05 MeV and 3.2 MeV by source measurements and Monte Carlo simulations

    Full-energy peak efficiency at the center position of a through-hole-type clover detector was determined by the measurement of standard sources and by Monte Carlo simulation. The coincidence summing under the large-solid-angle condition was corrected using Monte Carlo calculation based on the specific decay scheme for 133Ba, 152,154Eu, and 56Co. This allowed the peak efficiency to be extended from 0.05 MeV to 3.2 MeV with an approximate uncertainty of 3%. - Highlights: • Novel Ge detector having large solid angle for γ-ray measurements was developed. • Correction for coincidence summing was performed with measurements and simulation. • Peak efficiency was determined between 0.05 MeV and 3.2 MeV

  10. Neutron- and proton-induced evaluated transport library up to 150 MeV

    A new evaluated nuclear data library has been created. The library consists of two sub-libraries for neutron and proton incident particles. The neutron sub-library contains nuclear data for transport, heating and shielding applications for 242 nuclides with atomic numbers ranging from 8 to 82 in the energy region of primary neutrons from 10-5 eV to 150 MeV. Data below 20 MeV are taken mainly from ENDF/B-VI (revision 8) and for some nuclides, from the JENDL-3.3 and JEFF-3.0 libraries. The proton sub-library should contain data for the same range of target nuclides and energies. Proton-induced evaluated cross-section files are available for 15 nuclides at the moment. The evaluation of emitted particle energy and angular distributions at energies above 20 MeV (for incident neutrons) and above the reaction threshold (for incident protons) was performed with the help of the ALICE/ASH code and the analysis of available experimental data. The total cross-sections, elastic cross-sections and elastic scattering angular distributions were calculated with the help of the coupled channel model. The results of the calculation were adjusted to the data from ENDF/B-VI, JENDL-3.3, or JEFF-3.0 at the neutron energy equal to 20 MeV. The library is written in ENDF-6 format using the MF=3/MT=5 and MF=6/MT=5 representations

  11. Personal dose equivalent conversion coefficients for neutron fluence over the energy range of 20 to 250 MeV

    Mclean, Thomas D [Los Alamos National Laboratory; Justus, Alan L [Los Alamos National Laboratory; Gadd, S Milan [Los Alamos National Laboratory; Olsher, Richard H [RP-2; Devine, Robert T [RP-2

    2009-01-01

    Monte Carlo simulations were performed to extend existing neutron personal dose equivalent fluence-to-dose conversion coefficients to an energy of 250 MeV. Presently, conversion coefficients, H(p,slab)(10,alpha)/Phi, are given by ICRP-74 and ICRU-57 for a range of angles of radiation incidence (alpha = 0, 15, 30, 45, 60 and 75 degrees ) in the energy range from thermal to 20 MeV. Standard practice has been to base operational dose quantity calculations <20 MeV on the kerma approximation, which assumes that charged particle secondaries are locally deposited, or at least that charged particle equilibrium exists within the tally cell volume. However, with increasing neutron energy the kerma approximation may no longer be valid for some energetic secondaries such as protons. The Los Alamos Monte Carlo radiation transport code MCNPX was used for all absorbed dose calculations. Transport models and collision-based energy deposition tallies were used for neutron energies >20 MeV. Both light and heavy ions (HIs) (carbon, nitrogen and oxygen recoil nuclei) were transported down to a lower energy limit (1 keV for light ions and 5 MeV for HIs). Track energy below the limit was assumed to be locally deposited. For neutron tracks <20 MeV, kerma factors were used to obtain absorbed dose. Results are presented for a discrete set of angles of incidence on an ICRU tissue slab phantom.

  12. Little Boy neutron spectrum below 3 MeV

    The leakage neutron spectrum from the Little Boy replica has been measured from 12 keV to 3 MeV using a high-resolution 3He ionization chamber, and from 1 keV to 3 MeV using proton-recoil proportional counters. The 3He-spectrometer measurements were made at distances of 0.75 and 2.0 m from the active center and at angles of 00, 450, and 900 with respect to the axis of the assembly. Proton-recoil measurments were made at 900 to the assembly axis at distances of 0.75 and 2.0 m, with a shielded measurement made at 2.0 m to estimate background due to scattering. The 3He spectrometer was calibrated at Los Alamos using monoenergetic 7Li(p,n)7Be neutrons to generate a family of response functions. The proton-recoil counters were calibrated at Argonne by studying the capture of thermal neutrons by nitrogen in the counters, by observation of the 24-keV neutron resonance in iron, and by relating to the known hydrogen content of the counters. The neutron spectrum from Little Boy was found to be highly structured, with peaks corresponding to minima in the iron total neutron cross section. In particular, influence of the 24-keV iron window was evident in both sets of spectra. The measurements provide information for dosimetry calculations and also a valuable intercomparison of neutron spectrometry using the two different detector types. Spectra measured with both detectors are in essential agreement. 8 references, 7 figures, 2 tables

  13. Determination of (187)Os in molybdenite by ICP-MS with neutron-induced (186)Os and (188)Os spikes.

    Qu, W; Du, A; Zhao, D

    2001-10-31

    The article describes a method for the determination of (187)Os in molybdenite by isotope dilution inductively coupled plasma-mass spectrometry (ID-ICP-MS) with neutron-induced (186)Os and (188)Os spike. The spike used in the present work was prepared in line with the principle by which artificial nuclides are produced in a nuclear reaction. The concentration and isotopic composition of osmium in the prepared spike were evaluated accurately with the isotope dilution method, using negative thermal ion mass spectrometry (N-TIMS). The advantage of this method is that using (186)Os and (188)Os double spikes can effectively compensate for the mass discrimination effects of ICP-MS. Thus, the common correction practice for mass bias in the isotope dilution method with a single spike is unnecessary. In addition, the method enables one to reduce the determined error arising from instrumental instability. The precision for the (187)Os/((186)Os+(188)Os) ratio was approximately 2% (2sigma, RSD), but in the case of (187)Os/(186)Os, (187)Os/(188)Os and (186)Os/(188)Os, precision ranged from 2.0 to 8% (2sigma, RSD). The results for (187)Os concentration in a molybdenite sample determined with this method showed good agreement with reference values. PMID:18968429

  14. Unveiling the sodium intercalation properties in Na1.86□0.14Fe3(PO4)3

    Essehli, R.; Ben Yahia, H.; Maher, K.; Sougrati, M. T.; Abouimrane, A.; Park, J.-B.; Sun, Y.-K.; Al-Maadeed, M. A.; Belharouak, I.

    2016-08-01

    The new compound Na1.86□0.14Fe3(PO4)3 was successfully synthesized via hydrothermal synthesis and its crystal structure was determined using powder X-ray diffraction data. Na1.86Fe3(PO4)3 was also characterized by operando XRD and Mössbauer spectroscopy, cyclic voltammetry, and galvanostatic cycling. Na1.86Fe3(PO4)3 crystallizes with the alluaudite-type structure with the eight coordinated Na1 and Na2 sodium atoms located within the channels. The combination of the Rietveld- and Mössbauer-analyses confirms that the sodium vacancies in the Na1 site are linked to a partial oxidation of Fe2+ during synthesis. The electrochemical tests indicated that Na1.86Fe3(PO4)3 is a 3 V sodium intercalating cathode. At the current densities of 5, 10, and 20 mA g-1, the material delivers the specific capacities of 109, 97, and 80 mA h g-1, respectively. After 100 charge and discharge cycles, Na1.86Fe3(PO4)3 exhibited good sodium removal and uptake behavior although no optimizations of particle size, morphology, and carbon coating were performed.

  15. 14 MeV neutron work at the Lawrence Livermore National Laboratory

    The 14 MeV neutron work at Lawrence Livermore National Laboratory (LLNL) covers two main areas of interest to this Symposium: (1) measurements and calculations of differential cross sections; and (2) integral measurements of the neutron and gamma emission spectra. In both areas a large number of materials have been studied, spanning a wide mass range (6 < A < 239), of interest to fusion and hybrid reactors. In this presentation a brief description of the experimental techniques and calculational analysis is given for each of the above areas and the measured and calculated cross sections are discussed. 28 refs., 7 figs., 3 tabs

  16. 14 MeV neutron work at the Lawrence Livermore National Laboratory

    Hansen, L.F.

    1985-07-01

    The 14 MeV neutron work at Lawrence Livermore National Laboratory (LLNL) covers two main areas of interest to this Symposium: (1) measurements and calculations of differential cross sections; and (2) integral measurements of the neutron and gamma emission spectra. In both areas a large number of materials have been studied, spanning a wide mass range (6 < A < 239), of interest to fusion and hybrid reactors. In this presentation a brief description of the experimental techniques and calculational analysis is given for each of the above areas and the measured and calculated cross sections are discussed. 28 refs., 7 figs., 3 tabs.

  17. Neutron cross-sections for 55Mn in the energy range from 0.2 to 22 MeV

    RAHMAN, Abul Khaer Mohammad Rezaur

    2012-01-01

    Neutron total and differential elastic scattering cross-sections for 55Mn nucleus was calculated from different global spherical optical potential (SOP) sets for different neutron energies ranging from 0.2 MeV to 22 MeV using the well known computer program SCAT-2 on an IBM PC-AT. In addition, the angular distributions of elastically scattered neutrons at different neutron energies were calculated. The results were compared with those of the experimental data obtained from the EXFOR d...

  18. Study of the gamma spectra emitted in a nuclear reaction - Measurement of the half-lives of the levels 6.13 MeV, 6.92 MeV and 7.12 MeV of 16O

    When the energy shifts of the gamma spectrum released during a nuclear reaction are important compared with the detector resolution, the comparison of the experimental spectrum with theoretical spectra allows us to determine the half-life of the initial state of the transition. The calculation of the experimental spectrum implies to know the slowing-down of the recoil nucleus in the matter in order to take into account the Doppler effect. For recoil energies in the range of the MeV and for solid media, the Lindhard theory agrees well with experimental data. The phenomenon of deflection which appears at very low energies must be taken into account by restraining the measurement domain. By choosing an adequate media we can measure half-lives in the domain 1 and 100 fs without needing to take into account deflection effects. We have measured the half-life of the first 3 energy levels of 16O (6.135 MeV, 6.923 MeV and 7.121 MeV), these levels are reached through the reaction 19F(p,αγ)16O with proton incident energies ranging from 0.872 MeV to 2.42 MeV. We have used a coaxial germanium semi-conductor with lithium additions that was connected to an amplification line of Ortec type. 2 kinds of target have been used: calcium fluoride and copper fluoride evaporated on tantalum support. We have obtained the following values for the half-life: (16±4) fs for the 6.923 MeV level, (18±4) fs for the 7.121 MeV level, and for the 6.135 MeV we can only give a lower limit since the gamma decay occurs when the nucleus is at rest τ > 200 fs

  19. Updated Peach Bottom Model for MELCOR 1.8.6: Description and Comparisons

    Robb, Kevin R [ORNL

    2014-09-01

    A MELCOR 1.8.5 model of the Peach Bottom Unit 2 or 3 has been updated for MELCOR 1.8.6. Primarily, this update involved modification of the lower head modeling. Three additional updates were also performed. First, a finer nodalization of the containment wet well was employed. Second, the pressure differential used by the logic controlling the safety relief valve actuation was modified. Finally, an additional stochastic failure mechanism for the safety relief valves was added. Simulation results from models with and without the modifications were compared. All the analysis was performed by comparing key figures of merit from simulations of a long-term station blackout scenario. This report describes the model changes and the results of the comparisons.

  20. National Ignition Facility subsystem design requirements target area auxiliary subsystem SSDR 1.8.6

    This Subsystem Design Requirement (SSDR) establishes the performance, design, development, and test requirements for the Target Area Auxiliary Subsystems (WBS 1.8.6), which is part of the NIF Target Experimental System (WBS 1.8). This document responds directly to the requirements detailed in NIF Target Experimental System SDR 003 document. Key elements of the Target Area Auxiliary Subsystems include: WBS 1.8.6.1 Local Utility Services; WBS 1.8.6.2 Cable Trays; WBS 1.8.6.3 Personnel, Safety, and Occupational Access; WBS 1.8.6.4 Assembly, Installation, and Maintenance Equipment; WBS 1.8.6.4.1 Target Chamber Service System; WBS 1.8.6.4.2 Target Bay Service Systems

  1. 186 K Operation of Terahertz Quantum-Cascade Lasers Based on a Diagonal Design

    Kumar, Sushil; Hu, Qing; Reno, John L.

    2009-01-01

    Resonant-phonon terahertz quantum-cascade lasers operating up to a heat-sink temperature of 186 K are demonstrated. This record temperature performance is achieved based on a diagonal design, with the objective to increase the upper-state lifetime and therefore the gain at elevated temperatures. The increased diagonality also lowers the operating current densities by limiting the flow of parasitic leakage current. Quantitatively, the diagonality is characterized by a radiative oscillator strength that is smaller by a factor of two from the least of any previously published designs. At the lasing frequency of 3.9 THz, 63 mW of peak optical power was measured at 5 K, and approximately 5 mW could still be detected at 180 K.

  2. Molecular identification and antifungal susceptibility of 186 Candida isolates from vulvovaginal candidiasis in southern China.

    Shi, Xiao-Yu; Yang, Yan-Ping; Zhang, Ying; Li, Wen; Wang, Jie-Di; Huang, Wen-Ming; Fan, Yi-Ming

    2015-04-01

    There is limited information regarding the molecular epidemiology and antifungal susceptibilities of Candida isolates using the Neo-Sensitabs method in patients with vulvovaginal candidiasis (VVC). From August 2012 to March 2013, 301 non-pregnant patients aged 18-50 years with suspected VVC were prospectively screened at a teaching hospital in southern China. The vaginal isolates were identified by DNA sequencing of internal transcribed spacer and the D1/D2 domain. Antifungal susceptibility testing of seven antifungal agents was performed using the Neo-Sensitabs tablet diffusion method. Candida species were isolated from 186 cases (61.79 %). The most common pathogen was Candida albicans (91.4 %), followed by Candida glabrata (4.3 %), Candida tropicalis (3.2 %) and Candida parapsilosis (1.1 %). The susceptibility rates to C. albicans were higher for caspofungin, voriconazole and fluconazole than those for itraconazole, miconazole, ketoconazole and terbinafine (Ptreatment of VVC. PMID:25596116

  3. A protein-truncating R179X variant in RNF186 confers protection against ulcerative colitis.

    Rivas, Manuel A; Graham, Daniel; Sulem, Patrick; Stevens, Christine; Desch, A Nicole; Goyette, Philippe; Gudbjartsson, Daniel; Jonsdottir, Ingileif; Thorsteinsdottir, Unnur; Degenhardt, Frauke; Mucha, Sören; Kurki, Mitja I; Li, Dalin; D'Amato, Mauro; Annese, Vito; Vermeire, Severine; Weersma, Rinse K; Halfvarson, Jonas; Paavola-Sakki, Paulina; Lappalainen, Maarit; Lek, Monkol; Cummings, Beryl; Tukiainen, Taru; Haritunians, Talin; Halme, Leena; Koskinen, Lotta L E; Ananthakrishnan, Ashwin N; Luo, Yang; Heap, Graham A; Visschedijk, Marijn C; MacArthur, Daniel G; Neale, Benjamin M; Ahmad, Tariq; Anderson, Carl A; Brant, Steven R; Duerr, Richard H; Silverberg, Mark S; Cho, Judy H; Palotie, Aarno; Saavalainen, Päivi; Kontula, Kimmo; Färkkilä, Martti; McGovern, Dermot P B; Franke, Andre; Stefansson, Kari; Rioux, John D; Xavier, Ramnik J; Daly, Mark J; Barrett, J; de Lane, K; Edwards, C; Hart, A; Hawkey, C; Jostins, L; Kennedy, N; Lamb, C; Lee, J; Lees, C; Mansfield, J; Mathew, C; Mowatt, C; Newman, B; Nimmo, E; Parkes, M; Pollard, M; Prescott, N; Randall, J; Rice, D; Satsangi, J; Simmons, A; Tremelling, M; Uhlig, H; Wilson, D; Abraham, C; Achkar, J P; Bitton, A; Boucher, G; Croitoru, K; Fleshner, P; Glas, J; Kugathasan, S; Limbergen, J V; Milgrom, R; Proctor, D; Regueiro, M; Schumm, P L; Sharma, Y; Stempak, J M; Targan, S R; Wang, M H

    2016-01-01

    Protein-truncating variants protective against human disease provide in vivo validation of therapeutic targets. Here we used targeted sequencing to conduct a search for protein-truncating variants conferring protection against inflammatory bowel disease exploiting knowledge of common variants associated with the same disease. Through replication genotyping and imputation we found that a predicted protein-truncating variant (rs36095412, p.R179X, genotyped in 11,148 ulcerative colitis patients and 295,446 controls, MAF=up to 0.78%) in RNF186, a single-exon ring finger E3 ligase with strong colonic expression, protects against ulcerative colitis (overall P=6.89 × 10(-7), odds ratio=0.30). We further demonstrate that the truncated protein exhibits reduced expression and altered subcellular localization, suggesting the protective mechanism may reside in the loss of an interaction or function via mislocalization and/or loss of an essential transmembrane domain. PMID:27503255

  4. Stability of biodegradable radioactive rhenium (Re-186 and Re-188) microspheres after neutron-activation

    Our objective was to determine if microspheres made from the biodegradable polymer poly(lactic acid) that contained rhenium could withstand the conditions of direct neutron activation necessary to produce therapeutic amounts of radioactive rhenium. The radiation damage of the polymer produced by γ-doses of up to 1.05 MGy from Re-186 and Re-188 was examined by scanning electron microscopy and size exclusion chromatography. At a thermal neutron flux of 1.5x1013 n/cm2/s the microspheres melted after 3 h in the nuclear reactor, but suffered little damage after 1 h of radiation and released less than 5% of the radioactivity during incubation in buffer at 37 deg. C. The radioactive microspheres produced in this manner have a specific activity too low for radioembolization for treatment of liver tumors, but could be injected directly into tumors or applied topically to the wound bed of partially resected tumors

  5. Elastic scattering of neutron from 40Ca at 65-225 MeV

    We show the radial behavior of real part and imaginary part of the calculated central optical potential for n - 40Ca elastic scattering at incident energies En = 65, 75, 85, 95, 107.5, 127.5, 155, 185, 225 MeV using Urbana V-14 and Hamada Johnston realistic interaction. In the present work, we have analyzed neutron elastic scattering data at 65, 75, 85, 107.5, 127.5, 155, 185, 225 MeV from 40Ca using optical model potential calculated in first order Brueckner theory from two sources. We have used Urbana V-14 soft core inter nucleon potential as well as hard core Hamada Johnston inter- nucleon potential. We denote the neutron-nucleus optical potential obtained using soft-core potential by V-14 and for the hard-core potential by HJ

  6. The design of a proton recoil telescope for 14 MeV neutron spectrometry

    Hawkes, N P; Croft, S; Jarvis, O N; Sherwood, A C

    2002-01-01

    As part of the design effort for a 14 MeV neutron spectrometer for the Joint European Torus (JET), computer codes were developed to calculate the response of a proton recoil telescope comprising a proton radiator film mounted in front of a proton detector. The codes were used to optimise the geometrical configuration in terms of efficiency and resolution, bearing in mind the constraints imposed by the proposed application as a JET neutron diagnostic for the Deuterium-Tritium phase. A prototype instrument was built according to the optimised design, and tested with monoenergetic 14 MeV neutrons from the Harwell 500 keV Van de Graaff accelerator. The measured energy resolution and absolute efficiency were found to be in acceptable agreement with the calculations. Based on this work, a multi-radiator production version of the spectrometer has now been constructed and successfully deployed at JET.

  7. High-sensitivity measurements of the excitation function for Bhabha scattering at MeV energies

    Using a monochromatic e+ beam scattered on a Be foil and a high-resolution detector device, the excitation function for elastic e+e- scattering was measured with a statistical accuracy of 0.25% in 1.4 keV steps in the c.m.-energy range between 770 keV and 840 keV (1.79 - 1.86 MeV/c2) at c.m. scattering angles between 800 and 1000 (FWHM). Within the experimental sensitivity of 0.5 b.eV/sr (c.m.) for the energy-integrated differential cross section no resonances were observed (97% CL). From this limit we infer that a hypothetical spinless resonant state should have a width of less than 1.9 meV corresponding to a lifetime limit of 3.5x10-13 s. This limit establishes the most stringent bound for new particles in this mass range derived from Bhabha scattering and is independent of assumptions about the internal structure of the hypothetical particles. Less sensitivite limits were, in addition, derived around 520 keV c.m. energy (≅ 1.54 MeV/c2) from an investigation with a thorium and a mylar foil as scatterers. (orig.)

  8. Measurement and evaluation of neutron spectra above 0.1 MeV in the JMTR

    The evaluation of fast neutron spectra from the Japan Materials Testing Reactor (JMTR) have been performed by using the critical facility of the JMTR and by a combination of the multi-foil activation method and the adjustment codes (SAND II and NEUPAC). In order to measure and evaluate the neutron spectra above 0.1 MeV, resonance detectors such as manganese, gold and copper have been used to determine the neutron flux level in the 1/E region and threshold detectors such as silver, rhodium, indium, uranium, aluminium, magnesium and titanium have been used to determine the neutron flux level above 0.1 MeV. The foils for the measurement of the neutron reaction rate were separately irradiated. The 115In(n, n')sup(115m)In reaction is used for the monitoring of the average fast neutron flux in the irradiation period, and the slight difference of each irradiation condition was corrected. The guess spectra for the neutron spectrum adjustment were calculated by using the one-dimensional discrete-ordinates code ANISN with the slab model for the JMTR core. Some important points were concluded through the adjustment procedure of the neutron spectrum: the adjusted spectrum from 0.1 to 1 MeV depends on the accuracy of the neutron cross section data for the threshold detectors such as silver and rhodium, and also on the accuracy of these reaction rates. The ratio of neutron flux above 0.183 MeV to neutron flux above 1 MeV were calculated from the guess spectra and the adjusted spectra, and the ratios were in good agreement with each other. (orig.)

  9. Improved tumour response prediction with equivalent uniform dose in pre-clinical study using direct intratumoural infusion of liposome-encapsulated 186Re radionuclides

    Crucial to all cancer therapy modalities is a strong correlation between treatment and effect. Predictability of therapy success/failure allows for the optimization of treatment protocol and aids in the decision of whether additional treatment is necessary to prevent tumour progression. This work evaluated the relationship between cancer treatment and effect for intratumoural infusions of liposome-encapsulated 186Re to head and neck squamous cell carcinoma xenografts of nude rats. Absorbed dose calculations using a dose-point kernel convolution technique showed significant intratumoural dose heterogeneity due to the short range of the beta-particle emissions. The use of three separate tumour infusion locations improved dose homogeneity compared to a single infusion location as a result of a more uniform radioactivity distribution. An improved dose-response correlation was obtained when using effective uniform dose (EUD) calculations based on a generic set of radiobiological parameters (R2 = 0.84) than when using average tumour absorbed dose (R2 = 0.22). Varying radiobiological parameter values over ranges commonly used for all types of tumours showed little effect on EUD calculations, which suggests that individualized parameter use is of little significance as long as the intratumoural dose heterogeneity is taken into consideration in the dose-response relationship. The improved predictability achieved when using EUD calculations for this cancer therapy modality may be useful for treatment planning and evaluation.

  10. Characterization of 2 MeV, 4 MeV, 6 MeV and 18 MeV buildup caps for use with a 0.6 cubic centimeter thimble ionization chamber

    The purpose of this research is to characterize existing 2 MeV, 4 MeV and 6 MeV buildup caps, and to determine if a buildup cap can be made for the 0.6 cm3 thimble ionization chamber that will accurately measure exposures in a high-energy photon radiation field. Two different radiation transport codes were used to computationally characterize existing 2 MeV, 4 MeV, and 6 MeV buildup caps for a 0.6 cm3 active volume thimble ionization chamber: ITS, The Integrated TIGER Series of Coupled Electron-Photon Monte Carlo Transport Codes; and CEPXS/ONEDANT, A One-Dimensional Coupled Electron-Photon Discrete Ordinates Code Package. These codes were also used to determine the design characteristics of a buildup cap for use in the 18 MeV photon beam produced by the 14 TW pulsed power HERMES-III electron accelerator. The maximum range of the secondary electron, the depth at which maximum dose occurs, and the point where dose and collision kerma are equal have been determined to establish the validity of electronic equilibrium. The ionization chamber with the appropriate buildup cap was then subjected to a 4 MeV and a 6 MeV bremmstrahlung radiation spectrum to determine the detector response

  11. Review of neutron data: 10 to 40 MeV

    Neutron data are reviewed for incident neutron energies between 10 and 40 MeV. A census of the data shows that there are many gaps in this range and that the existing data are primarily for neutron energies around 14 MeV. Aside from total cross sections, there are few data between 10 and 13 MeV and between 15 and 40 MeV. Examples are presented to show the quality of selected data for total, elastic, inelastic, activation, and charged-particle and gamma-ray production cross sections. The spectra of emitted particles are also discussed

  12. Characterization of 2 MeV, 4 MeV, 6 MeV and 18 MeV buildup caps for use with a 0.6 cubic centimeter thimble ionization chamber

    Salyer, R.L.; VanDenburg, J.W.; Prinja, A.K.; Kirby, T.; Busch, R. [Univ. of New Mexico, Albuquerque, NM (United States); Hong-Nian Jow [Sandia National Laboratories, Albuquerque, NM (United States)

    1996-07-01

    The purpose of this research is to characterize existing 2 MeV, 4 MeV and 6 MeV buildup caps, and to determine if a buildup cap can be made for the 0.6 cm{sup 3} thimble ionization chamber that will accurately measure exposures in a high-energy photon radiation field. Two different radiation transport codes were used to computationally characterize existing 2 MeV, 4 MeV, and 6 MeV buildup caps for a 0.6 cm{sup 3} active volume thimble ionization chamber: ITS, The Integrated TIGER Series of Coupled Electron-Photon Monte Carlo Transport Codes; and CEPXS/ONEDANT, A One-Dimensional Coupled Electron-Photon Discrete Ordinates Code Package. These codes were also used to determine the design characteristics of a buildup cap for use in the 18 MeV photon beam produced by the 14 TW pulsed power HERMES-III electron accelerator. The maximum range of the secondary electron, the depth at which maximum dose occurs, and the point where dose and collision kerma are equal have been determined to establish the validity of electronic equilibrium. The ionization chamber with the appropriate buildup cap was then subjected to a 4 MeV and a 6 MeV bremmstrahlung radiation spectrum to determine the detector response.

  13. 14 MeV neutrons physics and applications

    Valkovic, Vladivoj

    2015-01-01

    Despite the often difficult and time-consuming effort of performing experiments with fast (14 MeV) neutrons, these neutrons can offer special insight into nucleus and other materials because of the absence of charge. 14 MeV Neutrons: Physics and Applications explores fast neutrons in basic science and applications to problems in medicine, the environment, and security.Drawing on his more than 50 years of experience working with 14 MeV neutrons, the author focuses on:Sources of 14 MeV neutrons, including laboratory size accelerators, small and sealed tube generators, well logging sealed tube ac

  14. Eradication of colon cancer cells before tumour formation in the peritoneal cavity of mice treated with intraperitoneal Re-186 radioimmunotherapy

    A treatment adjuvant to surgical resection of the primary lesion has been proven to be beneficial in improving the prognosis of patients with high risks of peritoneal dissemination of colon cancer. This study was performed to determine the comparative efficacy of intraperitoneal radioimmunotherapy (RIT) using Re-186 or I-131 labeled murine antibodies in the extermination of cancer cells. A murine anti-colorectal IgG1, A7 monoclonal antibody, was radio-labeled either with I-131 (by the chloramine-T method) or Re-186 (by the MAG3 pre-chelated method). A total number of 16 mice were subjected to RIT with Re-186 A7 (N=8) or I-131 A7 (N=8) at equitoxic doses in Balb/c bu/nu mice 10 min after intraperitoneal injection of LS180 human colon cancer cells. A third group of mice were subjected to chemotherapy with 5-fluorouracil at 30 mg/kg for 4 consecutive days following the intraperitoneal injection of the same LS180 human colon cancer cells. There were 19 mice in the control group who were not subjected to any form of therapy. The results revealed that the mean survival of mice in the control (N-19), I-131 A7 RIT (N=8) and Chemotherapy (N=6) groups were 33.8 ± 1.0, 80.1 ± 2.5 and 49.3 ± 5.3 days respectively. The eight mice who were subjected to Re-186 A7 RIT showed much better survival compared to the other groups. Two of the eight mice from this group died at 105 and 111 days following Re-186 A7 RIT. Other six mice were sacrificed at 172 days, and autopsy revealed no macroscopic peritoneal tumor growth. Based on this pilot study we concluded that individual tumor cells in the peritoneal cavity would be effectively exterminated by intraperitoneal RIT with Re-186 A7. (author)

  15. Interactions of 29 MeV. He3 particles with light nuclei

    The interactions of 29 MeV He3 particles with 32S, 19F and 12C, irradiated in the Nuffield cyclotron (Birmingham University) have been studied using the nuclear emulsion technique. The first excitation levels of 12C and 32S have been obtained and the pick-up reaction 12C(3He, 4He) 11C has been studied and used to calculate its Q-values and the first levels of 1C. (Author) 24 refs

  16. Predictions of 200 MeV proton scattering from polarized 3He

    Predictions of the differential cross sections and spin observables of p-3He scattering at 200 MeV have been made using a microscopic model of scattering in which a complex, nonlocal optical potential is obtained by full folding an effective two-nucleon interaction with nuclear structure found from a large basis shell model calculation. Good fits to data were obtained but there remains a need for better spectroscopy of the target. (authors)

  17. Large momentum transfer neutron pickup with the (. pi. /sup +/,p) and (p,d) reactions. [90 and 180 MeV, 800 MeV

    Smith, G.R.

    1980-01-01

    The (p,d) reaction was studied for the first time at 800 MeV on seven targets ranging from /sup 7/Li to /sup 40/Ca. The experimental resolution (approx. 400 keV) attained was sufficient to observe many discrete levels in each of the residual nuclei. A modified version of the one-nucleon model successfully describes the magnitude and angular dependence of almost all of the transitions observed. A specific counter example to the two-nucleon model of the reaction mechanism is suggested. The calculations are also sensitive to the neutron single-particle wave function, in accordance with the expectation that the high-momentum components of this wave function are probed at higher bombarding energies. States that have never been seen before were strongly populated in the high excitation region (up to 25 MeV) of some of the residual nuclei. The relative intensities of the other levels observed suggest that coupled-channels mechanisms play an important role for some of these states. Explicit calculations were performed to confirm this for several examples. The first high-resolution measurements of the (..pi../sup +/,p) reaction were also performed on /sup 6/Li, /sup 7/Li, /sup 12/C, and /sup 13/C at pion bombarding energies on and off the pion-nucleon resonance. Calculations employing a one-nucleon model of the reaction mechanism similar to the model successfully used for the (p,d) reaction are unable to account for transitions in the (..pi../sup +/,p) reaction. It is, however, unclear whether this failure is due to a fundamental inadequacy of the model or improper treatment of details in the calculations. A striking similarity was observed in the spectra of the (..pi../sup +/,p) and 800-MeV (p,d) reactions on the same target; this result implies a similar mechanism for the two reactions. 120 references, 97 figures, 15 tables.

  18. A mathematical method to calculate efficiency of BF3 detectors

    SI Fenni; HU Qingyuan; PENG Taiping

    2009-01-01

    In order to calculate absolute efficiency of the BF3 detector, MCNP/4C code is applied to calculate rela-tive efficiency of the BF3 detector first, and then absolute efficiency is figured out through mathematical techniques. Finally an energy response curve of the BF3 detector for 1~20 MeV neutrons is derived. It turns out that efficiency of BF3 detector are relatively uniform for 2~16 MeV neutrons.

  19. Response of LaBr3(Ce) scintillators to 14 MeV fusion neutrons

    The response of a 3″×3″ LaBr3(Ce) scintillator to 14 MeV neutron irradiation has been measured at the Frascati Neutron Generator and simulated by means of a dedicated MCNP model. Several reactions are found to contribute to the measured response, with a key role played by neutron inelastic scattering and (n,2n) reactions on 79Br, 81Br and 139La isotopes. An overall 43% efficiency to 14 MeV neutron detection above an experimental threshold of 0.35 MeV is calculated and confirmed by measurements. Post irradiation activation of the crystal has been also observed and is explained in terms of nuclear decays from the short lived 78Br and 80Br isotopes produced in (n,2n) reactions. The results presented in this paper are of relevance for the design of γ-ray detectors in burning plasma fusion experiments of the next generation, such as ITER, where capability to perform measurements in an intense 14 MeV neutron flux is required

  20. Valine radiolysis by MeV ions

    Da Silveira, Enio

    2016-07-01

    Valine, (CH3)2 CHCH (NH2) COOH, is a protein amino acid that has been identified in extraterrestrial environments and in the Murchison meteorite [1]. The knowledge of half-lives of small organic molecules under ionizing radiation is important for the setup of models describing the spread out of prebiotics across the Solar System or the Galaxy. We have investigated typical effects of MeV cosmic ray ions on prebiotic molecules in laboratory by impinging ions produced by the PUC-Rio Van de Graaff accelerator. Pure valine films, deposited by evaporation on KBr substrates, were irradiated by H ^{+}, He ^{+} and N ^{+} ion beams, from 0.5 to 1.5 MeV and up to a fluence of 10 ^{15} projectiles/cm ^{2}. The sample temperature was varied from 10 K to 300 K. The irradiation was interrupted several times for Mid-FTIR analysis of the sample. The main findings are: 1- The column density of the valine decreases exponentially with fluence. 2- In some cases, a second exponential appears in the beginning of irradiation; this feature has been attributed to sample compaction by the ion beam [2]. 3- Destruction cross sections of valine are in the 10 ^{-15} cm ^{2} range, while compaction cross sections are in the 10 ^{-14} cm ^{2} range. 4- Destruction cross section increases with the stopping power of the beam and also with the sample temperature. 5- Surprisingly, during the radiolysis of valine, just CO _{2} is seen by as a daughter molecule formed in the bulk. 6- After long beam fluence, also a CO peak appears in the infrared spectrum; this species is however interpreted as a fragment of the formed CO2 molecules. 7- Considering the flux ratio between laboratory experiments and actual galactic cosmic rays, half-life of valine is predicted for ISM conditions [3]. This work on pure valine is the first measurement of a series. New experiments are planned for determining cross sections of valine dissolved in H _{2}O or CO _{2}, inspired by the study performed for glycine [4]. [1] P

  1. Analysis of Neutron Double-Differential Cross Section of n+14N at 14.2 MeV

    YANYu-Liang; DUANJun-Feng; SUNXiao-Jun; WANGJi-Min; ZHANGJing-Shang

    2005-01-01

    Abstract By using a new reaction model for light nuclei, the double-differential cross section of n+14N reactions at En=14.2 MeV has been analyzed. In the case of n+14N reactions, the reaction mechanism is very complex, there are over one hundred opened partial reaction channels even at incident energy En=14.2 MeV. In this paper the opened reaction channels are listed in detail. With LUNF code the model calculation is performed to analyze the doubledifferential cross sections of total outgoing neutron. The calculated results agree fairly with the experimental data. The results indicate that the pre-equilibrium mechanism dominates the whole reaction processes, and the recoil egect in light nuclear reactions is essentially important. 5He emission has been considered, but it is only a small contribution to thedouble-differential cross section at incident energy En=14.2 MeV.

  2. Analysis of Neutron Double-Differential Cross Section of n+14N at 14.2 MeV

    YAN Yu-Liang; DUAN Jun-Feng; SUN Xiao-Jun; WANG Ji-Min; ZHANG Jing-Shang

    2005-01-01

    By using a new reaction model for light nuclei, the double-differential cross section of n+14N reactions at En = 14.2 MeV has been analyzed. In the case of n+14N reactions, the reaction mechanism is very complex, there are over one hundred opened partial reaction channels even at incident energy En = 14.2 MeV. In this paper the opened reaction channels are listed in detail. With LUNF code the model calculation is performed to analyze the doubledifferential cross sections of total outgoing neutron. The calculated results agree fairly with the experimental data. The results indicate that the pre-equilibrium mechanism dominates the whole reaction processes, and the recoil effect in light nuclear reactions is essentially important. 5He emission has been considered, but it is only a small contribution to the double-differential cross section at incident energy En = 14.2 MeV.

  3. Measuring the capability of resisting 14 MeV neutron yawp of domestic LaCl3 scintillator

    When measuring γpulse in 14 MeV neutron radiation field with LaCl3 scintillator, the γ sensitivity is necessarily know. At the same time, the capability of resisting 14 MeV neutron yawp should also be necessarily know, too. In this paper, the γ sensitivities of LaCl3 and CeF3 are measured in steady γ radiation field, and the neutron sensitivities of both are measured in 14 MeV pulse neutron radiation field which FWHM is about 10-6 s. The capability of resisting 14 MeV neutron yawp of LaCl3 scintillator is calculated according to that of CeF3 scintillator. The result shows that the capability of resisting 14 MeV neutron yawp of LaCl3 is comparative with that of CeF3. The ratio of above results adopting electric charge method is 1, the ratio of above results adopting peak value method is closely 2. The ratio of capability of resisting 14 MeV neutron yawp of LaCl3 and ST401 is more 10. (authors)

  4. Continuum spectra analysis of (p, d) and (n, d) reactions on Bi in several tens of MeV energy region

    Theoretical analyses of the double differential cross sections for proton and neutron induced deuteron pickup reactions on 209Bi are described. Neutron induced reaction cross-section data were analyzed at incident energies from about 41 MeV to 65 MeV and at 20deg laboratory angle, while proton induced reaction cross-section data were analyzed at the incident energy of 42 MeV and at 25deg laboratory angle. Spectrum regions are treated in the direct reaction scheme, i.e., several tens of MeV energy region. The double differential cross section - energy spectra were analyzed using the DWBA-based cross sections and the asymmetric Lorentzian form strength response function having energy dependent spreading width. Both the (n,d) and (p,d) spectra are fairly well reproduced by the theoretical calculations in the tens of MeV energy region. (author)

  5. Accuracy of calculation of neutron detection efficiency

    The problems of the accuracy for the scintillator spectrometer calculation of neutron recording efficiency value are discussed. The calculation is performed by the method of direct simulation of neutron interaction with the scintillator substance. The preliminary calculations show that a contribution to efficiency of neutron recording in the range of energies of 10 through 50 MeV due to interaction of neutrons with carbon is mostly determined by reactions 12(in n' 2α)4He and 12(n, n' p)11B. The effciency calculation results are given for the cylindrical crystal of stilbene. Measurements of the neutron recording efficiency in the range of energies from 10 MeV indicate a good agreement between the calculation and the experiment

  6. 10 MeV Medical Cyclotron Prototype Beam Commissioning

    GUAN; Feng-ping; GE; Tao; YIN; Zhi-guo; SONG; Guo-fang; ZHANG; Tian-jue; JI; Bin; LI; Peng-zhan; CAO; Lei; HOU; Shi-gang; LIU; Geng-shou; WANG; Feng; LEI; Yu; WU; Long-cheng; WEN; Li-peng; LI; Zhen-guo; CUI; Tao; JIA; Xian-lu; YAO; Hong-juan; PAN; Gao-feng; ZHANG; Su-ping; CAI; Hong-ru; XIE; Huai-dong

    2012-01-01

    <正>A 10 MeV medical cyclotron prototype for the production of short-lived isotopes has been developed independently at CIAE with a time span of 2 years. On the inner target, 8 hours stability test has been finished. The extraction beam is 10 MeV with a beam intensity of 100 μA.

  7. Ternary fission with 4He emission in 16O(144 Mev) + 232Th and 12C(108 Mev) + 197Au reactions

    Results of coincidence study of 4He emission with fission fragments in 12C (108 MeV) ions with sup(197)Au target and 16O (144 MeV) ions with sup(223)Th target reactions are presented. On the basis of Monte Carlo kinematic simulation of nuclear reactions analysis of energy and velocity spectra of α-particles has been performed. The conclusion has been performed. The conclusion has been drawn that the main source of 4He emission was the evaporation from a fissioning compound nucleus. Substantial part of α-particles was emitted from fully accelerated fission fragments. Some of 4He nuclei with mean energy of about 16 MeV emitted mainly perpendicular to the fission axis were identified as similar to long range α-particles in ternary fission of heavy nuclei with low excitation energy. Multiplicities of emission of these particles are considerably higher than those at low excitation energy. Comparison of experimental results with statistical model calculations has been made

  8. Simulation of Neutron Production in Selected Targets by Proton and Deuteron Beam in Energy Range from 10 MeV to 75 MeV

    Initial inter-comparison study of simulation of neutron production by beam of protons and deuterons in different target materials, in energy range from 10 MeV to 75 MeV, is shown in the paper. An idealised cylindrical (diameter = height = 2.5 cm) target is bombarded, along the central axis, perpendicularly at target base, by an infinite thin particle beam. Simulation is carried out for the target surrounded by void, i.e., the 'return effect' from surrounding materials in a real system is not encountered. The study is carried out using Monte Carlo based computer codes for intermediate and high-energy nucleon transport: LCS, ver.2.7 (LANL, USA) and SHIELD (INR, Russia). Yield (total number of neutrons in 4 , per incident particle) and spectrum of neutrons escaping the target surfaces are determined for different targets made from 208Pb/Pb, 238U/U, 184W/W, Be and 7Li. Maximum neutron yield, near 30%, is calculated for proton beam energy of 75 MeV bombarding 238U/U target, shaped as mentioned above. Generally, neutron yield for deuteron beam is less than neutron yield for proton beam of the same energy for targets made from high-Z nuclides. The opposite conclusion is derived for targets made from low-Z nuclides. (author)

  9. Study of the reaction mechanisms leading to projectile fragmentation in 40 Ar + Ag nat reactions at 30 MeV and 60 MeV per nucleon

    This work is devoted to a study of the reaction mechanisms leading to projectile fragmentation in heavy ion collisions at intermediate energy (less than 100 MeV per nucleon). In contradiction with some theoretical calculations, inclusive measurements of projectile fragments as well as correlation measurements between projectile and target fragments in the reaction 40Ar + natAg at 30 MeV and 60 MeV per nucleon do not show any evidence for a change in the reaction mechanism in this energy range. Angular, mass and velocity correlations between projectile and target fragments enable us to reject mass transfer from projectile to target as a leading mechanism in projectile fragmentations. However, a coherent description of the data can be given either in the framework of an abrasion-ablation model in which the primary fragments of the projectile and of the target are produced with very low excitation energies, or assuming a two-body reaction, reminiscent of the first steps of deeply inelastic collisions, in which the dissipated energy is shared about equally between strongly excited projectile and target. The high excitation energies deduced from the two-body analysis bring in question our description of the fragmentation process. Thus, the excitation energy of the primary fragment is a key parameter which may be used in future experiments to distinguish between different reaction mechanisms

  10. Radiopharmaceutical therapy of bone metastases with {sup 89}SrCl{sub 2}, {sup 186}Re-HEDP and {sup 153}Sm-EDTMP: a dosimetric study using Monte Carlo simulation

    Strigari, L.; D' Andrea, M.; Benassi, M. [Regina Elena Cancer Institute, Laboratory of Medical Physics and Expert Systems, Rome (Italy); Sciuto, R.; Pasqualoni, R.; Maini, C.L. [Regina Elena Cancer Institute, Nuclear Medicine Department, Rome (Italy)

    2007-07-15

    The aim of the paper is to calculate the dose to bone surface and bone volume using a Monte Carlo particle transport model and to give quantitative arguments for activity prescription. This study simulates the dose delivery process to skeletal metastases by bone surface- and bone volume-seeking radiopharmaceuticals. Dose distributions for three radiopharmaceuticals, {sup 186}Re-HEDP, {sup 153}Sm-EDTMP and {sup 89}SrCl{sub 2}, frequently used for pain palliation therapies, were calculated using the EGSnrc Monte Carlo code. The model simulates a cylindrical geometry with regions of different constant density compositions and radioactivity distribution consistent with known biodistribution features of the three radiopharmaceuticals: superficial for phosphonates ({sup 186}Re-HEDP and {sup 153}Sm-EDTMP) and volumetric for {sup 89}SrCl{sub 2}. After 3D dose distribution calculation, dose-volume histogram reduction was carried out using the ''preferred Lyman'' method, which yields effective uniform dose (D{sub eff}) equivalent to the inhomogeneous dose distributions to the reference region (volume and surface). Our simulations showed that to obtain a delivered dose to bone surface equivalent to that obtained from {sup 89}SrCl{sub 2}, the administered activities of {sup 153}Sm-EDTMP and {sup 186}Re-HEDP should be increased by 37% and 48%, respectively, in comparison with those usually administered. These results prove theoretically the empirical results from clinical observations and show that improvement in bone pain palliation by means of radiopharmaceutical therapy should be expected for dose-guided prescription. (orig.)

  11. Tc-99m and Re-186 complexes of tetraphosphonate ligands and their biodistribution pattern in animal models

    The syntheses of four α-aminomethyl phosphonates and their complexation studies with 99mTc and 186/188Re are reported. Complexation conditions were standardized to give maximum yields, which ranged from 90-97%. The yields of complexation were estimated by paper chromatography. The 99mTc complexes were stable for more than 4 h, while the 186/188Re complexes were stable for 3-8 days when stored at 4 deg. C. Biodistribution of these complexes in Wistar rats were carried out, and the uptake in bone and other soft tissue are detailed. Bone uptake of the 99mTc complexes varied from 40-60% at 30 min postinjection depending on the ligands. The uptake in soft tissue was minimum with all the complexes. A comparison of the biodistribution studies of the 99mTc complexes with that of the well-established radiopharmaceutical 99mTc-MDP was carried out for the purpose of evaluating the efficacy of the radiopharmaceutical preparation with the complexes of these ligands. The bone uptake of the 186/188Re complexes varied from 19-28% corresponding to 1.6-3% per g at 3 h postinjection. The residual activity in both 99mTc and 186/188Re complexes showed renal clearance

  12. Why the 18.6 year tide cannot explain the change of sign observed in j2

    F. Deleflie

    2003-01-01

    Full Text Available Recent studies show a change, starting in 1998, in the behavior of the variation of the dynamical flattening of the Earth (J2, supposed to be constant (secular, and mainly due to the post glacial rebound effect. In this paper, we study to what extent this behavior can be correlated or not with the 18.6 year tide: with more than twenty years of tracking data on LAGEOS-1, that is to say more than a period of 18.6 years, this effect can now be separated from the secular variation. We use our theory of mean orbital motion, dedicated to studies of the long period effects on the orbital motion. We build one single arc of LAGEOS-1 from 1980 to 2002, which provides a continuous description of the orbital parameters. This is the great originality of our approach. We focus our attention on the ascending node of LAGEOS-1, and we show that the change observed in j2 cannot be attributed to a statistical error due to a correlation, in short arcs results, between the secular variation of J2 and the 18.6 year tide. The proof is based on the adjustment of amplitudes and phases of the long period tides, and on the shape of the residuals.Key words. secular variation of J2, 18.6 year tide, mean orbital motione

  13. Inhibitory effect of free radical scavenger, MCI-186, in the increase of hydroxyl radical induced by iminodipropionitrile in rats.

    Nomoto, Nobuatsu

    2004-04-15

    Beta,beta'-Iminodipropionitrile (IDPN) is known to produce permanent motor behavioral abnormalities in rats. This behavior syndrome is also termed as "ECC Syndrome", the animal model for Gilles de la Tourette syndrome in humans. Some reports showed that these behavioral abnormalities are caused by monoamine changes. However, there was little research on the relation between IDPN-induced behavioral abnormalities and free radical. 3-Methyl-1-phenyl-2-pyrazolin-5-one (MCI-186), a newly synthesized free radical scavenger, exerts beneficial free radical scavenging and antioxidant characteristics. We investigated that MCI-186 inhibited the process of hydroxyl radical formation induced by IDPN administration in the rat brain. In the group of IDPN administration, hydroxyl radical levels exhibited predominant increase in most parts of the rat brain. In the group of IDPN and MCI-186 administration, hydroxyl radical levels marked significant decrease compared with those in the group of IDPN administration. Therefore, MCI-186 inhibited production of hydroxyl radical and might prove to be effective against ECC syndrome induced by IDPN. PMID:15050436

  14. Radiosynoviorthesis of small and medium joints with Rhenium-186 sulfide and Erbium-169 citrate

    This paper presents our experience and results of treatment of medium and small joints in the patients with rheumatoid arthritis. The efficacy and adverse effects of radiosynoviorthesis (RSO) are presented. Before RSO, all patients were subjected to detailed clinical examinations to assess degree of pain, joint swelling and joint mobility. All patients were also subjected to Ultrasonography (US), Xray and three-phase bone scintigraphy as a routine prior to therapy. A total of fifty seven patients (age range = 8 to 89 years; average age = 47 years; Male : Female = 26: 31) with rheumatoid arthritis of medium joints were treated with Rhenium-186 Sulfide. All in all a total number of 76 medium sized joints including 14 shoulders, 7 elbows, 41 wrists and 14 ankles were treated. On the other hand a total of twenty nine patients (age range = 31 to 60 years; average age = 47 years; Male : Female = 23: 6) with rheumatoid arthritis of small joints were also treated using Erbium-169 citrate. A total of 80 small joints including 65 metacarpophalangeal (MCP) and 15 proximal interphalangeal (PIP) joints were treated. The radiosynoviorthesis procedures were carried out under US control. About 70-110 MBq Re-186 Sulfide was injected into the joints in case of medium sized joints; while about 20-40 MBq of Erbium-169 Citrate was used to treat smaller joints. Following administration of radiopharmaceuticals into the joints, the joints were immobilized for 2-3 days. Repeat clinical and US examinations were performed at 6 and 12 months following therapy. Excellent results were obtained with regard to pain relief, resolution of swelling and synovial reaction, as well as improvement in joint mobility. With regard to effect on shoulder joints, excellent results were obtained resulting in reduction in pain, swelling and synovial reaction in almost all joints (100%); while improved mobility was noted in 60% joints. In case of elbow joints also excellent results were obtained with regard to

  15. Neutron shielding verification measurements and simulations for a 235-MeV proton therapy center

    Newhauser, W D; Dexheimer, D; Yan, X; Nill, S

    2002-01-01

    The neutron shielding at the Massachusetts General Hospital's 235-MeV proton therapy facility was investigated with measurements, analytical calculations, and realistic three-dimensional Monte Carlo simulations. In 37 of 40 cases studied, the analytical calculations predicted higher neutron dose equivalent rates outside the shielding than the measured, typically by more than a factor of 10, and in some cases more than 100. Monte Carlo predictions of dose equivalent at three locations are, on average, 1.1 times the measured values. Except at one location, all of the analytical model predictions and Monte Carlo simulations overestimate neutron dose equivalent.

  16. Reaction mechanisms in 12C(γ,pp) near 200 MeV

    Inclusive 12C(γ,pp) cross sections have been measured with tagged photons in the range Eγ=187 endash 227 MeV using the Saskatchewan-Alberta Large Acceptance Detector (SALAD). The large angular acceptance allowed the measurement of noncoplanar pp emission. The cross sections were compared to a Monte Carlo intranuclear cascade calculation. Agreement was reasonable for the shapes of the cross sections but the calculated total cross section was 3.9 times larger than the data. copyright 1996 The American Physical Society

  17. Theoretical model application to the evaluation of fission neutron data up to 20 MeV incidence energy

    A complex statistical theory of fission neutron emission combined with a phenomenological fission model has been used to calculate fission neutron data for 238U. Obtained neutron multiplicities and energy spectra as well as average fragment energies for incidence energies from threshold to 20 MeV (including multiple-chance fission) are compared with traditional data representations. (author). 19 refs, 6 figs

  18. An evaluation of the neutron-induced reaction cross sections on carbon from 10 to 20 MeV

    Available data on the neutron-induced reactions on carbon are reviewed for the energy range from 10 to 20 MeV. Evaluated cross sections obtained at Bruyeres-le-Chatel are discussed. Comparisons with coupled-channel calculations are presented for the total, elastic and inelastic (to the 2+ level) cross sections of 12C

  19. Modification of EXIFON code and analysis of O16+n reactions in En=20-50 MeV

    Murata, Toru [Nippon Nuclear Fuel Development Co. Ltd., Oarai, Ibaraki (Japan)

    1997-03-01

    To evaluate the nuclear data concerning neutron induced reactions of O-16 and N-14 in the incident energy range of 20-50 MeV, the statistical multistep reaction code EXIFON was modified to include the outgoing channels of deuteron, triton and He-3. The calculated double differential cross sections (DDXs) with the modified code are compared with experimental DDXs. (author)

  20. Measurement of leakage neutron spectra from a spherical pile of zirconium irradiated with 14MeV neutrons and validation of its nuclear data

    In order to make a benchmark validation of the nuclear data for Zr, the leakage neutron spectrum from a Zr sphere of a 61-cm diameter was measured between 0.1 and 16MeV using a time-of-flight technique with a 14MeV neutron source facility, OKTAVIAN. The result was compared with the calculation using the Monte Carlo code MCNP-4A. To investigate the spectrum dependence on the individual neutron reactions, test calculations were carried out with the MCNP-4A code using the JENDL-3.2-based libraries, in which partial cross section values were reduced from the original values. From the comparison between the measured and the calculated spectra, it was found that each of the results could predict well the experiment in general. However, in detail, both ENDF/B-VI and EFF-2.4 gave considerable overestimation above 1 MeV. The JENDL-3.2 predicts the spectrum almost satisfactorily except below 0.8 MeV and around 10 MeV. The discrepancy found in JENDL-3.2 calculation is considered due to the cross section values of the (n, 2n) reaction and its secondary energy distributions (SED). The modified JENDL-3.2 library with the reduced (n, 2n) reaction values and the lower SED below 1 MeV reproduced the experiment with better agreement over the whole energy range. (author)

  1. Evidence for the J^p=1/2^+ narrow state at 1650 MeV in the photoproduction of KLambda

    Mart, T

    2011-01-01

    We have investigated the existence of the J^p=1/2^+ narrow resonance predicted by the chiral soliton model by utilizing the kaon photoproduction process gamma + p --> K^+ + Lambda. For this purpose we have constructed two phenomenological models based on our previous effective Lagrangian model, which are able to describe kaon photoproduction from threshold up to W = 1730 MeV. By varying the mass (width) of an inserted P_{11} resonance from 1620 to 1730 MeV (0.1 to 1 MeV and 1 to 10 MeV) a number of fits has been performed in order to search for the resonance mass. Our result indicates that the most promising candidate mass (width) of this resonance is 1650 MeV (5 MeV). Although our calculation does not exclude the possibility of narrow resonances with masses of 1680, 1700 and 1720 MeV, the mass of 1650 MeV is obtained for all phenomenological models used in this investigation. Variations of the resonance width and $K\\Lambda$ branching ratio are found to have a mild effect on the chi^2. The possibility that th...

  2. Fission cross section calculations for Pa isotopes

    Based on the recently measured cross-section values for the neutron-induced fission of 231Pa and our experience gained with other isotopes, new self consistent neutron cross section calculations for n+231Pa have been performed up to 30 MeV. The results are quite different to the existing evaluations, especially above the first chance fission threshold. (authors)

  3. High latitude climate forcing by 18.6-year lunar tidal fluctuations

    Upper layer ocean temperatures in the northern North Pacific increased by more than 2C in 10 years beginning in 1972. Proxy time series indicate that this is not a monotonic signal but rather a very low frequency fluctuation. The sea surface temperatures, which began in 1946, and the air temperature at Sitka since 1910, show fluctuations of 15-25 years. A least squares fit of the 18.6-year lunar declination signal to the 5-year block-averaged air temperature at Sitka can account for 44% of its variance. A modification of the mean ocean circulation by the change in lunar tides is suggested as the cause for this fluctuation. Similar sea surface temperature fluctuations have been observed for the northern North Atlantic Ocean from 1876 to 1965 but they appear to be out of phase with the North Pacific. The Atlantic fluctuations also have a small amplitude; 0.24C versus 0.52C for the North Pacific. Low frequency cycles are also evident in the air temperatures from the Hudson Bay region since 1700. The opposite phasing of the water and air temperatures of the North Atlantic and North Pacific is consistent with the tidal modulation of the mean ocean circulation. The most recent minimum for the Sitka air temperature should have occurred in September 1989

  4. The dual role of Apl in prophage induction of coliphage 186.

    Reed, M R; Shearwin, K E; Pell, L M; Egan, J B

    1997-02-01

    In the present study we show that the Apl protein of the temperate coliphage 186 combines, in one protein, the activities of the coliphage lambda proteins Cro and Xis. We have shown previously that Apl represses both the lysogenic promoter, pL, and the major lytic promoter, pR, and is required for excision of the prophage. Apl binds at two locations on the phage chromosome, i.e. between pR and pL and at the phage-attachment site. Using an in vivo recombination assay, we now show that the role of Apl in excision is in the process itself and is not simply a consequence of repression of pR or pL. To study the repressive role of Apl at the switch promoters we isolated Apl-resistant operator mutants and used them to demonstrate a requirement for Apl in the efficient derepression of the lysogenic promoter during prophage induction. We conclude that Apl is both an excisionase and transcriptional repressor. PMID:9157239

  5. Beryllium in the Ultra-Lithium-Deficient,Metal-Poor Halo Dwarf, G186-26

    Boesgaard, A M; Boesgaard, Ann Merchant; Novicki, Megan C.

    2005-01-01

    The vast majority of low-metal halo dwarfs show a similar amount of Li; this has been attributed to the Li that was produced in the Big Bang. However, there are nine known halo stars with T $>$ 5900 K and [Fe/H] $<$ $-$1.0 that are ultra-Li-deficient. We have looked for Be in the very low metallicity star, G 186-26 at [Fe/H] = $-$2.71, which is one of the ultra-Li-deficient stars. This star is also ultra-Be deficient. Relative to Be in the Li-normal stars at [Fe/H] = $-$2.7, G 182-26 is down in Be by more than 0.8 dex. Of two potential causes for the Li-deficiency -- mass-transfer in a pre-blue straggler or extra rotationally-induced mixing in a star that was initially a very rapid rotator -- the absence of Be favors the blue-straggler hypothesis, but the rotation model cannot be ruled-out completely.

  6. Edaravone (MCI-186), a free radical scavenger, attenuates retinal ischemia/reperfusion injury in rats

    Yi SONG; Yuan-yuan GONG; Zheng-gao XIE; Cai-hong LI; Qing GU; Xing-wei WU

    2008-01-01

    Aim: To investigate the effect of edaravone (MCI-186), a free radical scavenger, against ischemia/reperfusion (I/R) injury in the rat retina. Methods: Retinal is-chemia was induced in male Sprague-Dawley rats by elevating intraocular pres-sure to 110 mmHg for 60 min. The rats were intraperitoneally injected with edaravone at a dose of 3 mg/kg at 30 min before ischemia, and then treated with edaravone (3 mg/kg, ip) twice daffy for 1 or 5 d after I/R. The levels of malondialdehyde (MDA) and superoxide dismutase (SOD) in the retinal tissues were determined on d 1 after I/R injury. The apoptosis of retinal neurons was detected on d 1 after I/R injury by terminal deoxynucleotidyl transferase-mediated digoxigenin-dUTP nick-end labeling staining. The electroretinogram (ERG) was recorded on d 5 after reperfusion. Results: Edaravone lowered MDA levels, raised SOD activity, and attenuated I/R-induced apoptosis of retinal neurons within the inner nuclear, gan-glion cell, and outer nuclear layers of the rat retina. Moreover, edaravone sup-pressed I/R-induced reduction in a- and b-wave amplitudes of ERG. Conclusion: Edaravone can protect the retina from I/R injury in rats through reducing oxidative stress and inhibiting apoptosis of retinal neurons, which suggests that edaravone might be a potential choice for the treatment of I/R-induced eye disorders.

  7. Semiclassical distorted wave model analysis of inclusive (N, N'x) reactions for incident energies up to 400 MeV

    The semiclassical distorted wave (SCDW) model with the Wigner transform of a one-body density matrix is applied to analyses of multistep direct processes in (p, p'x) reactions on 12C, 90Zr, and 197Au at incident energies near 150 MeV, and 392 MeV (p, p'x) and 346 MeV (p, nx) reactions on 40Ca. The calculations show good agreement with experimental double-differential cross sections over a wide mass range of target nuclei, except at backward angles. (author)

  8. The non-statistical population of the 11.10 MeV 4+ state in 16O by 12C(6Li, d)

    When compound nucleus calculations are normalized to the 13.88 MeV 4+12C(6Li,d)16O cross section it is found that the population of the 11.10 MeV 4+ state is underpredicted by a factor of four. These results mean that the anomalous population of the 11.10 MeV 4+ state in 16O by the 12C(6Li,d) reaction is not compound nuclear in origin

  9. Elastic scattering of 56 MeV polarized deuterons on 4He

    The differential cross section and the vector and tensor analyzing powers Asub(y), Asub(xx), Asub(yy) and Asub(xz) were measured for the d-4He elastic scattering at 56 MeV. The measurement of Asub(xz) was performed using a deuteron beam polarized in the horizontal plane. An optical-model analysis of the experimental data was carried out. The magnitude of the tensor analyzing powers could not be reproduced without the tensor potential. By including the Tsub(R) type tensor potential, the optical-model calculations give a reasonable reproduction of the experimental data at THETAsub(c.m.) 0. The obtained Tsub(R) tensor potential was much stronger than that predicted by the folding model. The strength of the real Tsub(R) potential was roughly in accordance with that obtained from the optical-model analysis of d-4He elastic scattering at 20.2 MeV. (orig.)

  10. The effect of 14.7 MeV neutrons on MOS structures

    Six MOS transistors on a common chip were irradiated with 14.7 MeV neutrons; the accompanying gamma radiation contributed 4% to the neutron dose. The mean energy of these photons was about 1 MeV. The dependence of the threshold voltage shift on the dose equivalent was investigated for several gate bias voltages. The MOS transistors irradiated with neutrons to a total dose equivalent of 188.40 Sv were also annealed isochronously in steps of 20 degC. The annealing curves are shown and activation energies of traps calculated therefrom. It was also found that the fading curve of fast-neutron-irradiated MOS transistors differed from that of photon irradiated ones. (J.B.)

  11. U, Th and Bi fission induced by protons of 600 MeV

    The measurements of U, Bi an Th fission cross sections induced by protons of 600 MeV were carried out, using nuclear emulsion techniques. The targets were prepared from KO Ilford type emulsion using solutions of U, Bi and Th complexes for its loading. The proton beam of 586 +- 5 MeV and integrated flux of 1,6 (+- 4,890)X1011 protons from CERN Synchro-Cyclotron was used for irradiating nuclear emulsions. The integrated flux was carried from aluminium desintegration curves by Al22 (p, 3pn) Na24 reaction. The fission events, were observed using Leitz microscopy and the statistical error of 10% were calculated. (M.C.K.)

  12. Analysing powers and spin correlations in deuteron-proton charge exchange at 726 MeV

    Dymov, S; Bagdasarian, Z; Barsov, S; Carbonell, J; Chiladze, D; Engels, R; Gebel, R; Grigoryev, K; Hartmann, M; Kacharava, A; Khoukaz, A; Komarov, V; Kulessa, P; Kulikov, A; Kurbatov, V; Lomidze, N; Lorentz, B; Macharashvili, G; Mchedlishvili, D; Merzliakov, S; Mielke, M; Mikirtychyants, M; Mikirtychyants, S; Nioradze, M; Ohm, H; Prasuhn, D; Rathmann, F; Serdyuk, V; Seyfarth, H; Shmakova, V; Ströher, H; Tabidze, M; Trusov, S; Tsirkov, D; Uzikov, Yu; Valdau, Yu; Weidemann, C; Wilkin, C

    2015-01-01

    The charge exchange of vector polarised deuterons on a polarised hydrogen target has been studied in a high statistics experiment at the COSY-ANKE facility at a deuteron beam energy of Td = 726 MeV. By selecting two fast protons at low relative energy E_{pp}, the measured analysing powers and spin correlations are sensitive to interference terms between specific neutron-proton charge-exchange amplitudes at a neutron kinetic energy of Tn ~ 1/2 Td =363 MeV. An impulse approximation calculation, which takes into account corrections due to the angular distribution in the diproton, describes reasonably the dependence of the data on both E_{pp} and the momentum transfer. This lends broad support to the current neutron-proton partial-wave solution that was used in the estimation.

  13. MeV scale leptonic force for cosmic neutrino spectrum and muon anomalous magnetic moment

    Araki, Takeshi; Ota, Toshihiko; Sato, Joe; Shimomura, Takashi

    2015-01-01

    Characteristic patterns of cosmic neutrino spectrum reported by the IceCube collaboration and long-standing inconsistency between theory and experiment in muon anomalous magnetic moment are simultaneously explained by an extra leptonic force mediated by a gauge field with a mass of the MeV scale. With different assumptions for redshift distribution of cosmic neutrino sources, diffuse neutrino flux is calculated with the scattering between cosmic neutrino and cosmic neutrino background through the new leptonic force. Our analysis sheds light on a relation among lepton physics at the three different scales, PeV, MeV, and eV, and provides possible clues to the distribution of sources of cosmic neutrino and also to neutrino mass spectrum.

  14. ITER Port Interspace Pressure Calculations

    Carbajo, Juan J [ORNL; Van Hove, Walter A [ORNL

    2016-01-01

    The ITER Vacuum Vessel (VV) is equipped with 54 access ports. Each of these ports has an opening in the bioshield that communicates with a dedicated port cell. During Tokamak operation, the bioshield opening must be closed with a concrete plug to shield the radiation coming from the plasma. This port plug separates the port cell into a Port Interspace (between VV closure lid and Port Plug) on the inner side and the Port Cell on the outer side. This paper presents calculations of pressures and temperatures in the ITER (Ref. 1) Port Interspace after a double-ended guillotine break (DEGB) of a pipe of the Tokamak Cooling Water System (TCWS) with high temperature water. It is assumed that this DEGB occurs during the worst possible conditions, which are during water baking operation, with water at a temperature of 523 K (250 C) and at a pressure of 4.4 MPa. These conditions are more severe than during normal Tokamak operation, with the water at 398 K (125 C) and 2 MPa. Two computer codes are employed in these calculations: RELAP5-3D Version 4.2.1 (Ref. 2) to calculate the blowdown releases from the pipe break, and MELCOR, Version 1.8.6 (Ref. 3) to calculate the pressures and temperatures in the Port Interspace. A sensitivity study has been performed to optimize some flow areas.

  15. Reaction mechanisms of fast neutrons on stable Mo isotopes below 21 MeV

    A large number of new measurements with the activation technique were performed for (n,2n) and neutron-induced ΔZ=1,2 reaction cross sections on the stable molybdenum isotopes in the energy range from 13.5 to 21 MeV. First results were obtained for the 92Mo(n,2n)91Mom,92Mo(n,α)89Zrm,94Mo(n,2n)93Mom,95Mo(n,p)95Nbm,96Mo(n,p) 96Nb,96Mo(n,x)95Nbm, 97Mo(n,p)97Nb, 97Mo(n,p)97Nbm, 97Mo(n,x)96Nb, 98Mo(n,p)98Nbm, 98Mo(n,x)97Nb, 98Mo(n,x)97Nbm, and 100Mo(n,α)97Zr reactions, above 16 MeV. A significant number of high-accuracy 14 MeV measurements were performed which are in good agreement with the measurements above 16 MeV for reactions studied in both energy ranges. The rather complete database for the molybdenum isotopes was analyzed with two different sets of consistent model calculations: a local and a global approach. The global approach (a blind calculation with the TALYS code) provides a good overall description of the dominant reaction channels, although the (n,α) reactions for the heavy isotopes are overpredicted. The local approach (an adjusted calculation with the STAPRE-H code) describes the shapes and magnitudes of the excitation functions well from the reaction thresholds up to 21 MeV using a consistent parameter set, which was optimized based on all experimental information for the nuclei at hand and their immediate neighbors. The agreement between experimental and calculated data is, in general, good both at the maxima and at the tails of the excitation functions, and both for total activation cross sections of a particular channel and for cross sections leading to isomers, showing the viability of the level densities, the optical models, and the γ widths. Comparison of the two model calculations with the data indicates the relevance of an appropriate treatment for preequilibrium (PE) α-particle emission for the description of the data above 14 MeV. Comparison between the model calculations shows largely different PE deuteron emission contributions to the

  16. Absolute fission rate measurement of 238U induced by 14 MeV neutrons penetrated composite material

    In order to prove the model calculation method and parameter, the 238U absolute fission rate in the case of 14 MeV neutrons penetrating through the special composite material was measured by minitype slab uranium fission chambers. The measuring spots are distributed in the surface of iron ball hull along the different position of equator. The calculated results are compared with the experiment results. The total error of measured 238U absolute fission rate is 6.1%. (author)

  17. ZZ DLC-2D/100G, 100 Neutron-Group Cross-Section Library by SUPERTOG Calculation for ANISN, DOT

    1 - Nature of physical problem solved: Format: ANISN, DOT or DTF-4; Number of groups: 100; Nuclides: H, D, He, He-3, Li-6, Li-7, Be-9, B-10, B-11, C-12, N-14, O-16, Na-23, Mg, Al-27, Si, Cl, K, Ca, V, Cr, Mn-55, Fe, Co-59, Ni, Cu, Cu-63, Cu-65, Nb, Mo, Ag-107, Xe-135, Cs-133, Sm-149, Eu-151, Eu-153, Gd, Dy-164, Lu-175, Lu-176, Ta-181, Ta-182, W-182, W-183, W-184, W-186, Re-185, Re-187, Au-197, Pb, Th-232, Pa-233, U-234, U-235, U-238, Pu-238, Pu-239, Pu-240, Pu-241, Pu-242, Am-241, Am-243, and Cm-244. Origin: The nuclides in DLC-2 are those which have been released as category I ENDF/B by the National Neutron Cross Section Center, Brookhaven National Laboratory. Weighting spectrum: The explicit assumption was made that the flux has the shape of a fission spectrum joined at 0.0674 MeV by a 1/E tail. Neutron transport calculations can be performed with DLC-2 data. Since the data are intended for use in multigroup discrete-ordinates or Monte Carlo transport codes which treat anisotropic scattering, possible cross section angular expansion is limited only by the options available in the particular code used. Specifically, the retrieval program manipulates DLC-2 such that it conforms to input requirements of the ANISN, DOT, or DTF-4 codes, or any computer code using data in the ANISN or DTF-4 format. The nuclides in DLC-2 are those which have been released as category I ENDF/B by the National Neutron Cross Section Center, Brookhaven National Laboratory. The library contains data for H, D, He, 3-He, 6-Li, 7-Li, 9-Be, 10-B, 11-B, 12-C, 14-N, 16-O, 23-Na, Mg, 27-Al, Si, Cl, K, Ca, V, Cr, 55-Mn, Fe, 59-Co, Ni, Cu, 63-Cu, 65-Cu, Nb, Mo, 107-Ag, 135-Xe, 133-Cs, 149-Sm, 151-Eu, 153-Eu, Gd, 164-Dy, 175-Lu, 176-Lu, 181-Ta, 182-Ta, 182-W, 183-W, 184-W, 186-W, 185-Re, 187-Re, 197-Au, Pb, 232-Th, 233-Pa, 234-U, 235-U, 238-U, 238-Pu, 239-Pu, 240-Pu, 241-Pu, 242-Pu, 241-Am, 243-Am, and 244-Cm. 2 - Method of solution: DLC-2 was generated by SUPERTOG from nuclear data in either point

  18. Three-body calculation of Be double- hypernuclei

    Hossein Sadeghi; Hassan Khalili; Shahla Nahidinejad

    2014-09-01

    Energy levels and bond energy of the double- hypernucleus are calculated by considering two- and three-cluster interactions. Interactions between constituent particles are contact interactions for reproducing the low binding energy of nuclei. The effective action is constructed to involve three-body forces. In this paper, we also compare the obtained binding energy result with experimental and other cluster and shell models. The results of all schemes agree very well showing the high accuracy of our method to calculate the other many-body hyperonic nuclei using three-cluster interactions. The experimental values of $B_{}$(${}^{10}_{}$ Be) = (11.90 ± 0.13) MeV, $B_{}$(${}^{11}_{}$Be) = (20.49 ± 1.15) MeV and $B_{}$(${}^{12}_{}$Be) = (22.23 ± 1.15) MeV seem to be more compatible with our calculated value of $B_{}$(${}^{10}_{}$Be) = 14.04 MeV, $B_{}$(${}^{11}_{}$Be) = 19.31 MeV and $B_{}$(${}^{12}_{}$Be) = 21.45 MeV in comparison with the other calculated results by Hiyama et al, Gal et al and Guleria et al.

  19. A calender of high multiplicity 16O induced reactions in Ag(Br) at 200A MeV

    This calendar contains information about all charged particles in 50 high multiplicity 16O + 107Ag or 80Br events in nuclear emulsions between 200A MeV and 220A MeV. A stack of 26 Ilford G5 pellicles, each 10*10*0.06 cm3, has been exposed horizontally to the 250A MeV 16O beam from the Berkeley Bevalac with a flux of 5*104 ions/cm2. All charged particles with a range >= 5 μm are registered and indentified by conventional methods. Except for Z=1 particles, no mass determination could be performed experimentally and the adopted mass values are otherwise those of the most stable isotopes. The tables could be used to: Estimation of source velocity. Correlation studies of various kind - angles, phase space etc. Flow tensor calculations. (author) (50 tables, 50 figures)

  20. Application of pulsed neutron technique for integral neutron cross-section tests in the MeV range

    The spectra of neutrons scattered by several elements and compounds for an incident beam of 14 MeV neutrons have been studied by the time of flight method at Livermore in the so called 'Livermore Pulsed Sphere Program'. The measurements have been compared with results of Monte Carlo and neutron transport codes to provide checks on the input cross-sections. Similar measurements have been carried out at Oak ridge for incident neutron energies between 1 MeV to 20 MeV with a view to obtain information useful for neutron shielding calculations. The salient features of these measurements and proposals for an experimental program for obtaining data of interest are reviewed. (author)

  1. Neutron doses in an 8 MeV linear accelerator and an 18 MeV betatron

    Using uranium fission track dosimeters, dose distributions of neutrons produced by photonuclear reaction in the shielding material were measured near an 8 MeV linear accelerator and an 18 MeV betatron. Dose equivalents, as a function of bremsstrahlung doses in the central beam, are given for different points outside the irradiation field, in particular at the location of the patient. The neutron production was determined as a function of photon energy between 8 and 18 MeV and compared with literature values. (orig./HP)

  2. Experiments on n-p scattering with 260-Mev neutrons

    Kelley, E.; Segre, E.; Leith, C.; Wiegand, C.

    1950-03-06

    Neutrons produced by 350 Mev protons impinging on beryllium are scattered by hydrogen. The authors measure the differential scattering cross section as a function of the scattering angle. Results are summarized here.

  3. EXPERIMENTS ON N-P SCATTERING WITH 260 MEV NEUTRONS

    Kelly, E.; Leith, C.; Segre, E.; Wiegand, C.

    1950-03-06

    Neutrons produced by 350 Mev protons impinging on beryllium are scattered by hydrogen. We measure the differential scattering cross section as a function of the scattering angle. Results are summarized in Fig. 3 of the paper.

  4. Performances of large BGO crystals below 20 MeV

    This paper presents the performances of large tapered BGO crystals to low energy photons of 6 to 20 MeV. The read-out of the crystals was made with large area photodiodes associated to shaping amplifiers

  5. Estimating variation within the genes and inferring the phylogeny of 186 sequenced diverse Escherichia coli genomes

    Kaas Rolf S

    2012-10-01

    Full Text Available Abstract Background Escherichia coli exists in commensal and pathogenic forms. By measuring the variation of individual genes across more than a hundred sequenced genomes, gene variation can be studied in detail, including the number of mutations found for any given gene. This knowledge will be useful for creating better phylogenies, for determination of molecular clocks and for improved typing techniques. Results We find 3,051 gene clusters/families present in at least 95% of the genomes and 1,702 gene clusters present in 100% of the genomes. The former 'soft core' of about 3,000 gene families is perhaps more biologically relevant, especially considering that many of these genome sequences are draft quality. The E. coli pan-genome for this set of isolates contains 16,373 gene clusters. A core-gene tree, based on alignment and a pan-genome tree based on gene presence/absence, maps the relatedness of the 186 sequenced E. coli genomes. The core-gene tree displays high confidence and divides the E. coli strains into the observed MLST type clades and also separates defined phylotypes. Conclusion The results of comparing a large and diverse E. coli dataset support the theory that reliable and good resolution phylogenies can be inferred from the core-genome. The results further suggest that the resolution at the isolate level may, subsequently be improved by targeting more variable genes. The use of whole genome sequencing will make it possible to eliminate, or at least reduce, the need for several typing steps used in traditional epidemiology.

  6. Preliminary design of cooling system for decy 13 MeV cyclotron

    Preliminary design of cooling a system for DECY 13 MeV cyclotron has been done, which will be installed in building 05 of PTAPB BATAN. The design is based on a predetermined layout and installation of all equipment, those are the magnet system, RF-dee, ion source and vacuum system. The calculations include heat transfer in chiller, fluid properties, flow and pump head, those are calculated from the pressure drop on each equipment, major losses of elevation, as well as minor losses which consist of friction losses in pipe and head in the supporting components of the valve, knee, measuring instrument, reducer and T-branch. The calculation of heating load in the DECY 13 MeV cyclotron is based on the amount of electrical power that required in each sub-system. From the calculation it is known that for cooling the equipment so that all incoming and outgoing chiller temperature remain at 25 °C and 10 °C required a total cooling water discharge of 123 L/min. In the distribution it is used two pumps: pump 1, types of WL 40/4 with floe rate 50,6 L/min, head 103,43 m to serve the RF-dee, ion sources and vacuum system. (author)

  7. Production of 14 MeV neutrons by heavy ions

    Brugger, Robert M.; Miller, Lowell G.; Young, Robert C.

    1977-01-01

    This invention relates to a neutron generator and a method for the production of 14 MeV neutrons. Heavy ions are accelerated to impinge upon a target mixture of deuterium and tritium to produce recoil atoms of deuterium and tritium. These recoil atoms have a sufficient energy such that they interact with other atoms of tritium or deuterium in the target mixture to produce approximately 14 MeV neutrons.

  8. Diagnostics for the 400 MeV FNAL Linac

    The last four 201 MHz alvarez tanks of the twenty-year-old, 200 MeV Fermilab Linac are being replaced by seven high-gradient (7 KV/m), high-frequency (805 MHz) side-coupled-cavity structures to produce a 400 MeV beam for injection into the Booster. Good, reliable beam diagnostics are an important factor in the success of this project. This paper discusses the diagnostic systems

  9. Design aspects of a test stand for axial injection system of 20-100 MeV compact cyclotron

    To increase the injection intensity and efficiency, a test stand is designed for the axial injection system of 20-100 MeV compact cyclotron so as to implement the experimental study. The design aspects of test stand, including the optics of the beam line, the elements design etc., are described. Mostly the elements selection for the beam transportation from the Hsource to the central region of the cyclotron, the matching calculation and the elements design are considered. To investigate the injection system of 22 MeV and 70 MeV cyclotrons experimentally by the test stand, the design goal is to keep the layout of injection line, the dimensions of elements, the operation parameters as close as possible so that the setup of the stand is more easily. The designed system can meet the need of the H- beam injection for the cyclotron from 20 MeV to 100 MeV though the dimension of the solenoid, which is installed in the main magnet of the machine, should be changed due to the different size of the magnets

  10. Reconstruction of the KFTI N-100 storagering with increase of stored electron energy up to 160 MeV

    To increase the effectiveness of investigations into dynamics of injected and accumulated electron beams as well as to broaden the possibilities of applying synchrotron radiation in H-100 storage ring of KFTJ of the Ukranian Academy of Sciences, the energy of electrons has been increased from 100 MeV (according to the project) to 160 MeV. The analysis of experimental curves of magnetized quadrants and exact calculation of the magnetic circuit have shown that by way of increasing magnetic motive force of quadrants it is possible to increase the intensity of magnetic field to the level 1...1.1 Tl, which corresponds to the energy of circulating electrons 160... . 165 MeV. In the course of reconstruction the intensification of separate section of magnetic circuit of quadrants is made, the ajustment of the ring that of injection tract is performed, measurements of the main magnetic characteristic are made. The first control experiments on the accumulation of the beam of electrons with the energy of 70 MeV and the following adiabatic increase of energy up to 160 MeV have shown that losses of the circulating beam do not exceed 10%

  11. MEMS Calculator

    SRD 166 MEMS Calculator (Web, free access)   This MEMS Calculator determines the following thin film properties from data taken with an optical interferometer or comparable instrument: a) residual strain from fixed-fixed beams, b) strain gradient from cantilevers, c) step heights or thicknesses from step-height test structures, and d) in-plane lengths or deflections. Then, residual stress and stress gradient calculations can be made after an optical vibrometer or comparable instrument is used to obtain Young's modulus from resonating cantilevers or fixed-fixed beams. In addition, wafer bond strength is determined from micro-chevron test structures using a material test machine.

  12. Design of a formulation for the preparation of 99m Tc-(V)-Dmsa and 186 Re-(V)-Dmsa

    Among the radiopharmaceuticals used for neoplasia, we can find the dimercaptosuccinic acid (Dmsa) labelled with 99m Tc and 186/188 Re. Initially, the 99m Tc-(III)-Dmsa was employed as a renal image agent. Nevertheless, when it is prepared into a basic solution, the 99m Tc-(V)-Dmsa complex is produced in high yield being cumulated by cells with a great metabolic activity. This property makes it a useful radiopharmaceutical for the detection of medullary thyroid carcinoma (MTC), soft-tissue tumors and other head and neck tumors. On the other hand, the renewed interest in β - emitting radionuclides, suggests that the 186 Re-(V)-Dmsa complex could be used as antineoplastic agent in therapy. However, the techniques reported for the preparation of these compounds lack of stability studies and they are still in process of investigation, compromising to continue on the development of the radiopharmaceuticals by introducing new possibilities for better products already known, obtaining in this way, the approximation to the ideal radiopharmaceutical. The objective of this work is to design a freeze dried kit formulation for the instant preparation of 99m Tc-(V)-Dmsa and 186 Re-(V)-Dmsa complexes useful in the diagnostic and therapy of soft-tissue tumors and other head and neck tumors. We obtained a freeze dried stable formulation for the preparation of 99m Tc-(V)-Dmsa kit with a radiochemical purity higher than 90 %, which fulfills with the quality control of radiopharmaceuticals. Furthermore, we developed analytical techniques for the determination of the different chemical compounds into the lyophilized kit. On the other hand, we obtained the optimum conditions for preparation of 186 Re-(V)-Dmsa complex in high radiochemical yields (>90%). (Author)

  13. Calculating Variations in Biological Effectiveness for a 62 MeV Proton Beam.

    Carante, Mario Pietro; Ballarini, Francesca

    2016-01-01

    A biophysical model of radiation-induced cell death and chromosome aberrations [called BIophysical ANalysis of Cell death and chromosome Aberrations (BIANCA)] was further developed and applied to therapeutic protons. The model assumes a pivotal role of DNA cluster damage, which can lead to clonogenic cell death following three main steps: (i) a DNA "cluster lesion" (CL) produces two independent chromosome fragments; (ii) fragment mis-rejoining within a threshold distance d gives rise to chromosome aberrations; (iii) certain aberration types (dicentrics, rings, and large deletions) lead to clonogenic inactivation. The yield of CLs and the probability, f, that a chromosome fragment remains un-rejoined even if other fragment(s) are present within d, were adjustable parameters. The model, implemented as a MC code providing simulated dose-responses directly comparable with experimental data, was applied to pristine and modulated Bragg peaks of the proton beam used to treat eye melanoma at INFN-LNS in Catania, Italy. Experimental survival curves for AG01522 cells exposed to the Catania beam were reproduced, supporting the model assumptions. Furthermore, cell death and chromosome aberrations at different depths along a spread-out Bragg peak (SOBP) dose profile were predicted. Both endpoints showed an increase along the plateau, and high levels of damage were found also beyond the distal dose fall-off, due to low-energy protons. Cell death and chromosome aberrations were also predicted for V79 cells, in the same irradiation scenario as that used for AG01522 cells. In line with other studies, this work indicated that assuming a constant relative biological effectiveness (RBE) along a proton SOBP may be sub-optimal. Furthermore, it provided qualitative and quantitative evaluations of the dependence of the beam effectiveness on the considered endpoint and dose. More generally, this work represents an example of therapeutic beam characterization avoiding the use of experimental RBE values, which can be source of uncertainties. PMID:27092294

  14. Calculating variations in biological effectiveness for a 62 MeV proton beam

    Mario Pietro Carante

    2016-04-01

    Full Text Available A biophysical model of radiation-induced cell death and chromosome aberrations (called BIANCA, BIophysical ANalysis of Cell death and chromosome Aberrations was further developed and applied to therapeutic protons. The model assumes a pivotal role of DNA cluster damage, which can lead to clonogenic cell death following three main steps: i a DNA Cluster Lesion (CL produces two independent chromosome fragments; ii fragment mis-rejoining within a threshold distance d gives rise to chromosome aberrations; iii certain aberration types (dicentrics, rings and large deletions lead to clonogenic inactivation. The yield of CLs and the probability, f, that a chromosome fragment remains un-rejoined even if other fragment(s are present within d, were adjustable parameters. The model, implemented as a MC code providing simulated dose-responses directly comparable with experimental data, was applied to pristine and modulated Bragg peaks of the proton beam used to treat eye melanoma at INFN-LNS in Catania, Italy. Experimental survival curves for AG01522 cells exposed to the Catania beam were reproduced, supporting the model assumptions. Furthermore, cell death and chromosome aberrations at different depths along a SOBP (Spread-Out Bragg Peak dose profile were predicted. Both endpoints showed an increase along the plateau, and high levels of damage were found also beyond the distal dose fall-off, due to low-energy protons. Cell death and chromosome aberrations were also predicted for V79 cells, in the same irradiation scenario as that used for AG01522 cells. In line with other studies, this work indicated that assuming a constant RBE along a proton SOBP may be sub-optimal. Furthermore, it provided qualitative and quantitative evaluations of the dependence of the beam effectiveness on the considered endpoint and dose. More generally, this work represents an example of therapeutic beam characterization avoiding the use of experimental RBE values, which can be source of uncertainties.

  15. Theoretical Calculations and Analysis for n+59Co Reaction up to 20 MeV

    2008-01-01

    <正>All cross-sections of neutron-induced reactions, angular distributions, double differential cross sections, and energy spectra for neutron, proton, deuteron, triton, helium and alpha-particle emissions are

  16. Calculating Variations in Biological Effectiveness for a 62 MeV Proton Beam

    Carante, Mario Pietro; Ballarini, Francesca

    2016-01-01

    A biophysical model of radiation-induced cell death and chromosome aberrations [called BIophysical ANalysis of Cell death and chromosome Aberrations (BIANCA)] was further developed and applied to therapeutic protons. The model assumes a pivotal role of DNA cluster damage, which can lead to clonogenic cell death following three main steps: (i) a DNA “cluster lesion” (CL) produces two independent chromosome fragments; (ii) fragment mis-rejoining within a threshold distance d gives rise to chromosome aberrations; (iii) certain aberration types (dicentrics, rings, and large deletions) lead to clonogenic inactivation. The yield of CLs and the probability, f, that a chromosome fragment remains un-rejoined even if other fragment(s) are present within d, were adjustable parameters. The model, implemented as a MC code providing simulated dose–responses directly comparable with experimental data, was applied to pristine and modulated Bragg peaks of the proton beam used to treat eye melanoma at INFN-LNS in Catania, Italy. Experimental survival curves for AG01522 cells exposed to the Catania beam were reproduced, supporting the model assumptions. Furthermore, cell death and chromosome aberrations at different depths along a spread-out Bragg peak (SOBP) dose profile were predicted. Both endpoints showed an increase along the plateau, and high levels of damage were found also beyond the distal dose fall-off, due to low-energy protons. Cell death and chromosome aberrations were also predicted for V79 cells, in the same irradiation scenario as that used for AG01522 cells. In line with other studies, this work indicated that assuming a constant relative biological effectiveness (RBE) along a proton SOBP may be sub-optimal. Furthermore, it provided qualitative and quantitative evaluations of the dependence of the beam effectiveness on the considered endpoint and dose. More generally, this work represents an example of therapeutic beam characterization avoiding the use of experimental RBE values, which can be source of uncertainties. PMID:27092294

  17. Evaluation of antimicrobial activity of the endophytic actinomycete R18(6) against multiresistant Gram-negative bacteria.

    Carvalho, Tiele; Van Der Sand, Sueli

    2016-03-01

    Endophytic actinomycetes are promising sources of antimicrobial substances. This study evaluates the activity of metabolites produced by the endophytic actinomycete R18(6) against Gram-negative bacteria multiresistant to antimicrobials. R18(6) isolate was grown in submerged cultures under different conditions: carbon source, temperature, pH and incubation time to optimize antimicrobials production. The actinomycete grown in base medium supplemented with 1% glucose, pH 6.5 and incubation at 30 ºC for 96 h with shaking at 100 rpm, exhibited the highest activity against the used Gram-negative bacteria. Minimum inhibitory concentration (MIC) of the crude extract produced by the microorganism varied between 1/32 and 1/256. It had bactericide or bacteriostatic activity, depending on the Gram-negative organism. The active extract was stable at high temperatures, and unstable in medium containing proteolytic enzymes. Micromorphology of R18(6) was investigated by optical and scan microscopy, revealing that it was morphologically similar to the genusStreptomyces. PMID:26871499

  18. Evolution of a Powerful Radio Loud Quasar 3C186 and its Impact on the Cluster Environment at z=1

    Siemiginowska, Aneta; Burke, Doug; Bechtold, Jill; Cheung, C C; LaMassa, Stephanie; Worrall, Diana M

    2007-01-01

    X-ray cluster emission has been observed mainly in clusters with "inactive" cD galaxies (L_bol ~1E40-1E43erg/sec), which do not show signs of accretion onto a SMBH. Our recent Chandra discovery of ~100kpc scale diffuse X-ray emission revealed the presence of an X-ray cluster associated with the radio loud quasar 3C186 at redshift z=1.1 and suggests interactions between the quasar and the cluster. In contrast to the majority of X-ray clusters the 3C186 cluster contains a quasar in the center whose radiative power alone exceeds that which would be needed to quench the cluster cooling. We present the Chandra X-ray data and new deep radio and optical images of this cluster. The 3C186 quasar is a powerful Compact Steep Spectrum radio source expanding into the cluster medium. The 2arcsec radio jet is unresolved in the Chandra observation, but its direction is orthogonal to the elliptical surface brightness of the cluster. The radio data show the possible presence of old radio lobes on 10 arcsec scale in the directi...

  19. A new empirical formula for 14-15 MeV neutron induced (N,P) reaction cross-section

    In this study we have introduced a new empirical formula by modifying the Levkovskiis formula with the new coefficients for the calculation of (n,p) reaction cross-sections at 14-15 MeV neutron incident energy. The cross sections have been calculated using asymmetry parameter depended on empirical formulas for the incoming energies 14-15 MeV neutron. Levkovskiis formulas have been determined by least-squares method that fit to the experimental cross sections. The measured experimental cross-sections values of the (n, p) reactions are taken from literature. The resulting modified formulas yielded cross sections, representing smaller χ2 deviations from experimental values, and values much closer to unity as compared with the calculation using Levskovskiis original formulas. The results obtained have been discussed and compared with the existing formulas, and found to be well in agreement, when used to correlate the available experimental σ(n,p) data of different nuclei

  20. Development of pharmaceuticals with radioactive rhenium for cancer therapy. Production of {sup 186}Re and {sup 188}Re, synthesis of labeled compounds and their biodistributions

    NONE

    1998-03-01

    Production of the radioactive rhenium isotopes {sup 186}Re and {sup 188}Re, and synthesis of their labeled compounds have been studied together with the biodistributions of the compounds. This work was carried out by the Working Group on Radioactive Rhenium, consisting of researchers of JAERI and some universities, in the Subcommittee for Production and Radiolabeling under the Consultative Committee of Research on Radioisotopes. For {sup 186}Re, production methods by the {sup 185}Re(n,{gamma}){sup 186}Re reaction in a reactor and by the {sup 186}W(p,n){sup 186}Re reaction with an accelerator, which can produce nocarrier-added {sup 186}Re, have been established. For {sup 188}Re, a production method by the double neutron capture reaction of {sup 186}W, which produces a {sup 188}W/{sup 188}Re generator, has been established. For labeling of bisphosphonate, DMSA, DTPA, DADS, aminomethylenephosphonate and some monoclonal antibodies with the radioactive rhenium isotopes, the optimum conditions, including pH, the amounts of reagents and so on, have been determined for each compound. The biodistributions of each of the labeled compounds in mice have been also obtained. (author)

  1. Prediction of the correct measured activity of {sup 186}Re and {sup 188}Re from reactor produced natural rhenium using an artificial neural network

    Leila Moghaddam, B., E-mail: lmoghaddam@aut.ac.i [Faculty of Nuclear Engineering and Physics, Amirkabir Technical University (Tehran Polytechnic), Hafez Street, Tehran (Iran, Islamic Republic of); Setayeshi, Saeed; Maragheh, Mohammad G.; Gholipour, Reza [Faculty of Nuclear Engineering and Physics, Amirkabir Technical University (Tehran Polytechnic), Hafez Street, Tehran (Iran, Islamic Republic of)

    2009-11-15

    To optimize the cost effectiveness of {sup 186}Re and {sup 188}Re production, which have recently been used as radio pharmaceuticals for therapeutic purposes, we designed an artificial neural network (ANN) to evaluate the activity of combined {sup 186}Re + {sup 188}Re. One of the production ways is the (n,gamma) reaction of natural rhenium which leads to combined {sup 186}Re + {sup 188}Re. Using the counted activity of {sup 186}Re + {sup 188}Re mixtures by a well type isotope calibrator, the precise activity of {sup 186}Re and {sup 188}Re is obtained by the ANN. A back-propagation ANN was trained using 30 activities of mixed {sup 186}Re + {sup 188}Re. The performance of the ANN was tested by Early-Stopping validation method, and the ANN was optimized with respect to its architecture. The response of the ANN shows significant precision that may be used for medical application of {sup 186}Re + {sup 188}Re mixtures.

  2. Evaluation of induced radioactivity in 10 MeV electron-irradiated spices

    In order to make clear appreciation to induced radioactivity in the irradiated foods, photonuclear reactions which could produce radioactivity at energies up to 10 MeV were listed up from elemental compositions of black pepper, white pepper, red pepper, ginger and turmeric. The samples were irradiated with 10 MeV electron from a linear accelerator to a dose of 100 kGy and radioactivity was measured. Induced radioactivity could not be detected significantly by gamma-ray spectrometry and beta-ray counting in the irradiated samples except for spiked samples which contain some photonuclear target nuclides in the list. From the amount of observed radioactivities of short-lived photonuclear products in the spiked samples and calculation of H50 according to ICRP Publication 30, it was concluded that the induced radioactivity and its biological effects in the 10 MeV electron-irradiated natural samples were negligible in comparison with natural radioactivity from 40K contained in the samples. (J.P.N.)

  3. Evaluation of induced radioactivity in 10 MeV electron-irradiated spices

    Furuta, Masakazu; Ito, Norio; Mizohata, Akira; Matsunami, Tadao; Katayama, Tadashi; Toratani, Hirokazu (Osaka Prefectural Univ., Sakai (Japan). Research Inst. for Advanced Science and Technology); Takeda, Atsuhiko

    1993-10-01

    In order to make clear appreciation to induced radioactivity in the irradiated foods, photonuclear reactions which could produce radioactivity at energies up to 10 MeV were listed up from elemental compositions of black pepper, white pepper, red pepper, ginger and turmeric. The samples were irradiated with 10 MeV electron from a linear accelerator to a dose of 100 kGy and radioactivity was measured. Induced radioactivity could not be detected significantly by gamma-ray spectrometry and beta-ray counting in the irradiated samples except for spiked samples which contain some photonuclear target nuclides in the list. From the amount of observed radioactivities of short-lived photonuclear products in the spiked samples and calculation of H[sub 50] according to ICRP Publication 30, it was concluded that the induced radioactivity and its biological effects in the 10 MeV electron-irradiated natural samples were negligible in comparison with natural radioactivity from [sup 40]K contained in the samples. (J.P.N.).

  4. Online calibration of neutrino liquid scintillator detectors above 10 MeV

    Chepurnov, A. S.; Gromov, M. B.; Shamarin, A. F.

    2016-02-01

    Online calibration of neutrino liquid scintillator detector at energies above 10 MeV is very important for study of such rare process as supernova and for correct calculation of backgrounds if spectral properties is the focus of researches. The traditional procedure implies the usage of radioactive sources with well-known spectral properties but such approach is limited by available radioactive sources, upper possible energies (∼10-11 MeV) and dangerous for ultra low background environment of modern detectors. The approach we propose is based on simulation of events with controllable UV double LED pulser. The LED's main wavelength fits the scintillator excitation wavelength. This technique allows to simulate physical events within the detector in very wide energy range from a few hundred keV to about 50 MeV. Additional studies like pile-up analysis can be performed due to double-LEDs scheme which generates two delayed signals with different adjustable amplitudes. The delay time is also adjustable parameter.

  5. Durable pharmacological responses from the peptide ShK-186, a specific Kv1.3 channel inhibitor that suppresses T cell mediators of autoimmune disease.

    Tarcha, Eric J; Chi, Victor; Muñoz-Elías, Ernesto J; Bailey, David; Londono, Luz M; Upadhyay, Sanjeev K; Norton, Kayla; Banks, Amy; Tjong, Indra; Nguyen, Hai; Hu, Xueyou; Ruppert, Greg W; Boley, Scott E; Slauter, Richard; Sams, James; Knapp, Brian; Kentala, Dustin; Hansen, Zachary; Pennington, Michael W; Beeton, Christine; Chandy, K George; Iadonato, Shawn P

    2012-09-01

    The Kv1.3 channel is a recognized target for pharmaceutical development to treat autoimmune diseases and organ rejection. ShK-186, a specific peptide inhibitor of Kv1.3, has shown promise in animal models of multiple sclerosis and rheumatoid arthritis. Here, we describe the pharmacokinetic-pharmacodynamic relationship for ShK-186 in rats and monkeys. The pharmacokinetic profile of ShK-186 was evaluated with a validated high-performance liquid chromatography-tandem mass spectrometry method to measure the peptide's concentration in plasma. These results were compared with single-photon emission computed tomography/computed tomography data collected with an ¹¹¹In-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-conjugate of ShK-186 to assess whole-blood pharmacokinetic parameters as well as the peptide's absorption, distribution, and excretion. Analysis of these data support a model wherein ShK-186 is absorbed slowly from the injection site, resulting in blood concentrations above the Kv1.3 channel-blocking IC₅₀ value for up to 7 days in monkeys. Pharmacodynamic studies on human peripheral blood mononuclear cells showed that brief exposure to ShK-186 resulted in sustained suppression of cytokine responses and may contribute to prolonged drug effects. In delayed-type hypersensitivity, chronic relapsing-remitting experimental autoimmune encephalomyelitis, and pristane-induced arthritis rat models, a single dose of ShK-186 every 2 to 5 days was as effective as daily administration. ShK-186's slow distribution from the injection site and its long residence time on the Kv1.3 channel contribute to the prolonged therapeutic effect of ShK-186 in animal models of autoimmune disease. PMID:22637724

  6. Response of electret dosemeters to eletrons with energies of 3 MeV, 7 MeV, 11 MeV

    The response of the electret dosemeter to electrons of 3,7 and 11 MeV from an accelerator Mevatron 12 is studied. Two external coatings (polyethylene or nylon) are used and a comparative evaluation is presented. (M.A.C.)

  7. Some radiation protection problems connected with the use of 186Re-HEDP and 153Sm-EDTMP for palliative therapy of of bone metastases

    The aim of this paper was to assess whether the ambulatory (outpatient) therapy with 186Re-HEDP and 153Sm-EDTMP is possible in the Czech Republic. Physical characteristics, administered activity, biokinetics of radiopharmaceuticals, radiation protection characteristics, irradiation of patients relatives as well as comparison with limits for rhenium-186 and samarium-153 radiopharmaceuticals are given. The outpatient administration of 186Re-HEDP and 153Sm-EDTMP with the subsequent keeping the patient for 6 hours in a department of nuclear medicine appears to be in compliance with regulations proposed in the Czech Republic as well as ICRP Recommendations. (J.K.) 1 tab., 12 refs

  8. The specific features of Guillain–Barré syndrome in Russia: Analysis of 186 cases

    N. A. Suponeva

    2014-01-01

    Full Text Available The medical records of 186 patients diagnosed with Guillain-Barré syndrome (GBS who had been followed up at the Research Center of Neurology, Russian Academy of Medical Sciences, in 2000 to 2011 were retrospectively analyzed. Most (65 % of the patients had severe GBS; 19 % of the patients were on mechanical ventilation (MV for an average of 21 (13; 48 days. The forms of GBS, such as acute inflammatory demyelinating polyneuropathy (AIDP (n = 141; 78 %, and axonal variants, such as acute motor axonal neuropathy (AMAN, acute sensorimotor axonal neuropathy (AMSAN, i. e. AMAN / AMSAN (n = 39; 22 %, were studied separately. There was a significant difference in the seasonal revalence (p < 0.05. AIDP was encountered evenly throughout the year; AMAN / AMSAN occurred in 46 % of cases in summer. AIDP was followed by acute respiratory viral infection in 35 % of cases; diarrhea wasby the axonal forms in 36 % (p < 0.05. The axonal forms ran a severer course than AIDP: MV was performed twice more frequently (33 and 15 %, respectively; its duration was 6‑fold longer: 90 (46; 102 and 15 (10; 21 days (p < 0.05. AMAN / AMSAN was characterized by a severer neurological status and disability in the acute period, as shown by the NIS, MRCss, INCAT, R-ODS, and Barthel scales; these patients showed a poorer response to pathogenetic therapy (p < 0.05: 59 % with an insufficient effect; 15 % of those with AIDP. After six years, the majority (84 % of the patients with AIDP walked alone and only 16 % were assisted. In the same period, less than half of the patients (40 % with AMAN / AMSAN walked alone and a third (29 % could move with assistance and almost the same percentage (31 % could not walk.Thus, a number of specific features of GBS were found in a Russian population (equal age and sex distribution; a larger percentage of the axonal forms than in European countries and the United States; however, the most characteristics did not differ from the global

  9. Measurement of neutron captured cross-sections in 1-2 MeV

    Kim, Gi Dong; Kim, Young Sek; Kim, Jun Kon; Yang, Tae Keun [Korea Institutes of Geoscience and Mineral Resources, Taejeon (Korea)

    2001-04-01

    The measurement of neutron captured reaction cross sections was performed to build the infra system for the production of nuclear data. MeV neutrons were produced with TiT target and {sup 3}T(p,n){sup 3}He reaction. The characteristics of TiT thin film was analyzed with ERD-TOF and RBS. The results was published at Journal of the Korea Physical Society (SCI registration). The energy, the energy spread and the flux of the produced neutron were measured. The neutron excitation functions of {sup 12}C and {sup 16}O were obtained to confirm the neutron energy and neutron energy spread. The neutron energy spread found to be 1.3 % at the neutron energy of 2.077 MeV. The {sup 197}Au(n,{gamma}) reaction was performed to obtain the nerutron flux. The maximum neutron flux found to be 1 x 10{sup 8} neutrons/sec at the neutron energy of 2 MeV. The absolute efficiency of liquid scintillation detector was obtained in the neutron energy of 1 - 2 MeV. The fast neutron total reaction cross sections of Cu, Fe, and Au were measured with sample in-out method. Also the neutron captured reaction cross sections of {sup 63}Cu were measured with fast neutron activation method. The measurement of neutron total reaction cross sections and the neutron captured reaction cross sections with fast neutrons were first tried in Korea. The beam pulsing system was investigated and the code of calculating the deposition spectrums for primary gamma rays was made to have little errors at nuclear data. 25 refs., 28 figs., 14 tabs. (Author)

  10. Li2Sr4B12O23: A new alkali and alkaline-earth metal mixed borate with [B10O18]6− network and isolated [B2O5]4− unit

    A novel ternary lithium strontium borate Li2Sr4B12O23 crystal with size up to 20 mm×10 mm×4 mm has been grown via the top-seeded solution growth method below 730 °C. Single-crystal XRD analyses showed that Li2Sr4B12O23 crystallizes in the monoclinic space group P21/c with a=6.4664(4) Å, b=8.4878(4) Å, c=15.3337(8) Å, β=102.02(3)°, Z=2. The crystal structure is composed of [B10O18]6− network and isolated [B2O5]4− unit. The IR spectrum further confirmed the presence of both BO3 and BO4 groups. TG-DSC and Transmission spectrum were reported. Band structures and density of states were calculated. - Graphical abstract: A new phase, Li2Sr4B12O23, has been discovered in the ternary M2O–M′O–B2O3 (M=alkali-metal, M′=alkalineearth metal) system. The crystal structure consists of [B10O18]6− network and isolated [B2O5]4− unit. Highlights: ► Li2Sr4B12O23 is a a novel borate discovered in the M2O–M′O–B2O3 (M=alkali-metal, M′=alkaline-earth metal) system. ► Li2Sr4B12O23 crystal structure has a three-dimensional crystal structure with [B10O18]6− network and isolated [B2O5]4− unit. ► Sr1 and Sr2 are located in two different channels constructed by 3∞[B10O18] network.

  11. Evaluation of d + 6,7Li data for deuteron incident energies up to 50 MeV

    A new evaluation of the nuclear data for a particle transport calculations was performed for d + 6,7Li interactions in the energy region from 4 to 50 MeV incident energy. Use was made of the available new optical model potential for d + Li interactions. For the description of a neutron emission a new optical model potential for n + 9Be was elaborated for the neutron energies from 0.1 to 22 MeV. Global optical model potentials were used for the neutrons above 22 MeV and for protons, tritons, He-3 and alphas - in the whole energy range. The following nuclear processes were accounted for: particle evaporation and preequilibrium emission, stripping of the proton from the deuteron and direct interactions of deuterons with lithium nuclei. GNASH and ECIS96 codes were applied for the first two process descriptions, the Serber model was utilised for stripping processes and the DWUCK4 code was used for direct reaction processes modelling. Total neutron emission spectra were calculated as a sum of the spectra in all these processes. A complete transport file was finally prepared in ENDF-6 format covering the deuteron incident energies up to 50 MeV. The newly evaluated data are in good agreement with experimental data for neutron emission spectra. The evaluated data files were successfully tested with a modified version of the MCNP computer code

  12. The electrosphere of macroscopc ""nuclei"": diffuse emissions in the MeV band from dark antimatter

    Forbes, Michael Mcneil [Los Alamos National Laboratory; Lawson, Kyle [CANADA; Zhitnitsky, Ariel R [CANADA

    2009-01-01

    Using a Thomas-Fermi model, we calculate the structure of the electrosphere of the quark antimatter nuggets postulated to comprise much of the dark matter. This provides a single self-consistent density profile from ultra-rel ativistic densities to the non-relativistic Boltzmann regime. We use this to present a microscopically justified calculation of several properties of the nuggets, including their net charge, and the ratio of MeV to 511 keV emissions from electron annihilation. We find that the calculated parameters agree with previous phenomenological estimates based on the observational supposition that the nuggets are a source of several unexplained diffuse emissions from the galaxy. This provides another nontrivial verification of the dark matter proposal. The structure of the electrosphere is quite general and will also be valid at the surface of strange-quark stars, should they exist.

  13. Polarized proton scattering on lithium isotopes at 14 MeV

    Differential cross sections, analyzing powers, and double differential cross sections for the 6,7Li(p,p') scattering have been measured at an incident energy of 14 MeV. Experimental procedures and results are briefly described. The experimental data of the elastic scattering have excellently been reproduced by calculations based on the spherical optical model (SOM) and the coupled channel (CC) method. The DWBA and CC calculations have not correctly predicted the analyzing powers in the inelastic channels leading to the 1st and 2nd excited states of 6,7Li. The three-body breakup process observed in the (p,p') continuum spectra has been qualitatively explained by DWBA calculations with the discretized-continuum states. The experimental and theoretical results are compared with neutron scattering data. Studies on proton scattering are valuable for modelling of nuclear reactions and for evaluation of neutron scatterings. (author)

  14. Theoretical fission times for U and Pb nuclei excited up to 250 MeV

    Full text: Recent experiments in GANIL (France) revealed that the average fission times ff> of uranium-like nuclei excited up to 250 MeV are much longer than the time scales usually inferred from either neutron or γ-ray pre-scission multiplicities (pre> and pre> respectively). In order to solve this puzzle, calculations have been done by means of the computer code CDSM2. The code simulates the fission process dynamically in the space of two collective degrees of freedom corresponding to the elongation- and mass-asymmetry modes. Light particle emission from the excited nuclei is considered statistically. Calculations performed with reduced value of the one-body dissipation are in agreement with measured f> of uranium isotopes, as well as with pre> and pre> from the 16O+208Pb fusion-fission reaction. This is encouraging us to make some predictions about the excitation energy dependence of f> and pre> for the isotopes of lead excited up to 250 MeV. In contrast to the uranium case, for these nuclei the calculated f> of the fission events accompanied by light charged particle emission are found to be shorter than the times of the events where only neutrons are emitted prior to scission

  15. Measurement of leakage neutron spectra from a spherical pile of zirconium irradiated with 14MeV neutrons and validation of its nuclear data

    Ichihara, C; Hayashi, S A; Yamamoto, J; Takahashi, A

    2003-01-01

    In order to make a benchmark validation of the nuclear data for Zr, the leakage neutron spectrum from a Zr sphere of a 61-cm diameter was measured between 0.1 and 16MeV using a time-of-flight technique with a 14MeV neutron source facility, OKTAVIAN. The result was compared with the calculation using the Monte Carlo code MCNP-4A. To investigate the spectrum dependence on the individual neutron reactions, test calculations were carried out with the MCNP-4A code using the JENDL-3.2-based libraries, in which partial cross section values were reduced from the original values. From the comparison between the measured and the calculated spectra, it was found that each of the results could predict well the experiment in general. However, in detail, both ENDF/B-VI and EFF-2.4 gave considerable overestimation above 1 MeV. The JENDL-3.2 predicts the spectrum almost satisfactorily except below 0.8 MeV and around 10 MeV. The discrepancy found in JENDL-3.2 calculation is considered due to the cross section values of the (n...

  16. Complete set of polarization transfer observables for the ${}^{16}{\\rm O}(\\vec{p},\\vec{n}){}^{16}{\\rm F}$ reaction at 296 MeV and 0 degrees

    Wakasa, T; Takaki, M; Dozono, M; Hatanaka, K; Ichimura, M; Noro, T; Okamura, H

    2011-01-01

    We report measurements of the cross section and a complete set of polarization transfer observables for the ${}^{16}{\\rm O}(\\vec{p},\\vec{n}){}^{16}{\\rm F}$ reaction at a bombarding energy of $T_p$ = 296 MeV and a reaction angle of $\\theta_{\\rm lab}$ = $0^{\\circ}$. The data are compared with distorted-wave impulse approximation calculations employing the large configuration-space shell-model (SM) wave functions. The well-known Gamow-Teller and spin-dipole (SD) states at excitation energies of $E_x$ $\\lesssim$ 8 MeV have been reasonably reproduced by the calculations except for the spin--parity $J^{\\pi}$ = $2^-$ state at $E_x$ = 5.86 MeV. The SD resonance at $E_x$ $\\simeq$ 9.5 MeV appears to have more $J^{\\pi}$ = $2^-$ strength than $J^{\\pi}$ = $1^-$ strength, consistent with the calculations. The data show significant strength in the spin-longitudinal polarized cross section $ID_L(0^{\\circ})$ at $E_x$ $\\simeq$ 15 MeV, which indicates existence of the $J^{\\pi}$ = $0^-$ SD resonance as predicted in the SM calcul...

  17. The cosmic MeV neutrino background as a laboratory for black hole formation

    Hasan Yüksel

    2015-12-01

    Full Text Available Calculations of the cosmic rate of core collapses, and the associated neutrino flux, commonly assume that a fixed fraction of massive stars collapse to black holes. We argue that recent results suggest that this fraction instead increases with redshift. With relatively more stars vanishing as “unnovae” in the distant universe, the detectability of the cosmic MeV neutrino background is improved due to their hotter neutrino spectrum, and expectations for supernova surveys are reduced. We conclude that neutrino detectors, after the flux from normal SNe is isolated via either improved modeling or the next Galactic SN, can probe the conditions and history of black hole formation.

  18. Study of the reaction α+Pb at 600 MeV

    The α + Pb experiment at 600 MeV was realised at the Laboratoire National Saturne to search the Mach cone - Shock wave phenomenon in the nuclear matter. The light particles p, d, t, 3He and 4He were detected by surface barrier detectors. Inclusive measurements and angular correlations between two particles were realised. The inclusive spectras were analysed by the evaporation model. The contribution of the evaporative processes in the experimental angular distribution has been calculated by a Monte-Carlo simulation. The residual angular distribution manifests a peak around 450, in agreement with theoretical predictions

  19. Production of gamma rays with energies greater than 30 MeV in the atmosphere

    Thompson, D.; Fichtel, C.; Kniffen, D.

    1974-01-01

    A three-dimensional study of atmospheric gamma rays with energy greater than 30 MeV has been carried out. Experimental results were obtained from four balloon flights from Palestine, Texas, with a 15 cm by 15 cm digitized wire grid spark chamber. The energy spectrum for downward-moving gamma rays steepens with increasing atmospheric depth. Near the top of the atmosphere, the spectrum steepens with increasing zenith angle. Experimental results compare reasonably well with a three-dimensional Monte Carlo calculation of atmospheric gamma ray production. Inclusion of upward-moving gamma rays makes possible the use of atmospheric secondaries for in-flight calibration of satellite gamma ray detectors.

  20. Nuclear excitation functions from 40-200 MeV proton irradiation of terbium

    Engle, Jonathan W; Parker, Lauren A; Jackman, Kevin R; Bitteker, Leo J; Ullmann, John L; Gulley, Mark S; Pillai, Chandra; John, Kevin D; Birnbaum, Eva R; Nortier, Francois M

    2015-01-01

    Nuclear formation cross sections are reported for 26 radionuclides, measured with 40 to 200 MeV proton irradiations of terbium foils. These data are relevant to the production of medically relevant radionuclides (e.g., 152Tb, 155Tb, 155Eu, and 156Eu) and to ongoing efforts to characterize stellar nucleosynthesis routes passing through long-lived intermediaries (e.g., 153Gd). Computational predictions from the ALICE2011, CEM03.03, Bertini, and INCL+ABLA codes are compared with newly measured data to contribute to the ongoing process of code development, and yields are calculated for selected radionuclides using measured data.

  1. Neutron cross section standards for the energy region above 20 MeV

    These proceedings of a specialists' meeting on Neutron cross section standards for the energy region above 20 MeV are divided into 6 sessions bearing on: - session 1: status of the date base for (n-p) scattering (2 conferences) - session 2: status of nucleon-nucleon phase shift calculations (1 conference) - session 3: recent and planned experimental work on n-p cross section measurements and facilities (7 conferences) - session 4: Instruments for utilizing the H (n.n) standard for neutron fluence measurement (4 conferences) - session 5: proposal for other neutron cross-section standards (4 conferences) - session 6: monitor reactions for radiation dosimetry (3 conferences)

  2. Printed board dipole trim magnet design for 20 MeV LIA

    The printed board dipole trim magnet design for a 20 MeV LIA is presented. The prototype dipole magnet with the sin/cos distributed windings has demonstrated more than 650 Gs-cm integrated dipole field and 1% integrated dipole field homogeneity within 5 cm in radius, which is about 40% of the magnet radius. Numerical modeling of two prototype magnet designs using the 3D magnetic field code SCMAG is presented as well as data from magnetic field measurements of the two magnets. The agreement between the calculations and measurements is accurate to 2-3%. (author). 3 figs., 4 refs

  3. NEUTRON CROSS SECTION COVARIANCES FROM THERMAL ENERGY TO 20 MeV.

    ROCHMAN,D.; HERMAN, M.; OBLOZINSKY, P.; MUGHABGHAB, S.F.; PIGNI, M.; KAWANO, T.

    2007-04-27

    We describe new method for energy-energy covariance calculation from the thermal energy up to 20 MeV. It is based on three powerful basic components: (i) Atlas of Neutron Resonances in the resonance region; (ii) the nuclear reaction model code EMPIRE in the unresolved resonance and fast neutron regions, and (iii) the Bayesian code KALMAN for correlations and error propagation. Examples for cross section uncertainties and correlations on {sup 90}Zr and {sup 193}Ir illustrate this approach in the resonance and fast neutron regions.

  4. Evaluated neutron-induced cross sections for 40Ca from 20 to 40 MeV

    Nuclear model codes were used to compute cross sections for neutron-induced reactions on 40Ca for incident energies from 20 to 40 MeV. The input parameters for the model codes were determined through analysis of experimental data in this energy region. Computed cross sections along with emission spectra for each product were combined into an Evaluated Nuclear Data File (ENDF) using the proposed format for charged-particle reactions. Discussion of the models used, the resulting calculations, and the final evaluated data file are presented

  5. Reliability Calculations

    Petersen, Kurt Erling

    1986-01-01

    probabilistic approaches have been introduced in some cases for the calculation of the reliability of structures or components. A new computer program has been developed based upon numerical integration in several variables. In systems reliability Monte Carlo simulation programs are used especially in analysis...... of very complex systems. In order to increase the applicability of the programs variance reduction techniques can be applied to speed up the calculation process. Variance reduction techniques have been studied and procedures for implementation of importance sampling are suggested....

  6. Model calculations of nuclear data for biologically-important elements

    We describe calculations of neutron-induced reactions on carbon and oxygen for incident energies up to 70 MeV, the relevant clinical energy in radiation neutron therapy. Our calculations using the FKK-GNASH, GNASH, and ALICE codes are compared with experimental measurements, and their usefulness for modeling reactions on biologically-important elements is assessed

  7. Excitation of the 1+ state in 48Ca(10.2 MeV) by inelastic scattering of π- and π+

    Excitation functions for inelastic scattering of π- from 48Ca to the 1+ state at 10.2 MeV have been measured at constant momentum transfer q = 73 MeV/c. The incident energy was varied between 116 and 180 MeV. An upper limit was measured for the π+ cross section at 116 MeV. The data are not fitted by distorted-wave impulse approximation calculations at this q where the differential cross section is predicted to have its maximum. The discrepancy between theory and experiment is similar to the disagreement observed for 12C(π,π')12C(1+ ,15.1 MeV)

  8. Crab Nebula observations - 0.2-10 MeV

    Gruber, D. E.

    1975-01-01

    Observations of the total emission from the Crab Nebula and also of the pulsed component were made over the 0.2 to 10-MeV range during three balloon flights in 1971 with an actively-collimated NaI scintillator. The total emission flux was positively observed over the entire interval. The observed spectrum to 1 MeV agrees with an extrapolation of the E to the -2.2 power law, which fits lower-energy data. The observations above 1 MeV are factors of 3 and 20 above this law and are better fit with a spectral index of 0.8. Confidence levels are 3 sigma or better for each half-decade band. The three observations are consistent with a constant flux level. The NP 0532 flux, detected during one flight only (August 8) between 0.2 and 0.38 MeV, agrees with the exponential power law spectrum already determined from other observations. The possibility of a rapidly rising pulsed emission fraction over the 0.1- to 1-MeV interval is excluded by this observation.

  9. Temporal Structure of MeV Electron Precipitation

    Millan, R. M.; Lorentzen, K. R.; Lin, R. P.; Smith, D. M.

    2001-12-01

    On January 12, 2000, the MAXIS (MeV Auroral X-ray Imaging and Spectroscopy) long duration balloon experiment was launched from McMurdo, Antarctica carrying x-ray instrumentation designed to search for MeV electron precipitation similar to the event observed in 1996 over Kiruna, Sweden (L=5.8). MAXIS detected seven x-ray bursts with significant flux extending above 0.8 MeV during the 18 day flight in addition to extended periods of softer X-ray activity. These seven events are characterized by an extremely flat spectrum ( ~E-1.7) indicating that the bulk of precipitating electrons producing the x-rays is at relativistic energies. The bursts were detected between magnetic latitudes 58o-67o (corresponding to L-values between 3.8-6.7) with durations varying from several minutes to several hours. The MeV bursts were found to occur preferentially in the late afternoon/dusk sectors (14:30-00:00 MLT) while softer precipitation was detected at all magnetic local times. Two of the strongest MeV events detected by MAXIS show strong modulation of the x-ray count rate at ULF timescales ( ~150 s) similar to modulations observed during the Kiruna event at 100-200 s. We present results from temporal analysis of the MAXIS germanium spectrometer data and examine ground-based and spacecraft observations for evidence of coincident ULF wave activity.

  10. Calculation of inelastic electron-nucleus scattering form factors of 29Si

    Salman, A. D.; Al-Dahan, N.; Sharrad, F. I.; Hossain, I.

    2014-08-01

    Inelastic electron scattering form factors for 29Si nucleus with total angular momentum and positive parity (Jπ) and excited energy (3/2+, 1.273 MeV; 5/2+, 2.028 MeV; 3/2+, 2.425 MeV and 7/2+, 4.079 MeV) have been calculated using higher energy configurations outside the sd-shell. The calculations of inelastic form factors up to the first- and second-order with and without core-polarization (CP) effects were compared with the available experimental data. The calculations of inelastic electron scattering form factors up to the first-order with CP effects are in agreement with the experimental data, excepted for states 3/2+(1.273 MeV) and 5/2+(2.028 MeV) and without this effect are failed for all states. Furthermore, the calculations of inelastic electron scattering form factors up to the second-order with CP effects are in agreement with the experimental data for 3/2+(1.273 MeV) and 5/2+(2.028 MeV).

  11. Development and application of a detector for absolute measurement of neutron fluence rate in MeV region

    The development and performance of the DTS (Dual Thin Scintillator) for the absolute measurement of the neutron fluence rate between 1 and 15 MeV is decribed. The DTS detector consists of a pair of organic scintillators in a dual configuration, where the incident produces a proton-recoil which is detected in a 2Π geometry therefore avoiding the effect of the escape of protons. Thin scintillators are used resulting in small multiple scattering corrections. The theoretical caluclations of detector efficiency and proton-recoil spectrum were performed by means of a Monte Carlos code - CARLO DTS. The calculated efficiency was compared to the experimental one at two neutron energies namely 2.446 MeV and 14.04 MeV applying the Time Correlated Associated Particle technique. The theoretical and experimental efficiencies agreed within the experimental uncertainties of 1.44% and 0.77%, respectively. The performance of the DTS has been verified in an absolute 235U(n,f) cross section measurement between 1 and 6 MeV neutron energy. The cross section results were compared to those obtained replacing the DTS detector by the NBS (National Bureau of Standards, USA) Black Neutron Detector. The agreement was excellent in the overlapping energy interval of the two experiments (between 1 and 3 MeV), within the estimated uncertainly in the range of 1,0 to 1,7%. The agreement with the most recent evaluation from the ENDF/B-VI was excellent in almost all the energy range between 1 and 6 MeV. The 235U(n,f) cross section, average over the 252Cf fission neutron spectrum has been evaluated. The result including the cross section values of the present work was 1220 mb, in excellent agreement with the average value among the most recent measurements, 1227 +- 12 mb, and with the value 1213 mb, using the ENDF/B-VI data. (author)

  12. IS186 Insertion at a Hot Spot in the lon Promoter as a Basis for Lon Protease Deficiency of Escherichia coli B: Identification of a Consensus Target Sequence for IS186 Transposition

    SaiSree, L.; Reddy, Manjula; J.Gowrishankar

    2001-01-01

    The radiation sensitivity of Escherichia coli B was first described more than 50 years ago, and the genetic locus responsible for the trait was subsequently identified as lon (encoding Lon protease). We now show that both E. coli B and the first reported E. coli K-12 lon mutant, AB1899, carry IS186 insertions in opposite orientations at a single site in the lon promoter region and that this site represents a natural hot spot for transposition of the insertion sequence (IS) element. Our analys...

  13. 3 MeV Test Stand commissioning report

    Bellodi, Guilia; Andreassen, O; Comblin, J-F; Dimov, V; Lallement, J-B; Martin, C; Midttun, O; Ovalle, E; Raich, U; Roncarolo, F; Rossi, C; Scrivens, R; Vollaire, J; Yarmohammadi Satri, M; Zocca, Z

    2013-01-01

    Linac4 is a normal-conducting 160 MeV H- linear accelerator, presently under construction, that will replace the present 50 MeV Linac2 as injector of the CERN proton accelerator complex with the goal of increasing the LHC luminosity. The Linac4 front-end, composed of a 45 keV ion source, a Low Energy Beam Transport (LEBT), a 352.2 MHz Radio Frequency Quadrupole (RFQ) and a Medium Energy Beam Transport (MEBT) housing a beam chopper, was commissioned at the 3 MeV test stand area during the first half of 2013. This report gives details of the installation and operational systems used, describes the commissioning phases and measurements performed and summarizes the results that were finally achieved and the lessons learnt in the process.

  14. Nuclear Resonance Fluorescence from Uranium above 2 MeV

    Kwan, E.; Howell, C. R.; Raut, R.; Rusev, G.; Tonchev, A. P.; Tornow, W.; Adekola, A.; Hammond, S. L.; Karwowski, H. J.; Tompkins, J. R.; Huibregtse, C.; Kelley, J. H.; Johnson, B.

    2009-10-01

    The detection of special nuclear materials is critical to the nation's efforts to counter serious threat from nuclear terrorist attacks. A research program has been initiated at TUNL to address the need for new nuclear data on the actinides using the High-Intensity Gamma-Ray Source (HIγS). The high-intensity nearly monoenergic and 100% polarized γ-ray beams from HγS were utilized to search for dipole states in ^235U and ^238U above 2 MeV. This information is necessary for developing technologies using Nuclear-Resonance Fluorescence (NRF) to nonintrusively scan cargo for specific nuclei. The existence of strong nuclear dipole transitions in the actinides above 2 MeV is important for nuclear forensics, because interrogation photons using NRF are the most penetrating at these energies. Results from our experiments at Eγ> 2.0 MeV on uranium will be presented.

  15. An RFQ accelerator system for MeV ion implantation

    Hirakimoto, Akira; Nakanishi, Hiroaki; Fujita, Hiroyuki; Konishi, Ikuo; Nagamachi, Shinji; Nakahara, Hiroshi; Asari, Masatoshi

    1989-02-01

    A 4-vane-type Radio-Frequency Quadrupole (RFQ) accelerator system for MeV ion implantation has been constructed and ion beams of boron and nitrogen have been accelerated successfully up to an energy of 1.01 and 1.22 MeV, respectively. The acceleration of phosphorus is now ongoing. The design was performed with two computer codes called SUPERFISH and PARMTEQ. The energy of the accelerated ions was measured by Rutherford backscattering spectroscopy. The obtained values agreed well with the designed ones. Thus we have confirmed the validity of our design and have found the possibility that the present RFQ will break through the production-use difficulty of MeV ion implantation.

  16. 10MeV 25KW industrial electron LINAC

    Kamino, Y.

    1998-06-01

    A 10MeV 25KW plus class electron LINAC was developed for sterilisation of medical devices. The LINAC composed of a standing wave type single cavity prebuncher and a 2m electro-plated travelling wave guide uses a 5MW 2856MHz pulse klystron as an RF source and provides 25KW beam power at the Ti alloy beam window stably after the energy analysing magnet with 10MeV plus-minus 1 MeV energy slit. The practical maximum beam power reached 29 KW and this demonstrated the LINAC as one of the most powerful S-band electron LINACs in the world. The control of the LINAC is fully automated and the "One-Button Operation" is realised, which is valuable for easy operation as a plant system. 2 systems have been delivered and are being operated stably.

  17. The JHP 200-MeV proton linear accelerator

    Kato, Takao [National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan)

    1997-11-01

    A 200-MeV proton linear accelerator for the Japanese Hadron Project (JHP) has been designed. It consists of a 3-MeV radio-frequency quadrupole linac (RFQ), a 50-MeV drift tube linac (DTL) and a 200-MeV separated-type drift tube linac (SDTL). A frequency of 324 MHz has been chosen for all of the rf structures. A peak current of 30 mA (H{sup -} ions) of 400 {mu}sec pulse duration will be accelerated at a repetition rate of 25 Hz. A future upgrade plan up to 400 MeV is also presented, in which annular-coupled structures (ACS) of 972 MHz are used in an energy range of above 150 or 200 MeV. One of the design features is its high performance for a beam-loss problem during acceleration. It can be achieved by separating the transition point in the transverse motion from that of the longitudinal motion. The transverse transition at a rather low-energy range decreases the effects of space-charge, while the longitudinal transition at a rather high-energy range decreases the effects of nonlinear problems related to acceleration in the ACS. Coupled envelope equations and equipartitioning theory are used for the focusing design. The adoption of the SDTL structure improves both the effective shunt impedance and difficulties in fabricating drift tubes with focusing magnets. An accurate beam-simulation code on a parallel supercomputer was used for confirming any beam-loss problem during acceleration. (author)

  18. Elastic and inelastic scattering of 30 MeV and 180 MeV antiprotons on nuclei

    This thesis reports on the first measurements of angular distributions for elastic and inelastic scattering of antiprotons from nuclei, which have been performed, using the beam delivered by LEAR and the spectrometer SPES II, over a wide angular range and with good precision. Angular distributions for elastic scattering of 50 MeV antiprotons from 12C, 40Ca, 208Pb and 180 MeV antiprotons from 12C, 16O, 18O, 40Ca, 208Pb have been measured. Data on the inelastic 4.4 MeV and 9.6 MeV excited states of 12C and 1.98 MeV excited state of 18O have also been collected. The diffractive angular distributions are first analysed in terms of a fuzzy black disk model, which confirms that the antiproton is strongly absorbed (annihilation) by the nuclei. Optical model analysis, with Woods-Saxon geometry, shows that the real potential is attractive and shallow. The potentials are only determined at the nuclear surface, around the strong absorption radius, where /W(R)/ > 2 /V(R)/. Main characteristics of the antip-nucleus elastic scattering cross sections are well described within microscopic models using the free elementary antiN N interaction, like KMT which have no free parameters. Possibility for test of spin-isospin dependence of the elementary amplitude antiN-N from the measurement of unnatural parity states is also studied

  19. SPEI Calculator

    Beguería, Santiago; Vicente Serrano, Sergio M.

    2009-01-01

    [EN] *Objectives: The program calculates time series of the Standardised Precipitation-Evapotransporation Index (SPEI). *Technical Characteristics: The program is executed from the Windows console. From an input data file containing monthly time series of precipitation and mean temperature, plus the geographic coordinates of the observatory, the program computes the SPEI accumulated at the time interval specified by the user, and generates a new data file with the SPEI time serie...

  20. Burnout calculation

    Reviewed is the effect of heat flux of different system parameters on critical density in order to give an initial view on the value of several parameters. A thorough analysis of different equations is carried out to calculate burnout is steam-water flows in uniformly heated tubes, annular, and rectangular channels and rod bundles. Effect of heat flux density distribution and flux twisting on burnout and storage determination according to burnout are commended

  1. Preparation of 186 Re-MIBI Complex for Myocardial Perfusion Imaging as Potential Replacement of Analogues 99mTc-MIBI

    The aim of the present study is to label 2-methoxy isobutyl-isonitrile (MIBI) compound with pure 186 Re and study the optimum conditions to prepare the 186 Re-MIBI complex as a stable contrast agent for myocardial perfusion imaging. From the obtained data the complexation of MIBI with 186 Re was carried out of using 1 mg MIBI, 1 mg SnCl2, 3 mg gentesic acid and 1 ml 186 Re(37 MBq) at ph 2 in a boiling water bath for 30 min. The biodistribution studies in mice indicate that, the complex was cleared from the body by kidneys to urinary bladder and finally was eliminated from the body by urine. 186 Re-MIBI demonstrated satisfactory heart uptake and retention like 99mTc-MIBI (8.94% dose/organ at 5 minutes), blood clearance was fast, while liver activity decreased by time and negligible activity in the lunges. The obtained data showed that 186 Re-MIBI as a potential replacement of 99mTc-MIBI for myocardial perfusion imaging

  2. Neutron-neutron quasifree scattering in nd breakup at 10 MeV

    Malone, R. C.; Crowe, B.; Crowell, A. S.; Cumberbatch, L. C.; Esterline, J. H.; Fallin, B. A.; Friesen, F. Q. L.; Han, Z.; Howell, C. R.; Markoff, D.; Ticehurst, D.; Tornow, W.; Witała, H.

    2016-03-01

    The neutron-deuteron (nd) breakup reaction provides a rich environment for testing theoretical models of the neutron-neutron (nn) interaction. Current theoretical predictions based on rigorous ab-initio calculations agree well with most experimental data for this system, but there remain a few notable discrepancies. The cross section for nn quasifree (QFS) scattering is one such anomaly. Two recent experiments reported cross sections for this particular nd breakup configuration that exceed theoretical calculations by almost 20% at incident neutron energies of 26 and 25 MeV [1, 2]. The theoretical values can be brought into agreement with these results by increasing the strength of the 1S0 nn potential matrix element by roughly 10%. However, this modification of the nn effective range parameter and/or the 1S0 scattering length causes substantial charge-symmetry breaking in the nucleon-nucleon force and suggests the possibility of a weakly bound di-neutron state [3]. We are conducting new measurements of the cross section for nn QFS in nd breakup. The measurements are performed at incident neutron beam energies below 20 MeV. The neutron beam is produced via the 2H(d, n)3He reaction. The target is a deuterated plastic cylinder. Our measurements utilize time-of-flight techniques with a pulsed neutron beam and detection of the two emitted neutrons in coincidence. A description of our initial measurements at 10 MeV for a single scattering angle will be presented along with preliminary results. Also, plans for measurements at other energies with broad angular coverage will be discussed.

  3. Resolution considerations in MeV ion microscopy and lithography

    Norarat, Rattanaporn, E-mail: rattanaporn@rmutl.ac.th [University of Applied Sciences (HES-SO), Haute Ecole Arc Ingénierie, Eplatures-Gris 17, CH-2300 La Chaux-de-Fonds (Switzerland); Faculty of Sciences and Agricultural Technology, Rajamangala University of Technology Lanna, Chiang Rai, 57120 Chiang Rai (Thailand); Whitlow, Harry J. [University of Applied Sciences (HES-SO), Haute Ecole Arc Ingénierie, Eplatures-Gris 17, CH-2300 La Chaux-de-Fonds (Switzerland)

    2015-04-01

    There a disparity between the way the resolution is specified in microscopy and lithography using light compared to MeV ion microscopy and lithography. In this work we explore the implications of the way the resolution is defined with a view to answering the questions; how are the resolving powers in MeV ion microscopy and lithography relate to their optical counterparts? and how do different forms of point spread function affect the modulation transfer function and the sharpness of the edge profile?.

  4. Crosslinking of commercial polyethylenes by 10 MeV electrons

    Commercial polyethylenes were irradiated with 10 MeV electrons to induce crosslinking. The gel fraction data measured as a function of total dose suggests that crosslinking proceeds on irradiation, as expected. A number of the properties of the irradiated polyethylenes, such as the degree of oxidation, crystallinity and thermal degradation, were studied by Fourier transform infrared/photo acoustic spectroscopy, X-ray diffraction, and a pyrolysis technique coupled with gas chromatography and mass spectrometry. The results of this study suggest that commercial polyethylenes can be crosslinked to a gel fraction of ∼70%, required for wire and cable applications, by 10 MeV electrons. (author). 35 refs., 6 figs

  5. A fully microscopic model of 200 MeV proton-12C elastic and inelastic scattering

    An effective two nucleon (NN) interaction in the nuclear medium is defined from an accurate mapping of the NN g matrices obtained by solving the Brueckner-Bethe-Goldstone equations for infinite nuclear matter. That effective interaction is used in a fully microscopic calculation of the nonlocal effective proton-12C interaction from which are obtained predictions of the differential cross section and analysing power for 200 MeV elastic scattering. The relative motion wave functions so found are used as the distorted waves in a distorted wave approximation (DWA) study of select inelastic scattering events. The effective NN interaction is used as the transition operator in those calculations. The relevant nuclear spectroscopy for the elastic and DWA (p, p') calculations is found from a full (0 + 2) ℎω shell model evaluation of the positive parity states while a restricted (1 + 3)ℎω has been used to give the negative parity states. Results are compared with those of the 0p-shell model of Cohen and Kurath or with those based upon axially symmetric, projected Hartree-Fock calculations. The diverse structure model wave functions are assessed by using them in calculations to compare with measured longitudinal, transverse electric and transverse magnetic form factors from electron scattering to many of the excited states of 12C. Using those models of the structure of 12C in the completely microscopic model of the elastic and inelastic scattering of 200 MeV protons, good fits have been found to the cross section and analysing power data. 50 refs., 3 tabs., 20 figs

  6. A study of radiation effects of 9 and 12 MeV protons on Chinese CMOS image sensor degradation

    The 9 and 12 MeV proton irradiations of the Chinese CMOS Image Sensor in the fiuence range from 1x109 to 4xl010 cm-2and 1x109 to 2x1012 cm-2 have been carried out respectively. The color pictures and dark output images are captured, and the average brightness of dark output images is calculated. The anti-irradiation fluence thresholds for 9 and 12 MeV protons are about 4x1010 and 2x1012 cm-2, respectively. These can be explained by the change of the concentrations of irradiation-induced electron-hole pairs and vacancies in the various layers of CMOS image sensor calculated by the TRIM simulation program. (authors)

  7. A study of radiation effects of 9 and 12 MeV protons on Chinese CMOS image sensor degradation

    MENG Xiang-Ti; HUANG Qiang; MA Yan-Xiu; ZHENG Yong-Nan; FAN Ping; ZHU Sheng-Yun

    2008-01-01

    The 9 and 12 MeV proton irradiations of the Chinese CMOS Image Sensor in the fluence range from 1×109to 4×1010 cm-2and 1×109 to 2×1012 cm-2 have been carried out respectively. The color pictures and dark output images are captured, and the average brightness of dark output images is calculated. The anti-irradiation fluence thresholds for 9 and 12 MeV protons are about 4×1010 and 2×1012 cm-2, respectively. These can be explained by the change of the concentrations of irradiation-induced electron-hole pairs and vacancies in the various layers of CMOS image sensor calculated by the TRIM simulation program.

  8. Relativistic few body calculations

    A modern treatment of the nuclear few-body problem must take into account both the quark structure of baryons and mesons, which should be important at short range, and the relativistic exchange of mesons, which describes the long range, peripheral interactions. A way to model both of these aspects is described. The long range, peripheral interactions are calculated using the spectator model, a general approach in which the spectators to nucleon interactions are put on their mass-shell. Recent numerical results for a relativistic OBE model of the NN interaction, obtained by solving a relativistic equation with one-particle on mass-shell, will be presented and discussed. Two meson exchange models, one with only four mesons (π,σ,/rho/,ω) but with a 25% admixture of γ5 coupling for the pion, and a second with six mesons (π,σ,/rho/,ω,δ,/eta/) but pure γ5γ/sup μ/ pion coupling, are shown to give very good quantitative fits to the NN scattering phase shifts below 400 MeV, and also a good description of the /rvec p/ 40Ca elastic scattering observables. Applications of this model to electromagnetic interactions of the two body system, with emphasis on the determination of relativistic current operators consistent with the dynamics and the exact treatment of current conservation in the presence of phenomenological form factors, will be described. 18 refs., 8 figs

  9. The nuclear response in the 54Fe(p vector, p' vector) reaction at 290 Mev

    Cross sections, analysing powers and spin-flip probabilities have been measured for inclusive inelastic scattering of 290 MeV protons from 54Fe at laboratory angles between 3.1 degrees and 20 degrees. The momentum transfers vary from small values (q ∼ 0.2 fm-1) where individual giant resonances of low multipolarity are observed, to larger values (q ∼ 1.4 fm-1) where quasielastic scattering dominates. For the observed range of momentum and energy transfers (ω ≤ 96 MeV at 20 degrees, ≤ 45 MeV at smaller angles) the spin-flip probabilities Snn and spin-flip strengths σSnn appear to be insensitive to assumptions about the reaction mechanism and are qualitatively described by a nonrelativistic model of quasielastic scattering which approximates the nuclear response by that of a semi-infinite slab with RPA correlations. Strongly enhanced Snn values are observed for ω > 25 MeV and q ≅ 100 MeV/c in agreement with similar observations for several other nuclei. The slab model gives a reasonable account of cross sections and angular distributions for the 54Fe(n,p)54Mn reaction at 298 MeV. The inclusion of damping of the response by 2 particle-2 hole excitations and of contributions from two-step processes improves the agreement with the (n,p) data. Using the experimental cross sections for (p,p') and (n,p) reactions and the measured spin-flip strengths in (p,p'), we have separated the nuclear response into spin (ΔS = 0, ΔS = 1), isospin (Tf = 1,2) and angular momentum (L 0,1,2...) components. The distribution and strengths of the Gamow Teller, the isovector giant dipole, and the (isoscalar) giant quadrupole resonances have been determined from this analysis and are compared to results from complementary reactions. Relative to quasiparticle RPA calculations the Gamow Teller quenching factors deduced from the σSnn data are slightly smaller than those from (p,n) and (n,p) reactions. (Author) (64 refs., 5 tabs., 20 figs.)

  10. Calculation of baryon masses in quantum chromodynamics

    The polarization operator of quark currents with the baryon quantum numbers is considered in quantum chromodynamics. The non-zero mean vacuum of the field operator products are taken into account. The sum rules are obtained assuming that in the virtuality region approximately 1 GeV, among the mean vacuum values violating the chiral invariance, the most important is . Saturating these sum rules by the lowest baryonic states one is able to calculate the masses of the isobar Δ and nucleon N, Msub(Δ) 1.4 GeV, Msub(N) = 1 GeV, up to 15 % through the known value . The mass splitting in the baryonic decuplet Msub(Σ*) - Msub(Δ) = 125 MeV is calculated in the first order in the current strange quark mass msub(s) = 150 MeV. Certain results for that baryonic resonances have been obtained

  11. Leakage neutron spectra from Al, Ni and Ti spheres with a 14 MeV neutron source

    The leakage neutron spectra from metallic spheres were measured on the 14 MeV pulsed neutron generator of the Physics and Power Engineering Institute. The experiment was performed by the time-of-flight method. The experimental set-up and the methods of conducting the measurements and treating the results are described. The experimental data are compared with calculations performed with the BLANK program, using ENDF, ENDL, JENDL and BROND evaluated data files. (author). 7 refs, 6 figs, 3 tabs

  12. Neutron activitation analysis of an air-dust sample using a high-flux 14 Mev neutron generator

    The 14 MeV neutron activation analysis technique is illustrated for multielement analysis of a Milanese air-dust sample. The neutron generator and electronic system, the efficiency and flux calibration, the γ-ray background, the sample preparation and the peak analysis used are described. After careful corrections of all possible interferences and error calculations, the results of 24 elemental concentrations are compared with those of other analytical techniques in the scope of an interlaboratory test. (orig.)

  13. The emission anisotropy of isolated K MO transitions in 40 MeV Ni+Ni collisions

    The emission anisotropy of isolated MO transitions was measured for the first time in 40 MeV Ni+Ni collisions by detecting K MO x-rays, emitted at 90deg and 0deg with respect to the beam direction, in coincidence with characteristic Ni K x-rays. A tenfold increase in the anisotropy was observed for the selected transitions over that associated with the total spectrum. Recent calculations agree with this large anisotropy. (author)

  14. Cross section systematics of (d,p) reactions at 8.5 MeV

    Highlights: • We develop the empirical and semi-empirical formulae for (d,p) nuclear reaction cross sections. • We calculate the (d,p) nuclear reaction cross sections at 8.5 MeV projectile energy. • We researched of the pairing effects for the cross sections of the (d,p) nuclear reactions. • The obtained results have been compared with other cross section values. - Abstract: The empirical and semi-empirical systematics of the (d,p) nuclear reaction cross sections were obtained at the incident deuteron energies of 8.5 MeV. The experimental values for (d,p) reaction cross sections were collected from the literature and analyzed for the some target nuclei 27 < A < 121. The obtained cross section formulas by fitting two parameters for the (d,p) nuclear reactions were given. The obtained cross section results by using the systematics for (d,p) nuclear reactions have been discussed and compared with the ALICE–ASH code calculations and the available experimental data. Finally, the semi-empirical cross section formula gives a good fit with the experimental values for the (d,p) nuclear reaction

  15. Attenuation data of point isotropic neutron sources up to 400MeV in water, ordinary concrete and iron

    Kotegawa, Hiroshi; Tanaka, Shun-ichi; Sakamoto, Yukio; Nakane, Yoshihiro; Nakashima, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1994-08-01

    A comprehensive attenuation data of dose equivalent for point isotropic monoenergetic neutron sources up to 400MeV in infinite shields of water, ordinary concrete and iron has been calculated using the ANISN-JR code and a neutron-photon multigroup macroscopic cross section HIL086R. The attenuation factors were fitted to a 4th order polynomial exponent formula, making possible to use easily for point kernel codes. Additional data in finite shielding geometry was also calculated to correct the effect due to infinite medium, giving the maximum correction of 0.23 in the region for more 400 cm distance from neutron source of 400 MeV in iron shield. Effective attenuation length for monoenergetic neutrons have been studied in detail. Subsequently, it was shown that the attenuation length was strongly dependent upon the penetration length and the Moyer`s formula using a single attenuation length brought large error into the dose estimation behind thick shields for the intermediate energy neutrons up to 400 MeV. Furthermore, it was demonstrated that there was difference more than 50 % in the attenuation length of iron between the calculations with HIL086R and HIL086 because of the self-shielding effect. (author).

  16. Attenuation data of point isotropic neutron sources up to 400MeV in water, ordinary concrete and iron

    A comprehensive attenuation data of dose equivalent for point isotropic monoenergetic neutron sources up to 400MeV in infinite shields of water, ordinary concrete and iron has been calculated using the ANISN-JR code and a neutron-photon multigroup macroscopic cross section HIL086R. The attenuation factors were fitted to a 4th order polynomial exponent formula, making possible to use easily for point kernel codes. Additional data in finite shielding geometry was also calculated to correct the effect due to infinite medium, giving the maximum correction of 0.23 in the region for more 400 cm distance from neutron source of 400 MeV in iron shield. Effective attenuation length for monoenergetic neutrons have been studied in detail. Subsequently, it was shown that the attenuation length was strongly dependent upon the penetration length and the Moyer's formula using a single attenuation length brought large error into the dose estimation behind thick shields for the intermediate energy neutrons up to 400 MeV. Furthermore, it was demonstrated that there was difference more than 50 % in the attenuation length of iron between the calculations with HIL086R and HIL086 because of the self-shielding effect. (author)

  17. Calculator calculus

    McCarty, George

    1982-01-01

    How THIS BOOK DIFFERS This book is about the calculus. What distinguishes it, however, from other books is that it uses the pocket calculator to illustrate the theory. A computation that requires hours of labor when done by hand with tables is quite inappropriate as an example or exercise in a beginning calculus course. But that same computation can become a delicate illustration of the theory when the student does it in seconds on his calculator. t Furthermore, the student's own personal involvement and easy accomplishment give hi~ reassurance and en­ couragement. The machine is like a microscope, and its magnification is a hundred millionfold. We shall be interested in limits, and no stage of numerical approximation proves anything about the limit. However, the derivative of fex) = 67.SgX, for instance, acquires real meaning when a student first appreciates its values as numbers, as limits of 10 100 1000 t A quick example is 1.1 , 1.01 , 1.001 , •••• Another example is t = 0.1, 0.01, in the functio...

  18. Reliability calculations

    Risk and reliability analysis is increasingly being used in evaluations of plant safety and plant reliability. The analysis can be performed either during the design process or during the operation time, with the purpose to improve the safety or the reliability. Due to plant complexity and safety and availability requirements, sophisticated tools, which are flexible and efficient, are needed. Such tools have been developed in the last 20 years and they have to be continuously refined to meet the growing requirements. Two different areas of application were analysed. In structural reliability probabilistic approaches have been introduced in some cases for the calculation of the reliability of structures or components. A new computer program has been developed based upon numerical integration in several variables. In systems reliability Monte Carlo simulation programs are used especially in analysis of very complex systems. In order to increase the applicability of the programs variance reduction techniques can be applied to speed up the calculation process. Variance reduction techniques have been studied and procedures for implementation of importance sampling are suggested. (author)

  19. Multi-step processes in the (d, t) and (d, 3He) reactions on 116Sn and 208Pb targets at Ed = 200 MeV

    The role of multi-step processes in the reactions 116Sn(d,t), 208Pb(d,t) and 116Sn(d,3He), previously studied at Ed = 200 MeV at forward angles and for relatively low energy transfers, has been investigated. We have performed for the first time multi-step calculations taking into account systematically collective excitations in the second and higher order step inelastic transitions. A calculation code based on the Feshbach, Kerman and Koonin model has been modified to handle explicitly these collective excitations, most important in the forward angle domain. One step double differential pick-up cross sections were built from finite range distorted wave results spread in energy using known or estimated hole state characteristics. It is shown that two-step cross sections calculated using the above method compare rather well with those deduced via coupled channel calculations for the same collective excitations. The multi-step calculations performed up to 6 steps reproduce reasonably well the 115Sn, 207Pb and 115In experimental spectra measured up to Ex∼- 40 MeV and 15 deg. The relative contributions of steps of increasing order to pick-up cross sections at Ed = 200 MeV and 150 MeV are discussed. (authors)

  20. Neutron cross sections at 14 MeV

    Neutron activation cross sections on Nd isotopes at 14 MeV were measured using the Ge(Li) gamma-ray spectroscopy. The nonlinear least square method was used for resolving the gamma spectra. The results obtained are discussed in detail and compared with theoretical results on other isotopes

  1. The 400 MeV Linac Upgrade at Fermilab

    Noble, R.J.

    1992-12-01

    The Fermilab Linac Upgrade in planned to increase the energy of the H{sup {minus}} linac from 200 to 400 MeV. This is intended to reduce the incoherent space-charge tuneshift at injection into the 8 GeV Booster which limit either the brightness or the total intensity of the beam. The Linac Upgrade will be achieved by replacing the last four 201.25 MHs drift-tube linac (DTL) tanks which accelerate the beam from 116 to 200 MeV, with seven 805 MRs side-coupled cavity modules operating at an average axial field of about 7.5 MV/meter. This will allow acceleration to 400 MeV in the existing Linac enclosure. Each accelerator module will be driven with a 12 MW klystron-based rf power supply. Three of seven accelerator modules have been fabricated, power tested and installed in their temporary location adjacent to the existing DTL. All seven RF Modulators have been completed and klystron installation has begun. Waveguide runs have completed from the power supply gallery to the accelerator modules. The new linac will be powered in the temporary position without beam in order to verify overall system reliability until the laboratory operating schedule permits final conversion to 400 MeV operation.

  2. Analysis of 33 MeV Nitrogen irradiated UHMWPE

    In this work, we irradiated UHMWPE with 33 MeV Nitrogen ions, at several fluences, to generate surface modifications without affecting the bulk properties. These modifications were quantified by means of wear resistance tests and Fourier transform infrared spectroscopy (FTIR) measurements. Experimental results show an optimum ion fluence value that maximizes UHMWPE wear resistance

  3. Linac4 crosses the 100 MeV threshold

    Corinne Pralavorio

    2016-01-01

    The new linear accelerator, which from 2020 will be the first link in the accelerator chain, has entered a new stage of its commissioning.   Members of the team in charge of the commissioning of Linac4 in the accelerator’s control room. A few hours earlier, Linac4 accelerated a beam to 107 MeV for the first time. We couldn’t have imagined a more appropriate date: on 1 July (1.07), Linac4 reached an energy of 107 MeV. Having crossed the 100 MeV barrier, the linear accelerator is now on the home straight of its commissioning. “This stage was very quick – it took less than two weeks,” says Alessandra Lombardi, deputy project leader of Linac4, in charge of the commissioning. In 2020, Linac4 will replace the existing Linac2 as the first link in the accelerator chain. It will accelerate beams of H- ions (protons surrounded by two electrons) to 160 MeV, compared to 50 MeV with Linac2. The new machine is particularly sophisticated as it comprises...

  4. 200 MeV RF linac for synchrotron injection

    Construction has been completed on an electron linear accelerator for the Brookhaven National Laboratory. This accelerator will be used for the injection of a 200 MeV electron beam into a synchrotron for lithography experiments. This paper describes the conceptual design of the linac, its e-gun pulser, and its control and timing systems. 3 figs., ref

  5. MeV neutrinos in double beta decay

    Zuber, K.

    1996-01-01

    The effect of Majorana neutrinos in the MeV mass range on the double beta decay of various isotopes is studied on pure phenomenological arguments. By using only experimental half life data, limits on the mixing parameter $U_{eh}^2$ of the order 10$^{-7}$ can be derived. Also the possible achievements of upcoming experiments and some consequences are outlined.

  6. Microscopic local optical potentials and the nucleon–nucleus scattering at 65 MeV

    Microscopic local optical potentials from two sources were calculated by folding the numerical g-matrices over point proton and neutron RMF densities of target nuclei. The hard-core Hamada–Johnston and the soft-core Urbana v-14 local inter-nucleon potentials have been used to generate numerical g-matrices by solving Bethe–Goldstone integral equation. The calculated potentials have been used to analyze successfully both the proton and neutron differential elastic scattering and polarization data at 65 MeV over a wide mass region of targets: 12C–208Pb. Comparison of the present results with a phenomenological optical model analyzes is also presented. Mass number dependence of the mean square radii of the two microscopic potentials are in close agreement with each other as well as with empirical results. (author)

  7. Statistical fragmentation of Au projectiles at E/A=600 MeV

    The mean multiplicity of intermediate mass fragments (MIMF) produced by fragmentation of Au projectiles interacting with targets of C, Al, Cu and Pb at an incident energy of E/A = 600 MeV is compared to predictions of statistical multifragmentation and sequential evaporation models. The initial conditions for the calculations were provided by BUU simulations. In the high excitation energy regime the observed universal correlation between (MIMF) and the total charge Zbound of projectile fragments with charges Z ≥ 2 can not be reprocuced by the sequential evaporation code GEMINI. The data are well described by statistical decay calculations which assume the formation of an expanded nuclear system and a rather fast break-up. (orig.)

  8. Track nanodosimetry of 20-MeV protons at 20 nm.

    Conte, V; Colautti, P; De Nardo, L; Ferretti, A; Poggi, M; Moro, D; Lombardi, M; Tornielli, G; Grosswendt, B

    2011-02-01

    Track nanodosimetry is the theoretical and experimental research which studies the stochastic aspects of ionisation yield produced by ionising particles in nanometric target volumes, positioned at different distances from the primary particle track. The STARTRACK experimental set-up, mounted on the +50° beam line at the Tandem-Alpi particle accelerator of Legnaro National Laboratories, has been conceived to give an experimental basis to nanodosimetric calculations. STARTRACK is a detection system able to measure the ionisation cluster-size distributions in a 20 nm propane site, by counting the electrons set in motion by different ion tracks, with the resolution of one electron. The 'sensitive volume' SV can be moved at different distances from the primary particle track (different impact parameter). Distributions of 20-MeV protons have been measured and compared with Monte Carlo calculations. PMID:21127036

  9. (p,pα) cluster-knockout reaction on 9Be at 200 MeV

    The (p,pα) cluster-knockout reaction on 9Be has been investigated experimentally at a bombarding energy of 200 MeV. Coincident data were obtained at five quasifree angle pairs for proton angles ranging from 40 degree to 80 degree. The data were analyzed in terms of the distorted-wave impulse approximation. The calculated energy-sharing distributions reproduce the data reasonably well, indicating that the quasifree-knockout mechanism dominates the reaction. The factorization approximation employed in the calculation is found to be valid. The absolute spectroscopic factors derived from the data are in excellent agreement with lower-energy results, and compare well with shell-model predictions

  10. Total cross section for p-d breakup below 30 MeV

    Kievsky, A; Viviani, M

    2000-01-01

    The total cross section for p-d breakup is studied in terms of the elastic S-matrix through the unitary condition. Calculations using the complex Kohn variational method along with the Pair Correlated Hyperspherical Harmonic basis are presented. The results have been restricted to energies below Ep=30 MeV where Coulomb effects are expected to be sizable and are compared to the existing data. Two different measurements have been found in the literature: 40 years ago, Gibbons and Macklin (1959); and 26 years ago, Carlosn et al. (1973). The calculations are found to be in reasonable agreement with these old data, though a discrepancy is observed near the deuteron breakup threshold. Moreover, a detailed analysis of the contributions to the observable from different partial waves has been presented. Unexpectedly, the main contribution for a wide range of energies has been detected in the J=3/2- state.

  11. Radiative capture of polarized neutrons by polarized protons at Tn=183 MeV

    Xu, G.; Pate, S. F.; Bloch, C.; Vigdor, S. E.; Bowyer, S. M.; Bowyer, T. W.; Jacobs, W. W.; Meyer, H. O.; Pierce, E.; Sowinski, J.; Whiddon, C.; Wissink, S. W.; Jolivette, P. L.; Pickar, M. A.

    1995-12-01

    In order to provide a quantitative test of theoretical calculations incorporating meson-exchange currents and intermediate Δ resonances, we measure the normal-component spin correlation coefficient CNN, the differential cross section dσ/dΩ, and the neutron and proton analyzing powers An and Ap, each as a function of angle, for n-->p-->-->dγ at Tn=183 MeV. Our n-->p-->-->dγ results, combined with the previous cross section and photon asymmetry data collected in the past decade, place quite strong constraints on model calculations. Our data are in excellent agreement with theoretical predictions by Jaus and Woolcock that incorporate meson-exchange and isobar current effects and relativistic corrections, signifying great recent progress in our understanding of these effects in the nucleon-nucleon system.

  12. Excitation functions of the proton induced nuclear reactions on {sup nat}Zn up to 40 MeV

    Uddin, M.S. [Department of Physics, Kyungpook National University, 1370 Sankyok-dong, Buk-gu, Daegu 702-701 (Korea, Republic of); Institute of Nuclear Science and Technology, Atomic Energy Research Establishment, Savar, GPO Box No. 3787, Dhaka-1000 (Bangladesh); Khandaker, M.U. [Department of Physics, Kyungpook National University, 1370 Sankyok-dong, Buk-gu, Daegu 702-701 (Korea, Republic of); Kim, K.S. [Department of Physics, Kyungpook National University, 1370 Sankyok-dong, Buk-gu, Daegu 702-701 (Korea, Republic of); Lee, Y.S. [Department of Physics, Kyungpook National University, 1370 Sankyok-dong, Buk-gu, Daegu 702-701 (Korea, Republic of); Kim, G.N. [Department of Physics, Kyungpook National University, 1370 Sankyok-dong, Buk-gu, Daegu 702-701 (Korea, Republic of)]. E-mail: gnkim@knu.ac.kr

    2007-05-15

    We measured the excitation functions of the {sup nat}Zn(p,xn){sup 66,67}Ga, {sup nat}Zn(p,pxn){sup 62,65,69m}Zn, and {sup nat}Zn(p,{alpha}xn){sup 61}Cu nuclear processes up to 40 MeV by using a stacked-foil activation technique at the MC50 cyclotron of the Korea Institute of Radiological and Medical Sciences. The results were compared with the earlier reported experimental data and theoretical calculations based on the ALICE-IPPE code. We have given new data points for the formation of the above radionuclides. The present values are in good agreement with some well-measured literature values. Integral yields were also deduced from the measured cross-sections. The reported direct measured thick target yields for the formation of the {sup 66}Ga and {sup 67}Ga radionuclides at 22 MeV support our deduced yields. The optimum formation of the {sup 66}Ga and {sup 61}Cu radionuclides with minimum impurities can be obtained at 8-15 MeV and 10-20 MeV energy range, respectively. The yields and decay characteristics of the nuclide {sup 65}Zn are suitable for thin layer activation analysis.

  13. Excitation functions of proton induced reactions on natOs up to 65 MeV: Experiments and comparison with results from theoretical codes

    Activation of thin natOs targets, electrodeposited on Ni backings, was investigated for the first time in stacked foil irradiations with 65 MeV and 34 MeV proton beams. Assessments of the produced radionuclides by high resolution gamma-ray spectroscopy yielded excitation functions for formation of 184, 185, 186m,m+g, 187m+g, 188m+g, 189m2+m1+g, 190m2,m1+g, 192m1+gIr and 185cum, 191m+gOs, 183m+gRe. Where available comparisons with the reaction cross sections obtained in 2 earlier studies on enriched 192Os were made. Reduced uncertainty on cross sections is obtained by simultaneous remeasurement of the 27Al(p,x)22,24Na, natNi(p,x)57Ni and natTi(p,x)48V monitor reactions over wide relevant energy ranges. Confirmation of monitoring took place by assessment of excitation functions of 61Cu, 56Ni, 55,56,57,58Co and 52Mn induced in the Ni backings and comparison with a recent compilation for most of these radionuclides. Contributing reactions and overall cross sections are discussed and were evaluated in comparison with the results of the theoretical code TALYS 1.6 (values from the on-line library TENDL-2013)

  14. A comparative study of the 13C(p,p')13C and 13C(p,n)13N reactions at Ep = 35 MeV

    Differential cross sections were measured at Ep = 35 MeV for the 13C(p,n) and 13C(p,p') reactions leading to the four low-lying states in the mirror nuclei 13N and 13C. In addition, the analyzing powers were measured for the 13C(p,p') reaction. The data are generally well accounted for by DWBA calculations except for the 13C(p,p')13C(3.09 MeV, 1/2+) reaction, for which the calculations can not even reproduce the qualitative features of the data. A comparison of the (p,n) and the (p,p') results suggests that the isoscalar part of the 13C(g.s., 1/2-) → 13C(3.09 MeV, 1/2+) transition is not correctly described by currently available shell-model wave functions. (author)

  15. Study of the Three-Nucleon Force Effects in the 2H(p, n) Breakup Reaction at 170 MeV

    For the study of three nucleon force (3NF) effects in the intermediate energy region, the differential cross sections and the vector analyzing power Ay were measured for the 2H(p, n) inclusive breakup reaction at 170 MeV. The polarized proton beam of 170 MeV was injected to the deuterated polyethylene (CD2) target and the energy of scattered neutrons were deduce by TOF method. The data was compared with the results of the Faddeev calculations with and without 3NFs. Concerning about the differential cross sections, we can see large discrepancies between the data and the calculations in the region where the energies of scattered neutrons are low, which are similar to the results of the 2H(p, p) inclusive breakup reaction at 250 MeV. (author)

  16. Measurement of the 2H(p, n) Breakup Reaction at 170 MeV and the Three-Nucleon Force Effects

    The effects of three nucleon force (3NF) have been actively studied via the nucleon–deuteron (Nd) scattering states. The differential cross sections and the vector analyzing powers Ay of the 2H(p, n) inclusive breakup reaction at 170 MeV were measured for the study of 3NF effects in the intermediate energy region. The polarized proton beam of 170 MeV was injected to the deuterated polyethylene (CD2) target and the energy of scattered neutrons were measured by using TOF method. The data were compared with the Faddeev calculations based on modern nucleon–nucleon (NN) forces with and without the 3NF. Concerning the differential cross sections, we can see large discrepancies between the data and the calculations in the region of scattered neutron energies are low, which is similar to the results of the 2H(p, p) inclusive breakup reaction at 250 MeV. (author)

  17. A calculation of the physical mass of sigma meson

    J R Morones-Ibarra; Ayax Santos-Guevara

    2007-06-01

    We calculate the physical mass and the width of the sigma meson by considering that it couples in vacuum to two virtual pions. The mass is calculated by using the spectral function, and we find that it is about 600 MeV. In addition, we obtained 220 MeV as the value for the width of its spectral function. The value obtained for the mass is in good agreement with that reported in the Particle Data Book for the σ-meson, which is also named 0(600). This result also shows that -meson can be considered as a two-pion resonance.

  18. Calculation of γ shielding buildup factor for certain light concrete

    Exposure buildup factors up to 40 mean free paths in ranging from 0.015 MeV to 15 MeV photon energy were calculated by using the Monte Carlo simulation code EGS4 for light concrete used in certain nuclear power plant. The calculation took into account effect of Bremsstrahlung, fluorescence and coherent (Rayleigh) scattering on the buildup factor. Then, the corresponding fitting parameters of the G-P fitting formula were presented by the geometrical progression approximation fitting formula. The method can get the y shielding buildup factors for any shielding thickness of the concrete and any photon energy. (authors)

  19. Textual research of Wudu earthquake in 186 B.C. in Gansu Province, China and discussion on its causative structure

    YUAN Dao-yang; LEI Zhong-sheng; HE Wen-gui; XIONG Zhen; GE Wei-peng; LIU Xing-wang; LIU Bai-chi

    2007-01-01

    On the basis of the textual research on the historical earthquake data and the field investigation of Wudu earthquake occurred in 186 B.C., we suggest that the earthquake parameters drawn from the present earthquake catalogs are not definite and amendments should be made. The heavily-damaged area of this earthquake should be located between Jugan township of Wudu County and Pingding township of Zhouqu County. Its epicenter should be in the vicinity of Lianghekou in Wudu County with a magnitude of about 7~7 1/4 and an intensity of about Ⅸ~Ⅹ. The major axis direction of the heavily-damaged area should be in the WNW direction that is approximately consistent with the strike of the middle-east segment of Diebu-Bailongjiang active fault zone, and the origin time should match up to that of the latest paleoearthquake event[before (83±46) B.C.] obtained by the trench investigation.Certain seismic rupture evidences are still preserved on this fault segment. Therefore, we propose on the basis of comprehensive analysis that the causative structure of the M7~7 1/4 Wudu earthquake in 186 B.C. Should be in the middle-east segment of Diebu-Bailongjiang active fault zone.

  20. Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region

    Pigni, Marco T [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Leal, Luiz C [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-01-01

    Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten—namely, 182W(26.5%), 183W(14.31%), 184W(30.64%), and 186W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.

  1. Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region

    Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten - namely, 182W(26.5%), 183W(14.31%), 184W(30.64%), and 186W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.

  2. High-velocity collimated outflows in planetary nebulae NGC 6337, He 2-186, and K 4-47

    Corradi, R L M; Villaver, E; Mampaso, A; Perinotto, M; Schwarz, H E; Zanin, C; Corradi, Romano L.M.; Goncalves, Denise R.; Villaver, Eva; Mampaso, Antonio; Perinotto, Mario; Schwarz, Hugo E.; Zanin, Caterina

    2000-01-01

    We have obtained narrow-band images and high-resolution spectra of the planetary nebulae NGC 6337, He 2-186, and K 4-47, with the aim of investigating the relation between their main morphological components and several low-ionization features present in these nebulae. The data suggest that NGC 6337 is a bipolar PN seen almost pole on, with polar velocities higher than 200 km/s. The bright inner ring of the nebula is interpreted to be the "equatorial" density enhancement. It contains a number of low-ionization knots and outward tails that we ascribe to dynamical instabilities leading to fragmentation of the ring or transient density enhancements due to the interaction of the ionization front with previous density fluctuations in the ISM. The lobes show a pronounced point-symmetric morphology and two peculiar low-ionization filaments whose nature remains unclear. The most notable characteristic of He 2-186 is the presence of two high-velocity (higher than 135 km/s) knots from which an S-shaped lane of emission...

  3. Re-evaluation of NUPEC M-7-1 Hydrogen Experiment using MELCOR 1.8.6

    Evaluation of hydrogen distribution in containment building is still of keen interests. KINS is evaluating the hydrogen risk for the continued operation of Kori-1 and also for the new reactors like Shin-Kori-1,2, Shin Wolsong-1,2 etc. Considering these needs and also that the code used in KINS is moving from MELCOR 1.8.5 to MELCOR 1.8.6, we have evaluated the NUPEC hydrogen test M-7-1 using MELCOR 1.8.6. The NUPEC test was chosen just because it is the only available data we have. We will continue to evaluate other experimental data of hydrogen once they are available. In NUPEC's Hydrogen Mixing and Distribution Test M-7-1, steam/helium mixture was released into the lower region of a simplified 1/4 scale model of large dry containment of 4-loop PWR(fig.1) to simulate break of a steam generator (SG) system. Total helium volume was decided by volumetric scaling of hydrogen released due to 100% Zr-H2O reaction. At the same time, containment spray was also activated to simulate the impact of spray water. Test containment had 25 compartments and 66 paths, and each compartment had measuring instruments for temperature (wall/air), pressure and helium concentration

  4. Calculation of the collimated bremsstrahlung flux from thin radiators

    A method is outlined for calculating the absolute flux of a bremsstrahlung beam created by passing an electron beam through thin radiators. Multiple scattering of the electron beam in the radiator and collimation of the bremsstrahlung flux are considered in this calculation. Separate measurements determine that this calculations has an absolute accuracy of 2.8% for an endpoint energy range from 120 to 360 MeV for a total radiator thickness of less than 0.012 radiation lengths. (orig.)

  5. The Equilibrium and Pre-Equilibrium Neutron Emission Spectra of Some Deformed Target Nuclei for (p,xn) Reactions up to 22.4 MeV

    In this study, by using equilibrium and pre-equilibrium reaction mechanisms, neutron-emission spectra produced by (p,xn) reactions for some deformed target nuclei as 165Ho, 181Ta and 232Th have been calculated the bombarding energies up to 22.4 MeV. In the calculations, pre-equilibrium calculations were calculated by using new evaluated hybrid model and geometry dependent hybrid model, full exciton model and cascade exciton model. The reaction equilibrium component was calculated by Weisskopf-Ewing model. The obtained results have been discussed and compared with the available experimental data and found agreement with each other

  6. Design of RF power coupler for 5 MeV, 3 KW traveling wave electron Linac

    A 5 MeV, 3 kW, S-band (2856 MHz) traveling wave electron linear accelerator is under design and development stage at Raja Ramanna Centre for Advanced Technology, Indore. The RF power is fed to this type of linac through an input coupler at the upstream end, and propagates to the downstream end, where it exits through an output coupler. Both the input as well as output coupler consists of a coupler cavity with a coupling slot (iris), and a tapered waveguide which connects the coupling slot to the standard WR-284 waveguide coming from the klystron. In this paper, we report the electromagnetic design calculations for the tapered waveguide, and the coupling cavity with coupling slot. First, the design calculations are performed to find out the dimensions of the tapered waveguide, such that the reflection at the interface of WR-284 waveguide and the tapered waveguide is less than 1%, assuming perfectly matched layer boundary condition at the other end of the tapered waveguide connected to the iris of the coupler cavity. Then, the dimensions of the coupling iris and the coupler cavity are calculated using Kyhl's method, such that the required value of coupling coefficient and resonant frequency is achieved. Transient solver module of the computer code CST-MWS has been used for performing these calculations. RF power couplers have been fabricated with the dimensions predicted by design calculations, and the measurement of coupling coefficient and resonant frequency are in excellent agreement with design predictions. (author)

  7. Validity of Brueckner theory for the nucleon optical potential near 200 MeV

    A comparison is made of the experimental cross sections for proton scattering from 12C, 40Ca and 208Pb near 200 MeV bombarding energy with the results obtained from optical potentials calculated from Brueckner theory. We confirm the results of earlier analyses that the calculated potentials cannot reproduce the experimental data. It is shown that the calculated imaginary part of the potentials is completely satisfactory and that it is the calculated real part which leads to the discrepancy between theory and experiment. The real part is found to have the wrong radial shape, it has too extreme a 'wine bottle' shape. We show that this is a consequence of the calculated dependence of the t-matrix on the internucleon separation, in particular on the very different ranges for the attractive and repulsive parts. This is a consequence of our use of a hard-core internucleon potential and we suggest that a soft-core or momentum-dependent potential might give a better account of the experimental data. (orig.)

  8. Neutron- and proton-induced nuclear data evaluation of thorium, uranium and curium isotopes for energies up to 250 MeV

    The evaluation of neutron and proton nuclear data for thorium-232, U-233,234,236, and Cm-243,244,245,246 isotopes have been performed at energies up to 250 MeV. Neutron data was evaluated at energies from 20 MeV to 250 MeV, and combined with the JENDL-3.3 data at 20 MeV, while proton data was obtained for energies from 1 to 250 MeV. Nuclear model parameters are largely based on the IAEA-RIPL recommendation, and adjusted to better reproduce the available measurements. The coupled channel optical model was applied to calculate the total, reaction, elastic, and direct inelastic cross sections, and to obtain the transmission coefficients. Decay of excited nuclei was described with the Hauser-Feshbach and exciton models using the GNASH code to simultaneously handle neutron, proton, deuteron, triton, helium-3, α, γ emission and fissions. Special attention was paid to the fission cross sections for energies where experimental data are scant, using appropriate systematics and fittings. Particles and γ emission spectra after fission were calculated based on the statistical approach of Fong, and adjusted to the experimental data using the ALICE-ASH code. (author)

  9. Measurement and microscopic analysis of the 11B(p,p') reaction at Ep = 150 MeV. Part I: Inelastic scattering

    Cross sections and analyzing powers for the 11B(p.p') reaction have been measured using a 150 MeV polarized proton beam from the AGOR cyclotron at KVI. For the stronger inelastic transitions, also spin-flip probabilities have been extracted. A fully microscopic distorted-wave analysis of the elastic and inelastic data has been made, using density-dependent effective interactions and input from shell-model calculations in a complete (0+2) ℎω model space for normal parity transitions and in a 1 ℎω model space for non-normal parity transitions. With the help of these model calculations spin-isovector M1 strengths for the negative-parity states at excitation energies of 2.125 MeV (Jπ = 1/2-), 4.445 MeV (Jπ 5/2-), 5.020 MeV (Jπ = 3/2-) and 8.920 MeV (Jπ 5/2-) have been extracted and compared to known Gamow-Teller strengths for the analog transitions to 11C

  10. Program DDCS for nucleon and composite particle DDX of nucleon induced reactions up to tens of MeV

    DDCS is a program for calculating the neutron or proton induced reactions of medium-heavy nuclei in the incident energy range up to 50 MeV including 5 emission processes. This program is written in FORTAN-77 on microscopic computer 486. DDCS is constructed within the framework of optical model, generalized master equation of the exciton model, and the evaporation model. The effect of recoil nucleus is considered in this program. DDCS has been used to calculate reactions of n + 56Fe, n + 93Nb, P + 120Sn, P + 197Au, and P + 209Bi. Pretty good results in agreement with the experimental data were obtained

  11. Prompt neutron multiplicity distribution for 235U(n,f) at incident energies up to 20 MeV

    CHEN Yong-Jing; LIU Ting-Jin

    2011-01-01

    For the n+U fission reaction, the total excitation energy partition of the fission fragments, the average neutron kinetic energy (A) and the total average energies E(A) removed by γ rays as a function of fission fragment mass are given at incident energies up to 20 MeV. The prompt neutron multiplicity as a function of the fragment mass, ν(A), for neutron-induced fission of U at different incident neutron energies is calculated. The calculated results are checked with the total average prompt neutron multiplicities ν and compared with the experimental and evaluated data. Some prompt neutron and γ emission mechanisms are discussed.

  12. Evaluation of 242Pu data for the incident neutron energy range 5-20 MeV

    Models, procedures and parameters are presented for the calculation of neutron cross sections, the neutron angular distributions and the neutron energy distributions of 242Pu in the energy range 5-20 MeV. The interaction takes place through direct interaction and compound nucleus mechanism. For heavy deformed nucleus the direct interaction was treated with the coupled channel process, using the ECIS code. For the compound nucleus mechanism, a statistical treatment was used for fission, neutron elastic and inelastic scattering, radiative capture, (n,2n), (n,3n), (n,4n) cross section calculations, using the GNASH code. (R.P.)

  13. Theoretical Analysis of Neutron Double-Differential Cross Section of n+11B at 14.2 MeV

    ZHANG Jing-Shang

    2003-01-01

    A new reaction model for light nuclei is proposed to analyze the measured data, especially for the doubledifferential cross sections. In this paper the calculation with this model is employed to analyze measurements of the total outgoing neutron double-differential cross sections for n+11B reactions at En = 14.2 MeV. The representation of the double-differential cross sections of the second emitted particles is given in detail. The calculation results indicate that the recoil effect in light nuclear reaction is essentially important. The reaction channels are discussed in detail.

  14. Equilibrium amd direct mechanism contribution to neutron emission spectra from 56Fe nuclei at 14 MeV initial energy

    Neutron emission spectra from Fe(n, xn) reaction at 14 MeV have been analyzed, taking into account direct and equilibrium interaction mechanisms. The direct contribution to the neutron emission spectra have been calculated using the DWBA method and strong channel couplings the equilibrium contribution was described in the framework of the Hauser-Feshbach approach using the generalized model of superfluid nucleus for the level density with fitted to experiment parameters. Comparison of the calculation with experimental data shows a good agreement and sufficiency of only these two processes

  15. Quantum molecular dynamics approach to estimate spallation yield from + 208Pb reaction at 800 MeV

    P K Sarkar; Maitreyee Nandy

    2003-10-01

    The spallation yield of neutrons and other mass fragments produced in 800 MeV proton induced reaction on 208Pb have been calculated in the framework of quantum molecular dynamics (QMD) model. The energy spectra and angular distribution have been calculated. Also, multiplicity distributions of the emitted neutrons and kinetic energy carried away by them have been estimated and compared with the available experimental data. The agreement is satisfactory. A major contribution to the neutron emission comes from statistical decay of the fragments. For mass and charge distributions of spallation productsthe QMD process gives rise to target-like and projectile-like fragments only.

  16. Curium-245 and curium-247 neutron cross sections between 10 keV and 10 MeV

    The optical model code 2PLUS and the statistical model codes COMNUC and CASCADE were used to compute neutron cross sections for Cm-245 and Cm-247 between 10 keV and 10 MeV. Cross sections for elastic and inelastic scattering, radiative capture, fission, and the (n,2n) reactions were computed. The parameters for the fission model were selected to yield agreement with the cross sections from the Physics-8 bomb shot. Pu-239 cross sections were calculated and compared with existing cross section evaluations to demonstrate the validity of the calculational methods

  17. Application of the modified Newton method to the inversion of elastic 12C+12C phases at Ec.m. = 18.5 MeV

    The modified Newton method is applied to the calculation of the 12C+12C potential by using experimental elastic phases at Ec.m. = 18.5 MeV. The resulting potential reproduces the original phases and the experimental cross section. (orig.)

  18. Determination of Oxygen in Aluminum by Means of 14 MeV Neutrons with an Account of Flux Attenuation in the Sample

    This study concerns the determination of oxygen present at low levels in aluminum using the 14 MeV neutron activation technique. The sensitivity obtained amounted to 0.2 mg oxygen. Various nuclear methods for the oxygen determination have been briefly reviewed. The attenuation of fast neutrons inside the aluminum samples has been calculated

  19. Neutron capture between 5 keV and 3 MeV

    Neutron capture cross-sections over a wide range of mass number are being measured for neutron energies between about 5 keV and 3 MeV. The nuclei studied to date are 41K, 85Rb, 86Sr, 87Rb, 89Y, 98Mo, 139La, 141Pr,158Gd, 170Er, 175Lu, and 176Yb. The experimental technique used is the activation method, in which the radioactive capture product formed in the neutron bombardment is measured by beta or gamma counting, and the counters are calibrated against a 4π-beta counter. Monoenergetic neutrons are produced by bombarding lithium or tritium targets with protons from the 4-MeV Van de Graaff accelerator. The neutron intensity is measured with a fission chamber, which counts fissions in a thin deposit of 235U. The data are compared with calculations based upon the statistical model of uncorrelated and non-interfering compound nuclear states. This model, which yields the energy averages of resonant or fluctuating compound nuclear cross-sections, was first used to calculate capture cross-sections by Lane and Lynn, and has been developed further by Moldauer. The calculations take into account the variation of radiation width and level density with excitation energy and spin of the compound nucleus, and include the competition of compound elastic and inelastic scattering and the variation of neutron widths from level to level (Porter-Thomas distribution). Neutron widths were calculated from optical model transmission coefficients, with the parameters chosen according to the spherical optical model of Moldauer. Another phenomenon is considered in the calculations. If the compound state, de-exciting through a gamma-ray cascade, ends its de-excitation in a low-lying level of (Z, A + 1), the event is radiative capture, as measured experimentally. If, however, after a gamma-ray decay, the compound system is at an excitation energy above the neutron emission threshold, the gamma-ray cascade may be ended by neutron emission, and the process does not contribute to the capture

  20. Long-Range Alpha Particle Emission in the Fission of U235 by 3-MeV Neutrons

    The energy and angular distribution of long-range alpha particles emitted in the fission of U235 induced by 3-MeV neutrons have been measured. The alpha panicles were detected by solid-state detector and the fission fragments were detected by a gas scintillation counter. The neutrons were produced by the T (p, n) He3 reaction using a 5.5- MeV Van de Graaff accelerator. About 3000 fission events accompanied by the emission of a high-energy alpha panicle were recorded. The most probable energy of the alpha particles is between 15-16 MeV. and the energy distribution has a full width at half maximum of about D MeV, which is the same as observed in tliermal- neutron fission. The angular distribution of the long-range alpha panicles with respect to the incident neutron direction was found to be forward-peaked, in agreement with previous work on alpha emission in 14-MeV neutron-induced fission of LP. At angles of 0° and 90° with respect to the incident neutron direction the alpha panicles were detected with an angular spread of about ± 25°. The anisotropy [Nα(0°)/ Nα(90°)] was found to be 1.320 ± 0.12. This value is in agreement with the anisotropy calculated on the basis of statistical evaporation of panicles. The results of the present investigation are consistent with the hypothesis that the emission of long-range alpha panicles in fission is an evaporation process. The implications of the results of this work and of other recent investigations on long-range alpha emission are discussed. (author)

  1. High resolution 12C(γ,p) experiments at Eγ ≅ 25-75 MeV

    Absolute differential cross sections for the 12C(γ,p)11B reaction have been measured over proton detection angels ranging from 30 to 150 deg, using tagged photons of 25-75 MeV energy, for low-lying regions of residual excitation energy in 11B. Four experiments were performed at the MAX laboratory in Lund in order to provide data. Previously reported cross sections for the reaction had systematic uncertainties of a magnitude which made them agree, in spite of a large spread in absolute values. The cross sections reported, with a systematic uncertainty of 8%, remove previous ambiguities for Eγ=40-75 MeV. A reinterpretation of the states excited in11B at E about 7 MeV is also presented. The data are compared with quasi-elastic (e,e'p) results in PWIA in the same recoil momentum range. It is found that the momentum distributions do not scale for the two reaction types. Furthermore, the data are compared with the results for the inverse reaction (p,γ) in the centre-of-momentum system by detailed balance. The comparison with respect to missing momentum indicates an angular dependence in the (γ,p) reaction which is not present in the inverse (p,γ) reaction. Recent results from the MAX laboratory for the (γ,n) reaction are compared to the (γ,p) results. The mirror nuclei 11C and 11B have almost identical excitation energy spectra at Eγ=60 MeV. It is concluded that HF-RPA calculations with essential contributions of meson exchange currents provide a qualitative description of the angular distributions obtained for the (γ,p) reaction. An extension of the spherical symmetric basis for the wave function is suggested for the states at E about 7 MeV in 11B. 108 refs, 83 figs

  2. Microscopic optical model calculations and uncertainty estimates

    Full text: The optical model is a basic ingredient of almost all reaction calculations. Therefore, a great effort has been devoted to its microscopic determination. Among the various attempts the nuclear matter approach with its various facets works surprisingly well even at low energies about 20 MeV. In the present contribution a comparison of elastic differential and integral cross sections and polarization data with theoretical results is given for structure materials. Possible procedures for assigning uncertainties to calculated observables are discussed. (author)

  3. Determination of the neutron capture cross sections of 232Th at 14.1 MeV and 14.8 MeV using the neutron activation method

    Lan, Chang-Lin; Peng, Meng; Lv, Tao; Yao, Ze-en; Chen, Jin-Gen; Kong, Xiang-Zhong

    2016-01-01

    The 232Th(n,{\\gamma})233Th neutron capture reaction cross sections were measured at average neutron energies of 14.1 MeV and 14.8 MeV using the activation method. The neutron flux was determined using the monitor reaction 27Al(n,{\\alpha})24Na. The induced gamma-ray activities were measured using a low background gamma ray spectrometer equipped with a high resolution HPGe detector. The experimentally determined cross sections were compared with the literatures data, evaluated data of ENDF/B-VII, JENDL-4.0, and CENDL-3.1. The Excitation functions of 232Th(n,{\\gamma}) reaction were also calculated theoretically using the TALYS 1.6 computer code.

  4. SU-E-T-186: Feasibility Study of Glass Cherenkov Detector for Prompt Gamma Detection in Proton Therapy

    Purpose: To simulate a Cherenkov glass detector system utilizing prompt gamma (PG) technique to quantify range uncertainties in proton radiation therapy. Methods: A simulation of high energy photons typically produced in proton interactions with materials incident onto a block of Cherenkov glass was performed with the Geant4 toolkit. The standard electromagnetic package was used along with several decay modules (G4Decay, G4DecayPhysics, and G4RadioactiveDecayPhysics) and the optical photon components (G4OpticalPhysics). Our setup included a pencil beam consisting of a hundred thousand 6 MeV photons (approximately the deexcitation energy released from 16O) incident onto a 2.5 ⊗ 2.5 ⊗ 1.5 cm3 of a Cherenkov glass (7.2 g of In2O3 + 90 g cladding, density of 2.82 g/cm3, Zeff = 33.7, index of refraction 1.56). The energy deposited from incident 6 MeV photons as well as secondary electrons and resulting optical photons were recorded. Results: The energy deposited by 6 MeV photons in glass material showed several peaks that included the photoelectric, the single and double escape peaks. About 11% of incident photons interacted with glass material to deposit energy. Most of the photons collected were in the region of double escape peak (approximately 4.98 MeV). The secondary electron spectrum produced from incident photons showed a high energy peak located near 6 MeV and a sharp peak located ∼120 keV with a continuous distribution between these two points. The resulting Cherenkov photons produced showed a continuous energy distribution between 2 and 5 eV with a slight increase in yield beginning about 3 eV. The amount of Cherenkov photons produced per interacting incident 6 MeV photon was ∼240.7. Conclusion: This study suggests the viability of utilizing the Cherenkov glass material as a possible prompt gamma photon detection device. Future work will include optimization of the detector system to maximize photon detection efficiency

  5. Operating experience of 10 MeV industrial linac

    For the past three years, an Industrial 10 MeV RF Electron linac has been in operation at Electron Beam Centre, Navi Mumbai. This pulsed linac has an on-axis coupled cavity bi-periodic π/2 structure and operates at frequency of 2856 MHz. The linac has been tested up to a maximum beam power of 5 kW and is being used for industrial applications. A successful 24-hour continuous run, at 3 kW, established the long term stability of all the linac parameters. This paper describes the high power operating experience of the 10 MeV linac. Details of RF conditioning and performance of the linac during long term tests is presented. Effect of various linac parameters, including injection voltage, RF input power, PRF, gun filament heating power, on the output beam power and energy has been discussed. (author)

  6. Upgrade of the Brookhaven 200 MeV linac

    The Brookhaven 200 MeV linac serves as the injector for the AGS Booster, as well as delivering beam to the Biomedical Isotope Resource Center. During the past year, many linac systems have been upgraded to allow operation at 2.5 times higher average current (150 μA). This was achieved by an increase in rep-rate from 5 to 7.5 Hz, an increase in beam current from 25 mA to 37 mA, and a slight increase in pulse width to ∼530 μs. Additional upgrades were made to improve reliability and modernize old systems. This paper describes improvements made in the 35 keV and 750 keV beam transport, 200 MeV beam transport, rf transmission line, rf power supplies, control systems, and instrumentation

  7. Femtosecond Time-resolved MeV Electron Diffraction

    Zhu, Pengfei; Cao, J; Geck, J; Hidaka, Y; Kraus, R; Pjerov, S; Shen, Y; Tobey, R I; Zhu, Y; Hill, J P; Wang, X J

    2013-01-01

    We report the experimental demonstration of electron diffraction with 130 femtosecond time resolution using bench-top MeV electron beams. High-quality, single-shot electron diffraction patterns for both polycrystalline aluminium and single-crystal 1T-TaS_{2} are obtained utilizing a 5 femto-Coulomb (~3x10^{4} electrons) pulse of electrons at 2.8 MeV. The timing jitter between the pump laser and probe electron beam was found to be ~ 100 fs. The time resolution is demonstrated by observing the evolution of Bragg and superlattice peaks of 1T-TaS_{2} following an optical pump. Our experiemntal results demonstrate the feasibility of ultimately realizing 40 fs time-resolved electron diffraction.

  8. Magnifying lens for 800 MeV proton radiography

    This article describes the design and performance of a magnifying magnetic-lens system designed, built, and commissioned at the Los Alamos National Laboratory (LANL) for 800 MeV flash proton radiography. The technique of flash proton radiography has been developed at LANL to study material properties under dynamic loading conditions through the analysis of time sequences of proton radiographs. The requirements of this growing experimental program have resulted in the need for improvements in spatial radiographic resolution. To meet these needs, a new magnetic lens system, consisting of four permanent magnet quadrupoles, has been developed. This new lens system was designed to reduce the second order chromatic aberrations, the dominant source of image blur in 800 MeV proton radiography, as well as magnifying the image to reduce the blur contribution from the detector and camera systems. The recently commissioned lens system performed as designed, providing nearly a factor of three improvement in radiographic resolution.

  9. Initial Test of the PEFP 20MeV DTL

    Kim, Han-Sung; Han, Sang-Hyo; Hwang, Yong-Suk; Jang, Ji-Ho; Kim, Yong-Hwan; Kwon, Hyeok-Jung; Park, Mi-Young; Tae Seol, Kyung

    2005-01-01

    A conventional 20MeV drift tube linac (DTL) for the Proton Engineering Frontier Project (PEFP) has been developed as a low energy section of 100MeV accelerator. The machine consists of four tanks with 152 cells supplied with 900kW RF power from 350MHz klystron through the ridge-loaded waveguide coupler. We assembled the fabricated accelerator components and aligned each part with care. We have also prepared the subsystems for the test of the DTL such as RF power delivery system, high voltage DC power supply, vacuum system, cooling system, measurements and control system and so on. The detailed description of the initial test setup and preliminary test results will be given in this paper.

  10. MeV electron populations as measured on DMSP

    A dosimeter flown on the DMSP F7 spacecraft during solar minimum from January 1984 through October 1987 measured electron fluxes and dose behind four different dome thicknesses. The spacecraft was in an 840 km, circular, polar orbit with a 101 minute orbit period. Using sophisticated display and analysis software developed for the CRRES program, the DMSP data base was re-examined. Displays of the data set uncovered previously unseen phenomena to include > 2.5 MeV electron penetrations to low magnetic latitudes during magnetospheric storm periods. During three periods (1 August 1984, 8--9 February 1986 and 12 September 1986) the > 2.5 MeV electrons were measured penetrating all the way to the magnetic equator. This is the first known report of these particles at the magnetic equator at 840 km. The particle penetrations occurred during periods of high magnetic activity as indicated by Kp and other indices

  11. XRD study of yttria stabilized zirconia irradiated with 7.3 MeV Fe, 10 MeV I, 16 MeV Au, 200 MeV Xe and 2.2 GeV Au ions

    Nakano, K.; Yoshizaki, H.; Saitoh, Y.; Ishikawa, N.; Iwase, A.

    2016-03-01

    To simulate energetic neutron irradiation effects, yttria-stabilized zirconia (YSZ) which is one of the major materials for electrical corrosion potential sensors (ECP sensors) was irradiated with heavy ions at energies ranging from 7.3 MeV to 2.2 GeV. Ion irradiation effects on the lattice structure were analyzed using the X-ray diffraction (XRD). The increase in lattice constant was induced by the ion irradiation. It was dominated by the elastic collision process and not by the electronic excitation process. The lattice disordering which was observed as a broadening of XRD peaks was also induced by the irradiation especially for 200 MeV Xe ion irradiation. The present result suggests that the expansion and/or the disordering of YSZ lattice induced by energetic neutrons may affect the durability of a joint interface between a metal housing and YSZ membrane for the usage of ECP sensors in nuclear power reactors.

  12. Interplay of the elastic and inelastic channels in the 16O+27Al scattering at Elab = 280 MeV

    Cappuzzello, F.; Nicolosi, D.; Linares, R.; Oliveira, J. R. B.; Lubian, J.; Agodi, C.; Carbone, D.; Cavallaro, M.; de Faria, P. N.; Foti, A.; Rodrigues, M. R. D.

    2016-06-01

    Recent data indicated a nuclear rainbow-like pattern in the elastic scattering of 16O + 27Al at E_{lab}=100 MeV that arises from couplings of the ground to the low-lying states of the 27Al nucleus. Similar effect was identified in the elastic angular distribution of 16O + 12C at E_{lab}=281 and 330 MeV. These experiments show a crucial role of microscopic details of nuclear structure in the elastic scattering of heavy ions at energies well above the Coulomb barrier. In this work we investigate the 16O + 27Al system at E_{lab}=280 MeV for which a coupled channel calculation predicts a pronounced nuclear rainbow-like structure. Obtained experimental data show evidences of an important coupling of the elastic channel to the inelastic. Coupled channel calculations reproduce the experimental angular distributions when a re-normalization factor on the real part of the optical potential is introduced. A proper theoretical approach still requires a high degree of accuracy for the nuclear structure models and new tools to deal with collective excitations.

  13. Elastic and inelastic scattering of polarized protons from carbon-12 at 400, 600, and 700 MeV

    Good resolution cross section and analyzing power (p vector, p') data for many states in 12C up to an excitation energy of 21 MeV and spanning a momentum transfer range of 0.3 to 2.1 fm-1 were obtained using the High Resolution Spectrometer at the Clinton P. Anderson Meson Physics Facility at incident beam energies of 398, 597, and 698 MeV. Optical model potentials were obtained from the elastic scattering data. Inelastic data were analyzed in the Distorted Wave Impulse Approximation using the Love-Franey effective nucleon-nucleon interaction. The energy dependent isoscalar natural parity cross sections were underestimated, while phase difficulties were encountered in fitting analyzing powers. The energy independent isovector natural parity cross sections were reasonably reproduced, but analyzing powers were not, the calculations yielding positive trends whereas the data are of opposite sign. The energy independent isoscalar and isovector unnatural parity cross sections were quite well reproduced up to moderate momentum transfers, and striking successes were observed for some analyzing power data. Systematics of energy dependence together with the results of the DWIA calculations permitted the assignment of spin, parity and isospin quantum numbers to states in the 18-21 MeV excitation region. 64 references

  14. Measurement and analysis of leakage neutron spectrum from a spherical pile of silicon with incident 14 MeV neutrons

    Absolute leakage neutron spectrum in the energy range between 0.1 and 15 MeV from a silicon spherical pile of 60-cm diameter was measured using an intense 14 MeV pulsed neutron source. OKTAVIAN, for the purpose of the benchmark validation of the nuclear data of silicon in JENDL-3.2, JENDL-3.3, ENDF/B-VI (release 2), ENDF/B-VI (release 5) and EFF-2.4. The neutron spectrum was compared with the calculated results using MCNP with different nuclear data. For estimating sensitivity of the individual cross section, the calculations were also performed using modified JENDL-3.2 based data libraries. It was found that the all nuclear data could predict the measured spectrum with the measurement fairly well. ENDF/B-VI (release 2) gave considerably large discrepancy over the whole energy region presumably caused by the inadequate inelastic scattering cross section values. The discrepancy found in the JENDL-3.2, JENDL-3.3 and EFF-2.4 between 5 and 10 MeV could be attributed to the too low values of the discrete inelastic scattering cross section values. The prediction with ENDF/B-VI (release 5) was almost satisfactory over whole energy region. (author)

  15. Evolution of the 400 MeV linac design

    MacLachlan, J.A.

    1987-11-09

    The basic premises of the conceptual design for the linac upgrade are pursued to establish lengths, gradients, power dissipation, etc., for the 400 MeV linac and matching section. The discussion is limited to accelerating and focusing components. Wherever values depend on the choice of the accelerating structure, the disk-and-washer structure is emphasized; the results are generally relevant to the side coupled cavity choice also.

  16. Construction of 35 MeV DSM at Nihon University

    High quality electron beam is needed for the excitation of the free electron laser(FEL). Construction of the 35 MeV double-sided microtron for the FEL has been started at 1984. This accelerator will feed a electron beam which has narrow energy width and low emittance. A first one turn beam line has been completed. Beam accelerating experiments and high power microwave tests are performed. (author)

  17. Scanning magnet power supply for 10 MeV linac

    The 10 MeV/10 kW RF Linac, coming up at Radiation Processing Facility, Indore; requires a variable frequency and variable amplitude saw-tooth current source for its scanning magnet. In this paper, development of a power supply, which is capable of generating a bipolar saw-tooth current wave up to ±10 A at a frequency, ranging from 0.5 Hz to 50 Hz, is presented. (author)

  18. Construction of a pulsed MeV positron beam line

    Masuno, Shin-ichi; Okada, Sohei; Kawasuso, Atsuo [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    1997-03-01

    To develop a fast (1 MeV) and short pulsed (100 ps) positron beam which enables defect behavior analysis of bulk states of materials even at high temperatures where a usual positron source would melt, we have been performing design study and construction of the beam line in a three-year program since 1994. This report describes the components, design study results and experimental results of the completed parts until now. (author)

  19. Radiation sterilization by 10 MeV electron beams

    Gamma-ray sterilization by 60Co source has been already popular in Japan. Many Kinds of medical plastic devices such as catheters, disposable syringes, dializers etc, has been irradiated at 60Co irradiation facilities instead of the conventional ethylene oxide fumigation method. On the other hand, improvement of the quality of electron accelerators has made it easier to take advantage of relatively high energy electrons which are profitable for radiation sterilization because of their high dose rate saving process hours and easiness of source handling and radiation control. So electron-beam sterilization is now under investigation in Japan and, partly, it will be practiced in the near future. Yet few data are available in the present situation. Especially for high energy electron beams near 10 MeV, more data are necessary for practical application of electron-beam sterilization. Therefore, in this study, sensitivity of Bacillus pumilus E601, the biological standard of radiation sterilization, was examined using 10 MeV electron beams from linear accelerator and sterility of the beams was also checked at each depth of plastic boards in order to get basic information for determination of sterility dose. Endospores from B. pumilus were dried on filter papers (Toyo No.1) and irradiated by 10 MeV electron beams of 60Co gamma-rays. The survival curves were shown in Fig. 1. The D values were obtained as 1.9 kGy ± 0.2 for electron beams and 1.7 kGy ± 0.1 for 60Co gamma-rays, both of which were similar. Electron beams could sterilize the endospores nearly uniformly till 3 cm depth of plastic boards at 10 MeV (Fig. 2,3). This indicates a possibility to sterilize relatively bulky products such as dializers etc. (author)

  20. Neutron inelastic scattering in silicon-28 to 4.15 MeV

    The absolute 125-deg differential gamma-ray production cross section for the 1780-keV transition in the 28Si(n,n'γ)28Si reaction was measured from 1.96- to 4.15-MeV bombarding energy. This transition represents the decay of the 2+ first excited state to the 0+ ground state of 28Si. The data were corrected for neutron multiple scattering as well as neutron and gamma-ray attenuation in the sample. The angle-integrated neutron scattering cross section was inferred from the gamma-ray production data using the shape of the gamma-ray angular distributions obtained from compound nucleus statistical model calculations. Incident neutrons were produced via the 3H(p,n)3He reaction using a target approx. 100 keV thick for 3.5-MeV protons, and this energy spread is reflected in the structure observed in the cross section. 16 references

  1. Full distribution of dipole states below 9MeV in 76Se

    Cooper, N.; Werner, V.; Smith, M. K.; Goddard, P. M.; Reichel, F.; Beller, J.; Fritzsche, M.; Pietralla, N.; Romig, C.; Savran, D.; Scheck, M.; Sonnabend, K.; Wagner, J.; Chakraborty, A.; Crider, B. P.; Peters, E.; Yates, S. W.; Kelly, J.; Raut, R.; Rusev, G.; Tonchev, A. P.; Tornow, W.; Deleanu, D.; Filipescu, D.; Glodariu, T.

    2011-10-01

    Systematics of photoexcitation strength near the particle emission threshold has been of great interest in recent years due its importance in stellar nucleosynthesis of certain heavy nuclei. Theories such as the QRPA and its variants are currently used to calculate photoexcitation strength in this energy region, as well as the nuclear matrix element of the hypothetical 0 ν 2 β -decay modes, such as 76Ge -->76Se + 2e- . Dipole states between 2 and 4MeV in 76Se have been studied using linearly polarized, nearly monoenergetic photons produced by Compton-backscattering at the HI γ --> S facility. The experiment completes a series of photon scattering experiments performed on this nucleus in the energy region below 9MeV, both at the S-DALINAC and at HI γ --> S. Collective dipole excitations are investigated. Supported by U.S. DOE grant nos. DE-FG02-91ER40609 and DE-FG02-97ER41033, and NSF grant no. PHY-0956310.

  2. Detectable MeV neutrinos from black hole neutrino-dominated accretion flows

    Liu, Tong; Ma, Ren-Yi; Xue, Li

    2015-01-01

    Neutrino-dominated accretion flows (NDAFs) around rotating stellar-mass black holes (BHs) have been theorized as the central engine of relativistic jets launched in massive star core collapse events or compact star mergers. In this work, we calculate the electron neutrino/anti-neutrino spectra of NDAFs by fully taking into account the general relativistic effects, and investigate the effects of viewing angle, BH spin, and mass accretion rate on the results. We show that even though a typical NDAF has a neutrino luminosity lower than that of a typical supernova, it can reach $10^{50}-10^{51}~{\\rm erg~s^{-1}}$ peaking at $\\sim 10$ MeV, making them potentially detectable with the upcoming sensitive MeV neutrino detectors if they are close enough to Earth. Based on the event rate of NDAFs in the local universe, we estimate a detection rate up to $\\sim$ 5 per century by the Hyper-Kamiokande detector. Detecting one such event would establish the observational evidence of NDAFs in the universe.

  3. A study of isospin symmetry breaking in carbon 12 with 50 MeV pions

    In the first experiment to use the superconducting RF cavity at LAMPF known as the Scruncher, cross sections have been measured for the 1+ doublet in 12C by 50 MeV πr± scattering. The cross section ratio of the isoscalar to the isovector states was found to be 6.8 ± 1.3 for π++ scattering and 3.9 ± 1.4 for π- scattering. These ratios give an isospin mixing matrix element H01, of 119 ± 40 key, in good agreement with the average value of 123 ± 26 key deduced from previous pion-scattering data and with values deduced from other probes. The ratio of π+ + p to π- + p cross sections was determined experimentally to be 2.60 ± 0.11, in agreement with a theoretical value of 2.85. The agreement of these results indicates that the impulse approximation is valid at 50 MeV. Cross sections were also measured for the elastic and collective states in 12C and were generally described well by distorted wave Born approximation calculations published previously

  4. Multiple scattering effects of MeV electrons in very thick amorphous specimens

    Multiple scattering has an important influence on the analysis of microns-thick specimens with MeV electrons. In this paper, we report on effects of multiple scattering of MeV electrons on electron transmission and imaging of tilted and thick amorphous film specimens by experiment and theoretical analysis. Electron transmission for microns-thick epoxy-resin and SiO2 specimens calculated by the multiple elastic-scattering theory is in good agreement with measurements in the ultrahigh voltage electron microscope (ultra-HVEM) at Osaka University. Electron transmission and electron energy are then presented in an approximate power law. The bright-field ultra-HVEM images of gold particles on the top or bottom surfaces of 5 and 15 μm thick specimens further illustrate the effect of multiple scattering on image quality. The observed top-bottom effect for the very thick specimens appears to be mainly caused by multiple elastic scattering. With increase in the accelerating voltage from 1 to 2 MV, image blurring, contrast, the signal-to-noise ratio, and the top-bottom effect are improved because of reduction in the influence of multiple scattering. However, the effect of specimen thickness on image blurring is shown to be stronger than that of accelerating voltage. At the 2 MV accelerating voltage, the 100 nm gold particle can be imaged with less blurring of ∼4 nm when located at the bottom surface of a 15 μm thick epoxy-resin specimen.

  5. Proton inelastic mean free path in a group of bioorganic compounds and water in 0.05-10 MeV range - Including higher-order corrections

    Tan Zhenyu, E-mail: tzy@sdu.edu.c [School of Electrical Engineering, Shandong University, Jinan 250061, Shandong (China); Xia Yueyuan; Zhao Mingwen; Liu Xiangdong [School of Physics, Shandong University, Jinan 250100, Shandong (China)

    2010-07-15

    The systematic calculations of the inelastic mean free paths (MFP) of 0.05-10 MeV protons in a group of eleven important bioorganic compounds, i.e. DNA, five bases, three fatty acids, cellulose and {beta}-carotene, have been performed. The expressions for the calculations are derived from the Ashley's optical-data model and from the higher-order correction terms in stopping power calculations. Especially, the Bloch correction for the inelastic MFP is proposed empirically in this work. The inelastic MFPs for energetic protons in water are also evaluated and compared with other theoretical calculations. The proton inelastic MFPs for these 11 bioorganic compounds in the energy range from 0.05 to 10 MeV are presented here for the first time, and might be useful for studies of various radiation effects in these materials.

  6. MeV ion processing applications for industry

    Ions beams with MeV energies produce a variety of interactions with matter, broadly classified as either electronic or nuclear. These interactions in turn lead to changes in the properties of the matter which may be beneficial or detrimental. In high technology industry, use is increasingly made of ion beam technologies to process novel materials. Typical applications include high energy implantation, in which the deposition of a specific element at depth within the structure of material is the required objective, and irradiation modification, in which the balance between the beneficial and the detrimental effects of the fast ion interactions is exploited. The basic principles behind MeV ion processing are described. Broad areas of application in industrial materials include effects in ion beam analysis, Thin Layer Activation for wear and corrosion measurement, carrier lifetime control in electronic devices, and the simulation of radiation damage effects in, for example, solar cells for spacecraft. New development areas are described in which subtle but potentially significant changes in the chemistry of surfaces and interfaces may be generated by exposure to MeV ion beams. (orig.)

  7. Tank 241-T-112, cores 185 and 186 analytical results for the final report

    This document is the analytical laboratory report for tank 241-T-112 push mode core segments collected between February 26, 1997 and March 19, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-T-112 Push Mode Core Samplings and Analysis Plan (TSAP) and the Safety Screening Data Quality Objective (DQO). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding and are not considered in this report

  8. Tank 241-T-112, cores 185 and 186 analytical results for the final report

    Steen, F.H.

    1997-06-03

    This document is the analytical laboratory report for tank 241-T-112 push mode core segments collected between February 26, 1997 and March 19, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-T-112 Push Mode Core Samplings and Analysis Plan (TSAP) and the Safety Screening Data Quality Objective (DQO). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding and are not considered in this report.

  9. Nucleon-induced reactions at intermediate energies: new data at 96 MeV and theoretical status

    Blideanu, V.; Lecolley, F.R.; Lecolley, J.F.; Lefort, T.; Marie, N.; Ban, G.; Louvel, M. [Caen Univ., Lab. de Physique Corpusculaire, ENSICAEN, IN2P3-CNRS ISMRA, 14 (France); Atac, A.; Bergenwall, B.; Blomgren, J.; Dangtip, S.; Hildebrand, A.; Hohansson, C.; Klug, J.; Nilsson, L.; Ollson, N.; Pomp, S.; Tippawan, U.; Osterlund, M. [Uppsala Univ., Nykoeping (Sweden). Dept. of Neutron Research; Tippawan, U. [Chiang Mai University, Fast Neutron Research Facility (Thailand); Elmgren, K.; Olsson, N. [Swedish Defense Research Agency, Stokholm (Sweden); Eudes, Ph.; Guertin, A.; Haddad, F.; Kirchner, T.; Lebrun, C.; Riviere, G. [Nantes Univ., Subatech, 44 (France); Foucher, Y. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Jonsson, O.; Prokofiev, A.V.; Renberg, P.U. [Uppsala Univ., Svedberg Laboratory (Sweden); Kerveno, M.; Stuttge, L. [IReS, Strasbourg (France); Le Brun, Ch. [Laboratoire de Physique Subatomique et de Cosmologie, 38 - Grenoble (France); Nadel-Turonski, P. [Uppsala Univ. (Sweden). Dept. of Radiation Sciences; Slypen, I. [Universite Catholique de Louvain (UCL), Institut de Physique Nucleaire, Louvain-la-Neuve (Belgium)

    2004-04-01

    Double-differential cross sections for light charged particle production (up to A = 4) were measured in 96 MeV neutron-induced reactions, at TSL laboratory cyclotron in Uppsala (Sweden). Measurements for three targets, Fe, Pb, and U, were performed using two independent devices, SCANDAL and MEDLEY. The data were recorded with low energy thresholds and for a wide annular range (20 - 160 degrees). The normalization procedure used to extract the cross sections is based on the np elastic scattering reaction that we measured and for which we present experimental results. A good control of the systematic uncertainties affecting the results is achieved. Calculations using the exciton model are reported. Two different theoretical approaches proposed to improve its predictive power regarding the complex particle emission are tested. The capabilities of each approach is illustrated by comparison with the 96 MeV data that we measured, and with other experimental results available in the literature. (authors)

  10. Nucleon-induced reactions at intermediate energies: new data at 96 MeV and theoretical status

    Double-differential cross sections for light charged particle production (up to A = 4) were measured in 96 MeV neutron-induced reactions, at TSL laboratory cyclotron in Uppsala (Sweden). Measurements for three targets, Fe, Pb, and U, were performed using two independent devices, SCANDAL and MEDLEY. The data were recorded with low energy thresholds and for a wide annular range (20 - 160 degrees). The normalization procedure used to extract the cross sections is based on the np elastic scattering reaction that we measured and for which we present experimental results. A good control of the systematic uncertainties affecting the results is achieved. Calculations using the exciton model are reported. Two different theoretical approaches proposed to improve its predictive power regarding the complex particle emission are tested. The capabilities of each approach is illustrated by comparison with the 96 MeV data that we measured, and with other experimental results available in the literature. (authors)

  11. Measurement of spectra of high-energy protons generated in the shielding of a 680 MeV synchrocyclotron

    Until very recently, no experimental information on spectra of high-energy protons generated in the shielding of accelerators has been available in the literature. Such information is necessary not only to establish the degree of radiation risk due to this field component, but also to check the methods of calculating the shielding and determining the degree of adequacy of the readings of dosimeters to the equivalent dose in the radiation fields behind the shielding of accelerators. The spectra of protons escaping from the shielding of the synchrocyclotron of the Laboratory of Nuclear Problems, Joint Institute for Nuclear Research, were measured along the normal to the shielding with a spectrometer constructed for proton spectra between 55 and 500 MeV. The measured spectra of protons emitted from shielding of the 680 MeV synchrocyclotron are presented

  12. Feasibility study of installing a thermal to 14 MeV neutron converter into a research nuclear reactor

    A deuterium-tritium (DT) based thermal-to-fast neutron converter will be installed into the TRIGA reactor at Jozef Stefan Institute. This paper presents preliminary results of a feasibility study where different aspects have been addressed. The thermal column is the most appropriate irradiation position for the DT converter in the reactor. From potential active converter materials, LiD yields the most 14 MeV neutrons. Lithium enrichment affects the required thickness of the active converter material, but not significantly the 14 MeV neutron yield. For coupled neutron-tritium transport calculations, the modified MCUNED code was used. Relevant DT neutron activation monitor materials for spectrum unfolding have been identified and neutron flux criteria established. (author)

  13. Long-term outcomes in haemophilic synovitis after radiosynovectomy using rhenium-186: a single-centre experience.

    Zulfikar, B; Turkmen, C; Kilicoglu, O; Dikici, F; Bezgal, F; Gorgun, O; Taser, O

    2013-03-01

    Radiosynovectomy has been performed successfully for more than 10 years in our hospital. This study investigated the long-term outcome in the context of time to progression (TTP) analysis and the factors influencing TTP following radiosynovectomy with Re-186 in patients with haemophilic synovitis. Radiosynovectomy performed in 165 joints (81 elbows, 74 ankles, 8 shoulder and 2 hip joints) of 106 patients (median age was 18.0 ± 7.5 years; 91 haemophilia A, 13 haemophilia B and 2 von Willebrand's disease between June 2001 and July 2011. The mean follow-up was 48 months (range: 9-120 months). This study revealed that patients' mean TTP after primary radiosynovectomy was satisfactory for both the ankle and elbow joints. There was no TTP differences between the ankle and elbow joint groups (67 vs. 72 months respectively; P = 0.22). We did not find a relationship between the TTP and the following variables: age, type and severity of haemophilia, the presence or absence of inhibitor, the radiological score, range of motion (ROM) status of joints and the pretreatment bleeding frequency. In this study, 18-20% of the treated joints had improved ROM and 82-79% of the treated joints had unchanged ROM after treatment both the ankle and elbow joints respectively. In this report including TTP analysis in the largest series with long-term follow-up, we demonstrated long-term effectiveness of Re-186 radiosynovectomy in haemophilic synovitis. In our experience, the main predictor of outcome following radiosynovectomy is the number of joint bleeding within 6 months after therapy. PMID:23171307

  14. Energy dependence of volume integral and mean square radii (MSR) for elastic scattering of neutrons from 40Ca at 65 - 225 MeV

    We describe our results for the calculated neutron-nucleus optical potential in the energy region 65-200 MeV for the scattering of neutrons from 40Ca, in first order Brueckner theory, using both the Urbana v -14 soft-core and Hamada - Johnston (HJ) hard-core interactions. The corresponding results are denoted by UB and HJ respectively. We have made a systematic study of energy dependence of Mean Square Radii and the volume integrals of the Optical model potentials. We have also used Hamada-Johnston realistic interaction for n- 40Ca in the energy region 65 to 225 MeV

  15. Measurements of the Fe-54 (n,p) Mn-54 Reaction Cross Section in the Neutron Energy Range 2.3-3.8 MeV

    We have measured the 54Fe (n, p) 54Mn reaction cross section using a surface barrier detector to record the number of protons released in the reaction. The neutron flux was determined by means of a hydrogenous radiator, detecting the scattered protons with the solid state detector, and calculating the number of impinging neutrons from the well known n-p scattering cross section. The 54Fe (n, p) 54Mn reaction cross section is found to increase from 25 mb at 2.3 MeV to 208 mb at 3.5 MeV

  16. Determination of 55Mn(n,γ) reaction cross-section at the neutron energies of 1.12 and 2.12 MeV

    In the present work, we determine the 55Mn(n,γ)56Mn reaction cross-section at the neutron energies of 1.12 and 2.12 MeV by using the off-line γ-ray spectrometric technique. The (n,γ) reaction cross-section 55Mn as a function of neutron energy was also calculated using nuclear reaction modular code TALYS-1.6 and compared with the present experimental data at 1.12 and 2.12 MeV as well as the literature data at other neutron energies

  17. Experiment and theory for the reaction 7Li(γ,t)4He for E/sub γ/<50 MeV

    Differential and total cross sections for the 7Li(γ,t)4He reaction were measured. Both real and virtual photons were used in the experiment and gave self-consistent results. The data show a broad resonance indicating the presence of positive parity states near 8 MeV excitation in 7Li. A calculation using an α-3H cluster model of 7Li was also performed. Poor agreement is found between the calculation and experimental results

  18. The H(n,n) cross section in the 20 MeV to 350 MeV range

    The differential H(n,n) cross section has been used as a standard relative to which other neutron emission cross sections, e.g., elastic or inelastic scattering, have been measured in several Mev region and these measured values are compared with the VL40 solution of R. Arndt, and R.L. Workman, Nuclear Data Standards for Nuclear Measurements, H. Conde (ed.). NEANDC-311, INDC (SEC)-101, 1992, p. 17. For hydrogen, the differential elastic scattering cross section can be directly related to the total cross section, since no other channels of importance are open below the pion production threshold at about 280 MeV (the capture and Bremsstrahlung cross section are very small). 16 refs, 3 figs

  19. The disintegration of nuclei in violent heavy ion interactions at 55 A MeV-110 A MeV

    High multiplicity 12C induced reactions in Ag(Br) at energies between 55 A MeV and 110 A MeV have been selected and investigated event by event in nuclear emulsions. Only a fraction of these events can possibly be described in terms of a normal thermal spectator-participant mechanism. Several events exhibit a violent breakup into several light and medium-mass fragments. A strong suppression of projectile associated proton- and composite particle emission in the forward direction is found in comparison with inclusive spectra. A large part of the low energy protons originates from a very slow source, with a velocity comparable to that of the heaviest fragment. The parallel fraction of the C.m. energy in each event, which is governed by the more energetic protons, has a broad distribution with a mean value of 0.61 and thus with no signals of collective production mechanisms. (orig.)

  20. Gamma-ray production cross sections for MeV neutrons

    Gamma-ray production cross section and spectra for 1- to 20-MeV neutrons were theoretically obtained, which were requested for heating calculations, for shielding design calculations, and for material damage estimates. Calculations were carried out for Al, Si, Ca, Fe, Ni, Cu, Nb, Ta, Au, and Pb, using a spin-dependent evaporation model without the parity conservation and including the dipole and quardupole gamma-ray transitions. The results were compared with the experimental data measured in ORNL to confirm the availability of this model in applications. In addition, the effects on the gamma-ray production cross section of the optical potential, level density, yrast level, and radiation width were investigated in detail. The conclusions are: 1) the use of the optical potential which gives the correct total reaction cross section is essential to gamma-ray production calculations, 2) the gamma-ray production cross section is not so sensitive to the choice of level density parameters, 3) the inclusion of yrast levels is necessary in dealing with the competition of the neutron and gamma-ray emissions from highly excited states, and 4) the Brink-Axel type's radiation width is unsuitable to be applied to radiative capture processes. (author)