WorldWideScience

Sample records for 1-year-old erythrocebus patas

  1. Locomotor Anatomy and Behavior of Patas Monkeys (Erythrocebus patas with Comparison to Vervet Monkeys (Cercopithecus aethiops

    Adrienne L. Zihlman

    2013-01-01

    Full Text Available Patas monkeys (Erythrocebus patas living in African savanna woodlands and grassland habitats have a locomotor system that allows them to run fast, presumably to avoid predators. Long fore- and hindlimbs, long foot bones, short toes, and a digitigrade foot posture were proposed as anatomical correlates with speed. In addition to skeletal proportions, soft tissue and whole body proportions are important components of the locomotor system. To further distinguish patas anatomy from other Old World monkeys, a comparative study based on dissection of skin, muscle, and bone from complete individuals of patas and vervet monkeys (Cercopithecus aethiops was undertaken. Analysis reveals that small adjustments in patas skeletal proportions, relative mass of limbs and tail, and specific muscle groups promote efficient sagittal limb motion. The ability to run fast is based on a locomotor system adapted for long distance walking. The patas’ larger home range and longer daily range than those of vervets give them access to highly dispersed, nutritious foods, water, and sleeping trees. Furthermore, patas monkeys have physiological adaptations that enable them to tolerate and dissipate heat. These features all contribute to the distinct adaptation that is the patas monkeys’ basis for survival in grassland and savanna woodland areas.

  2. Interspecific and temporal variation of ant species within Acacia drepanolobium ant domatia, a staple food of patas monkeys (Erythrocebus patas) in Laikipia, Kenya.

    Isbell, Lynne A; Young, Truman P

    2007-12-01

    The ants that live in the swollen thorns (domatia) of Acacia drepanolobium are staple foods for patas monkeys (Erythrocebus patas). To obtain a better understanding of these insects as resources for patas monkeys, we sampled the contents of 1,051 swollen thorns (ant domatia) over a 22-month period from December 1999 to September 2001, in Laikipia, Kenya. First, we confirmed that of the four species of ants that live on A. drepanolobium, Crematogaster sjostedti, the competitively dominant ant in this system, does not rear significant brood in the swollen thorns and is therefore not a major food item of patas monkeys. Second, across the other three species that do use swollen thorns for rearing their brood, C. nigriceps, C. mimosae, and Tetraponera penzigi, the number of worker ants per swollen thorn increased with increasing competitive dominance. Third, although there was considerable month-to-month variation in the number of workers, immatures, and especially alates (winged reproductives) within species, there was less variation across species because ant production was asynchronous. Variation in domatia contents was poorly related to rainfall for each of the three species. Finally, distal thorns held more alates and fewer workers than interior thorns, and branches higher off the ground held more alates and more workers than lower branches. For the numerically dominant C. mimosae, higher branches held significantly more immature ants than did lower branches. Ants are reliable food resources for patas monkeys, and are probably more reliable than many plant resources in this highly seasonal environment. We estimate that patas monkeys may get as much as a third of their daily caloric needs from these ants year-round. As ants and other insects are widely consumed by primates, we suggest that greater consideration be given to species differences in animal food choices and that further studies be conducted to examine the degree to which ants influence energy intake and

  3. Metabolism and pharmacokinetics of the combination Zidovudine plus Lamivudine in the adult Erythrocebus patas monkey determined by liquid chromatography-tandem mass spectrometric analysis

    Because of their similarity to humans, non-human primates constitute useful preclinical models in which to examine potential human drug toxicities. Antiretroviral nucleoside reverse transcriptase inhibitor (NRTI) toxicity is currently under investigation in Erythrocebus patas monkeys, and whereas NRTI pharmacokinetics have been studied in other monkey species, pharmacokinetics for Zidovudine plus Lamivudine (AZT/3TC) dosing have not been reported in the patas. Here we present 24 h serum pharmacokinetic parameters after a single oral exposure to the combination of AZT (40 mg) and 3TC (24 mg), doses equivalent to a human daily dose of Combivir (registered) . The patas (n = 3) AZT/3TC pharmacokinetic profiles were similar to those seen in other primate species. Average maximum serum concentrations (Cmax) for AZT and 3TC were 2.35 and 2.65 μg/ml, respectively, and were observed at 0.83 h (Tmax). Cmax was 13.34 μg/ml for the AZT-glucuronide (AZT-G) and was 0.023 μg/ml for the potentially toxic minor metabolite 3'-amino-3'-deoxythymidine (AMT), both occurring at about 1 h after dosing. Similar elimination half-times, 0.70 and 0.68 h-1, were found for AZT and AZT-G, respectively, while 3TC was eliminated about half as fast (0.33 h-1) resulting in AUC(0-∞) values of 6.97 μg/ml h for 3TC, 2.99 μg/ml h for AZT, 20.5 μg/ml h for AZT-G and 0.002 for AMT 6.97 μg/ml h. This study shows similar metabolism and pharmacokinetics for oral administration of AZT/3TC in the adult patas monkey, other primate species and humans. The data validate the use of the patas monkey for studies of NRTI toxicity

  4. Influence of environment enrichment to the behaviors of Erythrocebus patas in captive%环境丰容对赤猴行为分配影响的研究

    陈霖; 叶安城; 池章伟

    2014-01-01

    In 2011, the 3 male and 3 female Erythrocebus patas raised in Fuzhou Zoo suffered from such unhealthy growing conditions as unitary behavior, coarse hairs, dry and ruptured tails and claudication, etc. They were transferred to a cage with certain environment enrichment and stayed for one year. Compared with the conditions in the previous cage, the allocations of Erythrocebus patas' day-time behaviors of foraging and sports increase by 61.3% and 213.2% respectively, and their walking and resting time decrease by 41.2% and 26.7% respectively. Now, the Erythrocebus patas have fine hairs, their tails recover to normal conditions, and claudication basically disappears.%2011年初福州动物园饲养的3公3雌赤猴出现行为单一、毛发粗糙、尾部干枯断裂、见有跛行等不良生长状况。为了改变猴群出现的不良状况,福州动物园将赤猴转移至新兽舍饲养,该新兽舍有较大的活动空间、良好的植被覆盖,还在新兽舍中安置有假山、攀网、跑道等设施供赤猴锻炼。此外,还将赤猴部分饲料由定点投喂改为抛洒投喂。经过约一年适应,赤猴昼间行为分配相较旧笼时觅食和运动行为分别提高61.3%、213.2%;行走和休息时间分别减少41.2%、26.7%,猴群被毛良好,尾部恢复正常,跛行现象基本消失。

  5. Emotional Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Emotional Development: 1 Year Olds Ages & Stages Listen Español Text ...

  6. Social Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Ages & Stages > Toddler > Social Development: 1 Year Olds Ages & Stages Listen Español Text ...

  7. Language Development: 1 Year Olds

    ... Stages Listen Español Text Size Email Print Share Language Development: 1 Year Olds Page Content Article Body ... assured, it’s not your imagination. He’s developing his language and comprehension skills right on schedule. This giant ...

  8. Nutritional benefits of Crematogaster mimosae ants and Acacia drepanolobium gum for patas monkeys and vervets in Laikipia, Kenya.

    Isbell, Lynne A; Rothman, Jessica M; Young, Peter J; Rudolph, Kathleen

    2013-02-01

    Patas monkeys (Erythrocebus patas) are midsized primates that feed extensively on the gum of Acacia drepanolobium and the ants are housed in swollen thorns of this Acacia. Their diet resembles that expected more of smaller bodied primates. Patas monkeys are also more like smaller bodied primates in reproducing at high rates. We sought to better understand the convergence of patas monkeys with smaller bodied primates by comparing their feeding behavior on ants and gum with that of closely related, sympatric vervets (Chlorocebus pygerythrus), and analyzing the nutrient content of the gum of A. drepanolobium and of Crematogaster mimosae, the most common ant species eaten by patas monkeys in Laikipia, Kenya. All occurrences of feeding and moving during focal animal sampling revealed that 1) patas monkeys seek A. drepanolobium gum but vervets avoid it; 2) both species open swollen thorns most often in the morning when antsare less active; 3) patas monkeys continually feed onswollen thorns and gum while moving quickly throughout the day, whereas vervets reduce their consumption of these items and their travel rate at mid-day, and; 4) vervets eat young swollen thorns at a higher rate than patas monkeys. Patas monkeys are able to spend little time acquiring substantial amounts of energy, protein, and minerals from A. drepanolobium gum and C. mimosae ants each day. These findings, when coupled with evidence of causes of infant and adult female mortality, suggest that reproductive success of female patas monkeys is more immediately affected by illness, disease, interactions between adults and infants, and access to water than by food. PMID:23280312

  9. Mitochondrial compromise in 3-year old patas monkeys exposed in utero to human-equivalent antiretroviral therapies.

    Liu, Yongmin; Shim Park, Eunwoo; Gibbons, Alexander T; Shide, Eric D; Divi, Rao L; Woodward, Ruth A; Poirier, Miriam C

    2016-08-01

    Antiretroviral (ARV) drug therapy, given during pregnancy for prevention of mother-to-child transmission of human immunodeficiency virus 1 (HIV-1), induces fetal mitochondrial dysfunction in some children. However, the persistence/reversibility of that dysfunction is unclear. Here we have followed Erythrocebus patas (patas) monkey offspring for up to 3 years of age (similar in development to a 15-year old human) after exposure of the dams to human-equivalent in utero ARV exposure protocols. Pregnant patas dams (3-5/exposure group) were given ARV drug combinations that included zidovudine (AZT)/lamivudine (3TC)/abacavir (ABC), or AZT/3TC/nevirapine (NVP), for the last 10 weeks (50%) of gestation. Infants kept for 1 and 3 years also received drug for the first 6 weeks of life. In offpsring at birth, 1 and 3 years of age mitochondrial morphology, examined by electron microscopy (EM), was compromised compared to the unexposed controls. Mitochondrial DNA (mtDNA), measured by hybrid capture chemiluminescence assay (HCCA) was depleted in hearts of patas exposed to AZT/3TC/NVP at all ages (P < 0.05), but not in those exposed to AZT/3TC/ABC at any age. Compared to unexposed controls, mitochondrial reserve capacity oxygen consumption rate (OCR by Seahorse) in cultured bone marrow mesenchymal fibroblasts from 3-year-old patas offspring was ∼50% reduced in AZT/3TC/ABC-exposed patas (P < 0.01), but not in AZT/3TC/NVP-exposed patas. Overall the data show that 3-year-old patas sustain persistent mitochondrial dysfunction as a result of perinatal ARV drug exposure. Environ. Mol. Mutagen. 57:526-534, 2016. © 2016 Wiley Periodicals, Inc. PMID:27452341

  10. Parental spanking of 1-year-old children and subsequent child protective services involvement✩

    Lee, Shawna J.; Grogan-Kaylor, Andrew; Berger, Lawrence M.

    2014-01-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once ...

  11. Development of newborn and 1-year-old reference phantoms based on polygon mesh surfaces

    The purpose of this study is the development of paediatric reference phantoms for newborn and 1-year-old infants to be used for the calculation of organ and tissue equivalent doses in radiation protection. The study proposes a method for developing anatomically highly sophisticated paediatric phantoms without using medical images. The newborn and 1-year-old hermaphrodite phantoms presented here were developed using three-dimensional (3D) modelling software applied to anatomical information taken from atlases, textbooks and images provided by the Department of Anatomy of the Federal University of Pernambuco, Brazil. The method uses polygon mesh surfaces to model body contours, the shape of organs as well as their positions and orientations in the human body. Organ and tissue masses agree with corresponding data given by the International Commission on Radiological Protection for newborn and 1-year-old reference children. Bones were segmented into cortical bone, spongiosa, medullary marrow and cartilage to allow for the use of μCT images of trabecular bone for skeletal dosimetry. Anatomical results show 3D images of the phantoms’ surfaces, organs and skeletons, as well as tables with organ and tissue masses or skeletal tissue volumes. Dosimetric results present comparisons of organ and tissue absorbed doses or specific absorbed fractions between the newborn and 1-year-old phantoms and corresponding data for other paediatric stylised or voxel phantoms. Most differences were found to be below 10%. (paper)

  12. A rare case of peripheral T-cell lymphoma in 1-year-old child

    Vignesh Kandakumar

    2011-01-01

    Full Text Available Peripheral T-cell lymphoma (PTCL represents approximately 12% of lymphoid neoplasms. They are even rarer in children and represent only 1% of Non-Hodgkin′s lymphoma in this age group. We report a case of PTCL in a 1-year-old female child for its rarity.

  13. A rare case of peripheral T-cell lymphoma in 1-year-old child

    Vignesh Kandakumar; Prasanth Ganesan; Peush Bajpai; Rejiv Rajendranath; Sagar Tenali; Urmila Majhi; Ponni Sivaprakasam

    2011-01-01

    Peripheral T-cell lymphoma (PTCL) represents approximately 12% of lymphoid neoplasms. They are even rarer in children and represent only 1% of Non-Hodgkin′s lymphoma in this age group. We report a case of PTCL in a 1-year-old female child for its rarity.

  14. Parental spanking of 1-year-old children and subsequent child protective services involvement✩

    Lee, Shawna J.; Grogan-Kaylor, Andrew; Berger, Lawrence M.

    2015-01-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once in the past month. Spanking at age 1 was associated with increased odds of subsequent CPS involvement (adjusted odds ratio=1.36, 95% CI [1.08, 1.71], ppunishment, professionals who work with families should counsel parents not to spank infants and toddlers. For optimal benefits, efforts to educate parents regarding alternative forms of discipline should begin during the child's first year of life. PMID:24602690

  15. Traumatic spinal epidural hematoma in a 1-year-old boy.

    Tarbé de Saint Hardouin, A-L; Grévent, D; Sainte-Rose, C; Angoulvant, F; Chéron, G

    2016-07-01

    Traumatic spinal epidural hematoma is uncommon in children, making rapid diagnosis difficult. In this report, we present a case of traumatic cervical epidural hematoma in a 1-year-old boy, diagnosed with computed tomography scanning and magnetic resonance imaging (MRI). Management was conservative and the lesion regressed spontaneously. The presentation in childhood is often nonspecific. MRI is the imaging modality of choice for diagnosing these lesions. Conservative treatment has to be considered in cases with a benign clinical course and provided that the patient is followed up neurologically with repeated MRI. PMID:27266638

  16. Parental spanking of 1-year-old children and subsequent child protective services involvement.

    Lee, Shawna J; Grogan-Kaylor, Andrew; Berger, Lawrence M

    2014-05-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once in the past month. Spanking at age 1 was associated with increased odds of subsequent CPS involvement (adjusted odds ratio=1.36, 95% CI [1.08, 1.71], pchildren, there was a 33% greater probability of subsequent CPS involvement for children who were spanked at age 1. Given the undesirable consequences of spanking children and a lack of empirical evidence to suggest positive effects of physical punishment, professionals who work with families should counsel parents not to spank infants and toddlers. For optimal benefits, efforts to educate parents regarding alternative forms of discipline should begin during the child's first year of life. PMID:24602690

  17. Development of 1-year-old computational phantom and calculation of organ doses during CT scans using Monte Carlo simulation

    With the rapidly growing number of CT examinations, the consequential radiation risk has aroused more and more attention. The average dose in each organ during CT scans can only be obtained by using Monte Carlo simulation with computational phantoms. Since children tend to have higher radiation sensitivity than adults, the radiation dose of pediatric CT examinations requires special attention and needs to be assessed accurately. So far, studies on organ doses from CT exposures for pediatric patients are still limited. In this work, a 1-year-old computational phantom was constructed. The body contour was obtained from the CT images of a 1-year-old physical phantom and the internal organs were deformed from an existing Chinese reference adult phantom. To ensure the organ locations in the 1-year-old computational phantom were consistent with those of the physical phantom, the organ locations in 1-year-old computational phantom were manually adjusted one by one, and the organ masses were adjusted to the corresponding Chinese reference values. Moreover, a CT scanner model was developed using the Monte Carlo technique and the 1-year-old computational phantom was applied to estimate organ doses derived from simulated CT exposures. As a result, a database including doses to 36 organs and tissues from 47 single axial scans was built. It has been verified by calculation that doses of axial scans are close to those of helical scans; therefore, this database could be applied to helical scans as well. Organ doses were calculated using the database and compared with those obtained from the measurements made in the physical phantom for helical scans. The differences between simulation and measurement were less than 25% for all organs. The result shows that the 1-year-old phantom developed in this work can be used to calculate organ doses in CT exposures, and the dose database provides a method for the estimation of 1-year-old patient doses in a variety of CT examinations. (paper)

  18. Successful Endosonography-Guided Drainage of an Intra-Abdominal Abscess in a 1-Year-Old Infant

    Ito, Yukiko; Isayama, Hiroyuki; Nakai, Yousuke; Umefune, Gyoutane; Sato, Tatsuya; Nakahara, Saori; Suwa, Junko; Kato, Keiichi; Nakata, Ryo

    2016-01-01

    Endoscopic ultrasound (EUS)-guided intervention has been established as a safe, effective and minimally invasive procedure for various diseases in adults, but there have been limited reports in pediatric patients. Herein, we report our experience with successful EUS-guided drainage of an intra-abdominal abscess in a 1-year-old infant concomitant with disseminated intravascular coagulation. The abscess was punctured via the stomach using a standard, convex-type echoendoscope, and the patient’s condition improved after naso-cystic catheter placement. Although the clinical course was complicated by delayed hemorrhage from the puncture site, the bleeding was successfully managed by endoscopic hemostasis using a standard forward-viewing endoscope. PMID:27114437

  19. Diet in 1-year-old farm and control children and allergy development: results from the FARMFLORA birth cohort

    Karin Jonsson

    2016-08-01

    Full Text Available Background: A farming environment confers strong protection against allergy development. We have previously shown that farming mothers consume more full-fat dairy than control mothers, who instead consume more low-fat dairy, margarine, and oils; margarine and oil intake was associated with increased risk of allergy development in their children. Objectives: The aims of this study were to investigate the differences in diet between children in farming and control families at 1 year of age, to investigate the relation between the diets of the mothers and their children, and to relate the children's diet to allergy development. Design: The diet of 1-year-old children from dairy farming families (n=28 and from control families in the same rural area (n=37 was assessed by 24-h dietary recalls, followed by 24-h food diaries. Allergy was diagnosed by pediatricians at 3 years of age using strict predefined criteria. Results: Farm children had a higher intake of farm milk, whole cream, cholesterol, saturated fat, and fat in total and tended to eat more butter, while controls consumed more carbohydrates and poultry and tended to eat more margarine. Farm children also had higher intakes of homemade porridge/gruel, oily fish, and iodine. The intake of butter and whole milk in children and mothers correlated significantly in farm families but not in controls. A weak negative association was found between seafood intake and allergy development, while allergy was positively associated with the intake of pork as well as zinc in the control group; these intakes also correlated with each other. Conclusions: Consistent with mothers in farming families, the children consumed more full-fat dairy and saturated fat than did controls, but this could not be linked to the low risk of allergy in the farming group. Seafood intake might protect against allergy development, in accordance with earlier findings.

  20. A congenital anterior urethral diverticulum associated with obstructive urinary symptoms in a 1-year-old male child: A case report and review of the literature

    Mehmet Hanifi Okur

    2015-05-01

    Full Text Available Congenital anterior urethral diverticula are rarely found in children. We present the case of a 1-year-old male child with a congenital anterior urethral diverticulum. This condition can lead to obstructive lower urinary tract symptoms and urosepsis. The clinical presentation, diagnosis, and management of this rare condition are discussed in this report. The diagnosis was made using retrograde urethrography. Patient was treated with open diverticulectomy and urethroplasty

  1. Accumulation pattern of endogenous cytokinins and phenolics in different organs of 1-year-old cytokinin pre-incubated plants: implications for conservation

    Aremu, A.O.; Plačková, L. (Lenka); Grúz, J. (Jiří); Bíba, O. (Ondřej); Šubrtová, M. (Michaela); Novák, O. (Ondřej); Doležal, K. (Karel); van Staden, J.

    2015-01-01

    A better understanding of phytohormone physiology can provide an essential basis to coherently achieve a conservation drive/strategy for valuable plant species. We evaluated the distribution pattern of cytokinins (CKs) and phenolic compounds in different organs of 1-year-old greenhouse-grown Tulbaghia simmleri pre-treated (during micropropagation) with three aromatic CKs (benzyladenine=BA, meta-topolin=mT, meta-topolin riboside=mTR). The test species is highly valuable due to its medicinal an...

  2. Profound Vitamin B12 Deficiency in a 1-Year-Old Child in Botswana: A Call to Initiate Early Empiric Therapy.

    Gajudhur, Juyotee; Slone, Jeremy S; Mehta, Parth S; Mahoney, Donald

    2016-08-01

    Vitamin B12 deficiency is a rare diagnosis in young children. We present the case of a 1-year-old Zimbabwean child with profound anemia. Further testing revealed undetectable levels of vitamin B12 and positive intrinsic factor antibodies that were drawn after the initiation of empiric treatment with parenteral vitamin B12. We report the evaluation and management of vitamin B12 deficiency in a resource-limited setting. Vitamin B12 deficiency should be considered in children presenting with unexplained cytopenias with consideration of empiric treatment with parenteral vitamin B12, as developmental and neurological complications of vitamin B12 deficiency can be devastating and permanent. PMID:27306229

  3. 0~1岁婴儿出生缺陷的流行病学调查%Epidemiological survey on 0-1 years old baby with birth defect

    倪少义; 何洁壁; 陈少娜; 吴翔; 蔡幸生; 黄伟鹏; 王榕生; 洪艳苹; 倪少英; 卢晓航

    2012-01-01

    Objective To understand the incidence of birth defect in 0-1 years old baby in some regions of Jieyang, then to determine the focus groups for prevention. So that it can provide a foundation for birth defect prevention, pre-pregnancy and pregnancy care. Methods Those babies, who were born in Jiedong County, Puning City and Rongcheng District from March 3, 2011 to May 2, 2012 were surveyed by general investigation. Birth defect based on clinical diagnosis, its entity and statistical standard referred to the regulations of International Centre on Birth Defects and Prematurity. Results 238 cases of birth defect babies were found out of 10 773 cases of monitored new babies. The top five diseases of baby birth defects were congenital heart disease, talipes equinovarus, polydactyly, cleft lip and palate and fetal-edematous-syndrome. Some babies had higher incidence of birth defects, such as baby boy, low birth weight baby, and those babies whose mother did not take folic acid, vitamin and trace elements during pregnancy and whose family members smoking and excessive drinking (P < 0.05). Conclusion The incidence rate of birth defects in 0-1 years old baby is 220.92 per ten thousand in some regions of Jieyang City. It is slightly higher than the national average, so it needs attention from each side. Strengthening propaganda and education, screening and preventing birth defects are matters of great urgency.%目的 了解揭阳部分地区0~1岁婴儿出生缺陷的发病情况,确定预防的重点人群,为出生缺陷的预防和孕前、孕期保健提供依据.方法 采用普查的方式,对揭东县、普宁市、榕城区三地2011年3月3日~2012年5月2日出生的婴儿进行调查.出生缺陷以临床诊断为依据,病种及统计标准参照国际出生缺陷监测情报交换所的规定.结果 共监测10 773名婴儿,发现出生缺陷238例;婴儿出生缺陷排名前5位的疾病分别是先天性心脏病、马蹄内翻足、多指(趾)、唇(腭)裂

  4. Saber morir. Antropología de la muerte y relatos de psicópatas en el cine.

    Sánchez-Biosca, Vicente

    1995-01-01

    El presente texto estudia la relación existente entre la antropología de la muerte y los relatos de psicópatas. Partiendo de una concepc8ión del relato que se inspira de Walter Benjamin y se materializa en las formas de continuidad, serialidad, ciclismo y final, pone en relación los rasgos formales de los nuevos relatos de psicópatas en el cine de los años 80 en adelante con el imaginario científico de la postmodernidad.

  5. Labor de la enfermera en la atención a gestantes cardiópatas

    Maritza Miclín Velázquez

    1999-04-01

    Full Text Available Se indica el desarrollo alcanzado en los últimos años en la atención a los pacientes cardiópatas. Se hizo un estudio descriptivo y retrospectivo de 51 gestantes cardiópatas atendidas en el Servicio de Perinatología del Hospital de Maternidad Norte "Tamara Bunke" de Santiago de Cuba, durante 1994, con el propósito de valorar la importancia de la labor de Enfermería durante el embarazo, parto y puerperio de estas pacientes, de donde se derivó que los cuidados especiales mantenidos garantizaron que la enfermedad cardíaca no repercutiera sobre la tasa de morbilidad y mortalidad maternoperinatales, que las complicaciones fueran mínimas en las madres y que no se produjeran defunciones.The development achieved during the last years in the attention of cardiacs is stressed. A descriptive and retrospective study of 51 pregnant women attended at the Perinatology Service of the "Tamara Bunke" North Maternal Hospital, in Santiago de Cuba, during 1994, was conducted aimed at assessing the importance of the nurse´s work during the pregnancy, delivery and puerperium of these patients. It was concluded that thanks to the special care given, the heart disease did not influence on the maternal and perinatal morbidity and mortality rate, mothers´ complications were minimal, and there were no deaths.

  6. Mutations in Genes patA and patL of Anabaena sp. Strain PCC 7120 Result in Similar Phenotypes, and the Proteins Encoded by Those Genes May Interact ▿

    Liu, Jinjie; Wolk, C. Peter

    2011-01-01

    PatA resembles a response regulator protein with a defective DNA-binding domain, and PatL (All3305) is a pentapeptide repeat protein. A yeast two-hybrid library identified PatL as a protein with which PatA may interact. Heterocysts of patA and patL Anabaena sp. form nearly exclusively terminally in long filaments, further linking the genes.

  7. Actitudes de los médicos alópatas frente a la acupuntura en una EPS en Colombia. 2011

    Bernal Doblado, Mauricio

    2011-01-01

    Esta investigación constituye una descripción concreta sobre actitudes, conocimientos y prácticas de médicos alópatas con respecto a la Acupuntura, proporcionando información relevante tanto para directivos que determinan las políticas, filosofías y servicios concretos en el sistema de salud, como para médicos alópatas cuyo criterio determina en gran medida la integración de la Acupuntura a tratamientos de casos específicos de usuarios del sistema de Salud. Objetivo: Describir las actitudes q...

  8. Superação da dormência em sementes de pata-de-vaca (Bauhinia angulata Vell. = Overcoming dormancy of pata-de-vaca (Bauhinia angulata Vell seeds.

    Oscar José Smiderle

    2010-12-01

    Full Text Available O trabalho foi realizado no Laboratório de Análise de Sementes da Embrapa Roraima, com o objetivo de estudar métodos pré-germinativos em laboratório para a superação da dormência de sementes de pata-de-vaca. O delineamento experimental foi o inteiramente ao acaso com sete tratamentos e 4 repetições de 50 sementes. Os tratamentos pré-germinativos foram: escarificação com imersão em ácido sulfúrico (PA por 5, 10 e 15 minutos; imersão em álcool etílico por 5, 10 e 15 minutos; e testemunha, sem tratamento prévio nas sementes. As sementes foram incubadas a 25oC no interior de caixas plásticas, tipo ‘gerbox’, contendo como substrato papel ‘germitest’ umedecido. Diariamente, até 89 dias após a semeadura, foi feita avaliação da embebição e da germinação; a partir dos dados de germinação foi estimada a velocidade de germinação. Os resultados demonstraram que os tratamentos pré-germinativos promoveram acréscimo de pelo menos 50% na germinaçãodas sementes de pata-de-vaca, sendo que a escarificação com ácido sulfúrico (15 minutos, revelou ser o método mais efetivo para a superação da dormência desta espécie. A utilização de álcool (10 minutos pode ser uma boa alternativa para promover a germinação de sementes de pata-de-vaca.= - This study was carried out at Seed laboratory of Embrapa Roraima, with the objective to study the overcoming dormancy of pata-de-vaca (Bauhinia angulata seeds. The experimental design was a completely randomized design with seven treatments and four replicates of 50 seeds each. The pre-germinations treatments were: sulfuric acid - PA (5, 10 and 15 minutes, ethylene alcohol (5, 10 and 15 minutes, and control. The seeds were disposed in plastic boxes over humidified paper and incubated at 25oC in a germinator. The parameters evaluated were germination, imbibition, speed of germination, normal seedlings at 89 days after sowing. The germinated seeds were counted daily during 89

  9. Superação da dormência em sementes de pata-de-vaca (Bauhinia angulata Vell). = Overcoming dormancy of pata-de-vaca (Bauhinia angulata Vell) seeds.

    Oscar José Smiderle; Francisco Joaci de Freitas Luz

    2010-01-01

    O trabalho foi realizado no Laboratório de Análise de Sementes da Embrapa Roraima, com o objetivo de estudar métodos pré-germinativos em laboratório para a superação da dormência de sementes de pata-de-vaca. O delineamento experimental foi o inteiramente ao acaso com sete tratamentos e 4 repetições de 50 sementes. Os tratamentos pré-germinativos foram: escarificação com imersão em ácido sulfúrico (PA) por 5, 10 e 15 minutos; imersão em álcool etílico por 5, 10 e 15 minutos; e testemunha, sem ...

  10. Avaliação da qualidade de amostras comerciais de boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. e ginco (Ginkgo biloba L. Control quality evaluation of commercial samples of boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. and ginkgo (Ginkgo biloba L.

    J. G. de Melo

    2004-01-01

    Full Text Available O presente trabalho procurou avaliar a qualidade de produtos comercializados à base de boldo, pata-de-vaca e ginco, através dos parâmetros contidos na Farmacopéia Brasileira e na literatura específica. Foram analisadas oito amostras de boldo, nove de pata-de-vaca e sete de ginco, adquiridas em farmácias na cidade do Recife. A metodologia consistiu em avaliar: os rótulos e bulas dos produtos verificando se estavam de acordo com a RDC n o 17 de 24/02/2000 e a portaria 110/97 da ANVISA; realizar análise sensorial; verificar a autenticidade das amostras e sua pureza. Todas as embalagens de boldo, pata-de-vaca e seis de ginco continham erros ou ausência de informações científicas, além da falta de bula. Na verificação de impurezas, todas as de boldo, cinco de pata-de-vaca, e uma amostra de ginco foram reprovadas. Todos os produtos analisados apresentaram alguma irregularidade segundo os códigos oficiais, sendo necessário uma maior intensificação na vigilância de produtos à base de plantas medicinais no Brasil.This study aimed to evaluate the quality of commercial products prepared with boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. and ginkgo (Ginkgo biloba L. by using parameters from the Brazilian Pharmacopoeia and specific literature. Eight samples of "boldo", nine of "pata-de-vaca", and seven of ginkgo were analyzed, all bought from pharmacies in Recife (Pernambuco, Brazil. The methodology consisted in evaluating the products’ labels and instructions to verify their accordance to RDC n o 17 of 02/24/2000 and ANVISA (National Sanitary Surveillance Agency decree 110/97, undertaking a sensorial analysis, and verifying the authenticity and purity of the samples. All of the packages of "boldo" and "pata-de-vaca" and six of the packages of ginkgo contained mistakes or lacked scientific information; instructions were also missing. After analyzing for impurities, all samples of "boldo", five of "pata-de-vaca", and one of

  11. The Stain That Gets Increasingly Visible. The Ethnic Segregation in the Pata Rât (Stain snout Ghetto, Cluj-Napoca

    Viorel Mionel

    2012-04-01

    Full Text Available This paper presents, in the first part, a brief theoretical analisys of the ethnic segregation and the causes entailing this kind of urban fragmentation. Undoubtedly, discrimination is one of the main reasons of segregation, closely followed by the countless social disadvantages. Besides all these, we may point out the poor quality of public policies which instead of improving the marginalized people’s situaion, pushes them deeper into poverty and stigma, as in the case study of Pata Rât, Cluj-Napoca. This paper aims at drawing attention to discrimination and segregation of the Gypsy people living in the outskirts of Cluj-Napoca city, usually called Pata Rât ghetto, and the urgent need for new inclusion policies.

  12. Overexpression of patA and patB, Which Encode ABC Transporters, Is Associated with Fluoroquinolone Resistance in Clinical Isolates of Streptococcus pneumoniae▿

    Garvey, Mark I.; Baylay, Alison J.; Wong, Ryan L.; Piddock, Laura J. V.

    2010-01-01

    Fifty-seven clinical isolates of Streptococcus pneumoniae were divided into four groups based on their susceptibilities to the fluoroquinolones ciprofloxacin and norfloxacin and the dyes ethidium bromide and acriflavine. Comparative reverse transcription-PCR was used to determine the level of expression of the genes patA and patB, which encode putative ABC transporters. Overexpression was observed in 14 of the 15 isolates that were resistant to both fluoroquinolones and dyes and in only 3 of ...

  13. Aprovechamiento de Patas de Pollos como Alternativa para disminuir Residuos Generados en los Mataderos Use of Chicken Feet as an Alternative to the reduce Wastes from Slaughterhouse

    Poliana F Almeida

    2012-01-01

    Full Text Available Se presenta un estudio sobre la producción de jaleas y gelatinas a partir de las patas de pollo, usualmente producidas como desechos de los mataderos de aves. La investigación se llevó a cabo en dos etapas. En la primera etapa, las jaleas se obtuvieron a partir de las patas del pollo y se evaluaron sus cualidades sensoriales para verificar su aceptabilidad. En la segunda etapa, se produjo gelatinas y se analizó también sus cualidades sensoriales para comprobar su aceptabilidad. Los resultados mostraron que la mayoría de los catadores aprobaron los productos con más de 7 puntos en la escala hedónica y más del 80% dijeron que consumirían los productos. Los niveles de proteínas en las jaleas y gelatinas de patas de pollo superaron en cuatro veces los niveles de los productos comerciales, lo que indica una superioridad con respecto a las calidades químicas y potencialmente medicinales.A study on the production of jelly and gelatin from chicken feet, produced as wasted from chicken slaughterhouse is presented. The study was conducted in two parts. In the first part, jellies were produced from chicken feet and sensory quality was done to verify their acceptability. In the second step, gelatins were elaborated from chicken feet and also subjected to sensory analysis. Results showed that most experts in the panel accepted the products with more than 7 points in the hedonic scale and 80% said that they would consume these chicken products. Gelatin and jelly protein contents were four times larger than commercial products, indicating superiority in their chemistry and potential medicinal qualities.

  14. pata Terminal Aerodrome Forecast

    National Oceanic and Atmospheric Administration, Department of Commerce — TAF (terminal aerodrome forecast or terminal area forecast) is a format for reporting weather forecast information, particularly as it relates to aviation. TAFs are...

  15. Synthesis of Biotin Linkers with the Activated Triple Bond Donor [p-(N-propynoylaminotoluic Acid] (PATA for Efficient Biotinylation of Peptides and Oligonucleotides

    Martina Jezowska

    2012-11-01

    Full Text Available Biotin is an important molecule for modern biological studies including, e.g., cellular transport. Its exclusive affinity to fluorescent streptavidin/avidin proteins allows ready and specific detection. As a consequence methods for the attachment of biotin to various biological targets are of high importance, especially when they are very selective and can also proceed in water. One useful method is Hüisgen dipolar [3+2]-cycloaddition, commonly referred to as “click chemistry”. As we reported recently, the activated triple bond donor p-(N-propynoylaminotoluic acid (PATA gives excellent results when used for conjugations at submicromolar concentrations. Thus, we have designed and synthesized two biotin linkers, with different lengths equipped with this activated triple bond donor and we proceeded with biotinylation of oligonucleotides and C-myc peptide both in solution and on solid support with excellent yields of conversion.

  16. Efeitos do alfa-tocoferol nas lesões de isquemia-reperfusão induzidas em pata direita de ratos

    Bitu-Moreno José

    2001-01-01

    Full Text Available Recentes estudos demonstraram que os radicais livres de oxigênio parecem desempenhar papel importante nas lesões de isquemia-reperfusão. O alfa-tocoferol(AT age in vivo como um anti-oxidante. Nosso objetivo foi o de verificar se o AT atenuava as lesões de isquemia-reperfusão em pata direita de ratos. Os animais, randomizados, foram divididos nos seguintes grupos(G: G1-controle sem isquemia; G2 e G3 - quatro horas isquemia e duas reperfusão. Os animais do G2 foram tratados com salina e os do G3 com AT, 50mg/kg. Como parâmetros examinamos as alterações de volume e circunferência do pé direito ao longo do experimento, assim como a captação de 99mTc-pirofosfato e a microscopia eletrônica de transmissão do músculo soleus direito. Os aumentos de volume e circunferência do pé dos animais do G2 foram estatisticamente maiores quando comparados com o G1. As medidas do G3 não diferiram do G1. A captação de 99mTc-pirofosfato foi bem aumentada nos G2 e G3, quando comparados ao G1, porém sem diferenças entre os grupos isquêmicos. As lesões ao MET foram menos intensas em três animais do G3, quando comparados ao G2. Conclusão: O tratamento com AT diminuiu a formação do edema mas só protegeu parcialmente as células musculares contra as lesões de isquemia-reperfusão.

  17. Psicopatología, crimen violento, cine y realidad: desmontando mitos sobre psicópatas y psicóticos

    José Manuel Pozueco Romero

    2015-08-01

    Full Text Available Psicosis, esquizofrenia, paranoia, personalidad múltiple y otro sinfín de términos son los que parecen coincidir con los conceptos coloquiales y peyorativos de locos, tarados, etc. Según numerosos autores, parece ser que la psicosis es la enfermedad mental más grave que existe, y, también, es evidente la cantidad de veces que ha sido (mal utilizada para recrear centenares de películas; el ejemplo más claro de esto mismo lo tenemos en el famoso film de Alfred Hitchcock, Psicosis, que analizamos aquí desde una perspectiva psicológico-forense y criminológica. Por otra parte, el tópico de la psicopatía también ha venido siendo amplia y erróneamente abordado por los medios de comunicación, y mal caracterizado en numerosas películas y series televisivas, todo esto a pesar de que hoy día se trata de un constructo clínico-forense válido y fiable. La relación de la psicopatía con la violencia y la criminalidad es bastante conocida, si bien este aspecto también requiere de una serie de rigurosos matices. En este artículo trataremos de desmontar el mito generalizado de que los enfermos mentales son muy peligrosos, y de que su criminalidad se ciñe exclusivamente a los homicidios, algo que también extienden muchos autores al caso de los psicópatas.

  18. PREDICTORS OF EMOTIONAL AND BEHAVIORAL PROBLEMS IN 1-YEAR-OLD CHILDREN: A LONGITUDINAL PERSPECTIVE.

    Sirvinskiene, Giedre; Zemaitiene, Nida; Jusiene, Roma; Markuniene, Egle

    2016-07-01

    Emotional and behavioral problems at an early age can reasonably be considered a high-risk factor for later mental health disorders. The aim of the article is to reveal predictive factors of 1½-year-old children's emotional and behavioral problems. The study was a part of a prospective birth-cohort study. The study sample consisted of 172 full-term infants (born during Gestational Weeks 37-42) and their mothers. Emotional and behavioral problems at the age of 1½ years were measured using the Child Behavior Checklist for Ages 1½-5 (T. Achenbach & L. Rescorla, 2000), which was completed by mothers. Emotional and behavioral problems at age of 1½ years were more prevalent in infants born via cesarean section, as compared to infants born vaginally without administration of medication. Newborns' suboptimal functioning after birth, complicated emotional acceptance of pregnancy, a couple's nonsatisfactory relationship during pregnancy, maternal distress during pregnancy and in the first months after childbirth, and inflexible and parent-oriented attitudes toward infant-rearing also predicted children's emotional and behavioral problems independent of sociodemographic factors. Results suggest that biomedical and psychosocial factors which manifest themselves in the prenatal and perinatal periods can have associations with later infant and child mental health. PMID:27336695

  19. Nutrition and Iron Status of 1-Year Olds following a Revision in Infant Dietary Recommendations

    Thorisdottir, Asa V.; Inga Thorsdottir; Gestur I. Palsson

    2011-01-01

    A previous study showed low iron status in 12-month-old Icelandic infants associated most strongly with cow's milk intake and growth. Infant dietary recommendations were revised in 2003. This study investigated nutrition and iron status in a new infant cohort. Subjects/Methods. Randomly selected infants were prospectively investigated for diet, anthropometry, and iron status (n = 110–141). Results. Breastfeeding initiation rate was 98%; 38% of 5-month olds were exclusively and 20% of 12-month...

  20. Serological Evidence of Infection with Endemic Human Pathogens Among Free-Ranging Old World Monkeys in Puerto Rico.

    Hemme, Ryan R; Lopez-Ortiz, Ricardo; Garcia, Brenda Rivera; Sharp, Tyler M; Galloway, Renee L; Elrod, Mindy G; Hunsperger, Elizabeth A

    2016-05-01

    Serum specimens from free-ranging but nonnative patas monkeys (Erythrocebus patas) and rhesus macaques (Macaca mulatta) in southwestern Puerto Rico (PR) were tested for antibodies to infection with dengue viruses (DENVs), West Nile virus (WNV), Leptospira species, and Burkholderia pseudomallei by microneutralization, plaque reduction neutralization, microscopic agglutination, and indirect hemagglutination, respectively. Of 23 animals (21 E. patas and two M. mulatta) tested, all had evidence of prior DENV infection, and of 17 animals tested for WNV, nine (53%) had evidence of prior infection. Of 24 (22 E. patas, two M. mulatta) tested for Leptospira spp., 10 (42%) had evidence of prior exposure, and one patas monkey had antibodies against B. pseudomallei The acquisition of pathogens endemic among humans in PR by resident nonhuman primates merits further study to define modes of acquisition. PMID:27001754

  1. Detection of cyclospora in captive chimpanzees and macaques by a quantitative PCR-based mutation scanning approach

    Marangi, M; A.V. Koehler; S.A. Zanzani; Manfredi, M.T.; E. Brianti; Giangaspero, A.; Gasser, R. B.

    2015-01-01

    Background Cyclospora is a protistan parasite that causes enteritis in several species of animals including humans. The aim of this study was to investigate the presence of Cyclospora in captive non-human primates. Methods A total of 119 faecal samples from Pan troglodytes, Macaca sylvanus, Cercopithecus cephus, Erythrocebus patas, Chlorocebus aethiops and Macaca fascicularis from a wildlife animal rescue center as well as from Macaca fascicularis from an experimental primate research center ...

  2. Unexpected dominance of 1 year old parr among migrating salmon and sea trout individuals in the River Siesartis, Lithuania

    Kęstutis Skrupskelis

    2015-12-01

    However, 1 year age parr unexpectedly dominated among salmon juveniles descending towards the Sea in the restocked Siesartis River, which is situated 400 km to the Baltic Sea. The same phenomenon has been observed among migrating sea trout individuals, too. Mass migration of 1 year age salmon and sea trout parr with mean body length ranging from 69 to 150 mm can hardly be explained by density-dependant regulatory mechanisms alone. Possible impact of particularly long distance migration route is also discussed.

  3. Individual variation in fathers' testosterone reactivity to infant distress predicts parenting behaviors with their 1-year-old infants.

    Kuo, Patty X; Saini, Ekjyot K; Thomason, Elizabeth; Schultheiss, Oliver C; Gonzalez, Richard; Volling, Brenda L

    2016-04-01

    Positive father involvement is associated with positive child outcomes. There is great variation in fathers' involvement and fathering behaviors, and men's testosterone (T) has been proposed as a potential biological contributor to paternal involvement. Previous studies investigating testosterone changes in response to father-infant interactions or exposure to infant cues were unclear as to whether individual variation in T is predictive of fathering behavior. We show that individual variation in fathers' T reactivity to their infants during a challenging laboratory paradigm (Strange Situation) uniquely predicted fathers' positive parenting behaviors during a subsequent father-infant interaction, in addition to other psychosocial determinants of paternal involvement, such as dispositional empathy and marital quality. The findings have implications for understanding fathering behaviors and how fathers can contribute to their children's socioemotional development. © 2015 Wiley Periodicals, Inc. Dev Psychobiol 58: 303-314, 2016. PMID:26497119

  4. Accumulation pattern of endogenous cytokinins and phenolics in different organs of 1-year-old cytokinin pre-incubated plants: implications for conservation

    Aremu, A.O.; Plačková, Lenka; Grúz, Jiří; Bíba, Ondřej; Šubrtová, Michaela; Novák, Ondřej; Doležal, Karel; van Staden, J.

    2015-01-01

    Roč. 17, č. 6 (2015), s. 1146-1155. ISSN 1435-8603 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : Acclimatisation * conservation * meta-topolins Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.633, year: 2014

  5. Psicópatas y asesinos en serie

    Antuña Bellerín, Mª de los Ángeles; Rodríguez Franco, Luís

    2007-01-01

    En este artículo, distinguimos la psicopatía de otros trastornos, como el explosivo intermitente, el disocial o el negativista desafiante, que conllevan comportamientos violentos y que se encuentran recogidos en los manuales diagnósticos al uso. Tras realizar un breve bosquejo de la evolución del término psicopatía, analizamos los problemas que se presentan entre el trastorno antisocial de la personalidad y la psicopatía para centrarnos a continuación en los llamados asesinos en serie. Si bie...

  6. Adaptação cultural de instrumento para avaliação da capacidade física em cardiopatas Adaptación cultural de instrumento para evaluación de la capacidad física en cardiópatas Cultural adaptation of an instrument to assess physical fitness in cardiac patients

    Gabriela de Barros Leite Domingues

    2011-04-01

    Full Text Available OBJETIVO: Validar o conteúdo e avaliar a confiabilidade do instrumento Veterans Specific Activity Questionnaire, adaptado culturalmente para uso na população brasileira de cardiopatas. MÉTODOS: O instrumento foi traduzido, retrotraduzido e analisado por comitê de juízes para avaliação das equivalências semântico-idiomática e cultural. As atividades físicas indicadas no instrumento incomuns ao cotidiano da população-alvo foram substituídas. Outro comitê de especialistas analisou a equivalência metabólica das atividades substituídas. A proporção de concordância de avaliação dos juízes foi quantificada pelo Índice de Validade de Conteúdo. O pré-teste foi realizado em duas etapas (n1 e n2 = 15. A confiabilidade foi avaliada por meio do teste re-teste (intervalo de 7-15 dias, n = 50. RESULTADOS: Na avaliação das equivalências semântico-idiomática e cultural, os itens com Índice de Validade de Conteúdo OBJETIVO: Validar el contenido y la confiabilidad del instrumento Veterans Specific Activity Questionnaire, adaptado culturalmente para uso en la población brasileña de cardiópatas. MÉTODOS: El instrumento fue traducido y retro traducido y analizado por comité de árbitros para evaluación de las equivalencias semántico-idiomática y cultural. Las actividades físicas indicadas en el instrumento, no comunes a lo cotidiano de la población de interés fueron sustituidas. Otro comité de especialistas analizó la equivalencia metabólica de las actividades sustituidas. La proporción de concordancia de evaluación de los árbitros fue cuantificada por el Índice de Validez de Contenido. La pre-test fue realizada en dos etapas (n1 y n2=15. La confiabilidad fue evaluada por medio de la prueba re-test (intervalo de 7-15 días, n=50. RESULTADOS: En la evaluación de las equivalencias semántico-idiomática y cultural, los itens con Índice de Validez de Contenido OBJECTIVE: To validate the content and to evaluate the

  7. Doença coronária obstrutiva em hepatopatas crônicos que aguardam transplante hepático Enfermedad coronaria obstructiva en hepatópatas crónicos que aguardan trasplante hepático Obstructive coronary disease in patients with chronic liver disease awaiting liver transplantation

    Moacir Fernandes de Godoy

    2011-01-01

    grado importante con consecuente aumento de riesgo o incluso contraindicación para trasplante hepático. OBJETIVOS: Analizar la contribución de los factores de riesgo clásicos para la enfermedad arterial coronaria (EAC en pacientes portadores de IHA con y sin coronariopatía obstructiva. MÉTODOS: Evaluación de los factores de riesgo para EAC en 119 pacientes, en un servicio de referencia para trasplante hepático, con las siguientes características: más de 40 años de edad, portadores de IHA y sometidos a cinecoronariografía. RESULTADOS: Coronariopatía obstructiva fue detectada en 21 (17,6% de los casos. Estos pacientes presentaban realmente niveles bajos de colesterol, siendo de 129,0±53,5mg/dL con mediana de 117,0mg/dL en los hepatópatas con coronarias normales y 135,4±51,7mg/dL con mediana de 122,0mg/dL en los hepatópatas con coronariopatía obstructiva (P=0,8215. En la regresión logística multivariada, la edad, el sexo, el índice de masa corporal, así como las presencias de diabetes, de tabaquismo y de etilismo no tuvieron significancia estadística aislada en la diferenciación entre los grupos. También no hubo asociación con la etiología de la IHA. A su vez, la hipertensión arterial se mostró relevante en la asociación con EAC (P=0,0474. CONCLUSIÓN: Sólo la hipertensión arterial fue factor de riesgo con significancia estadística para el desarrollo de EAC en pacientes con IHA aguardando trasplante hepático. Por ser un factor de riesgo cambiable, este hallazgo orienta hacia una práctica de actitudes terapéuticas en la tentativa de evitarse o retardar el desarrollo de la EAC en estos pacientes.BACKGROUND: Advanced liver failure (ALF usually presents hypocholesterolemia. Nevertheless, some patients with ALF develops major coronary obstructive diseases with consequent increased risk or contraindication to liver transplantation. OBJECTIVE: To analyze the contribution of classical risk factors for coronary artery disease (CAD in patients

  8. Allelopathic activity of fresh and dry extracts of Stryphnodendron adstringens (Mart. Coville and Bauhinia forficata link leaves on the germination and initial development of tomato seedlings / Atividade alelopática dos extratos fresco e seco de folhas de barbatimão (Stryphnodendron adstringens (Mart. Coville e pata-devaca (Bauhinia forficata link sobre a germinação e desenvolvimento inicial de plântulas de tomate

    Gisela Ferreira

    2009-07-01

    Full Text Available The objective of this study aimed at the verification of the allelopatic action of extracts of “pata-devaca” (Bauhinia forficata Link and “barbatimão” (Stryphnodendron adstringens (Mart. Coville on seeds of tomato (Lycopersicum esculentum Mill. Tomato seeds placed in translucent “gerbox” were treated with aqueous extracts prepared with fresh and dry leaves of the tested species at the following concentrations: 100%, 75%, 50%, 25%, and 0% (control. The experimental design was completely randomized with five treatments and five replications of 25 seeds per plot per species. The data were submitted to the analysis of variance and the means compared by Tukey test at 5% of probability. Germination percentage, mean time and germination rates (MGT and MGR, and mean of the primary root length were evaluated. No difference was found for germination percentage of tomato seeds for the different extracts. For MGR, all treatments with fresh leaf extract differed from the check. MGT and MGR showed differences among the following dry leaf extracts concentrations: 25%, 75% and 100%. All treatments presented inhibitory effect on the length of the primary root.O trabalho teve por objetivo verificar a ação alelopática de pata-de-vaca (Bauhinia forficata Link, e barbatimão (Stryphnodendron adstringens (Mart. Coville em sementes de tomate (Lycopersicum esculentum Mill. As sementes de tomate foram tratadas com extratos aquosos preparados a partir de folhas frescas e secas das espécies-teste nas concentrações de 100%, 75%, 50%, 25% e 0% (controle e acondicionadas em ‘gerbox’ transparente. O delineamento experimental foi inteiramente casualizado, com cinco tratamentos e cinco repetições de 25 sementes por parcela por espécie-teste. Foram avaliados porcentagem, tempo e velocidade médios de germinação e, comprimento médio de raiz primária. Os dados foram submetidos à análise de variância e as médias comparadas por Tukey a 5% de

  9. Hábitos alimentares de crianças menores de 1 ano amamentadas e não-amamentadas Feeding habits of breastfed and non-breastfed children up to 1 year old

    Graciete O. Vieira

    2004-01-01

    Full Text Available OBJETIVOS: Descrever os hábitos alimentares de crianças amamentadas e não-amamentadas através da análise dos alimentos consumidos pelas crianças menores de 1 ano de idade na cidade de Feira de Santana, BA, no ano de 2001. MÉTODOS: Foi realizado um estudo transversal, no qual foram aplicados questionários às mães das crianças menores de 1 ano no dia nacional de vacinação, presentes nas 44 (71% unidades de vacinação, selecionadas por estratificação simples. Foram avaliadas 2.319 crianças, representando 24,3% da população estimada. As medidas de associação calculadas foram: razão de prevalência, com intervalo de confiança a 95%, e de significância estatística, através do teste do qui-quadrado com respectivo valor p. RESULTADOS: Nas crianças com idade igual ou inferior a 4 meses e não-amamentadas, foi observada uma chance 8,2 e 6,7 vezes maior de a criança ser alimentada, respectivamente, com a refeição da família (IC 95% 3,23-20,66 e com papas de legumes (IC 95% 3,84-11,78. Na mesma faixa etária, as prevalências de crianças não-amamentadas que receberam água, chás, sucos e papa de frutas foram significativamente maiores (70,7% versus 19,7%, 63,3% versus 26,7%, 33,3% versus 4,9% e 14,4% versus 1,4%, respectivamente. CONCLUSÕES: As crianças amamentadas, quando comparadas com as não-amamentadas, apresentaram melhores hábitos no que se refere à época de introdução dos alimentos complementares.OBJECTIVE: To describe the eating habits of breastfed and non-breastfed children through the analysis of food intake by children younger than one year of age in Feira de Santana in 2001. METHODS: Cross-sectional study. The mothers of children younger than one year answered a questionnaire during the national vaccination day in 44 (71% vaccination units selected by simple stratification. 2,319 children were evaluated, representing 24.3% of the estimated population. Prevalence ratio and 95% confidence interval were calculated. Statistical significance was determined using the chi-square test. RESULTS: Non-breastfed children aged four months or younger were 8.2 and 6.7 times more likely to receive the family food (95% CI: 3.23-20.66 or vegetable soup (95% CI: 3.84-11.78, respectively. In the same age group, the prevalence of non-breastfed children receiving water, juice, and fruit was significantly higher in relation to breastfed children (70.7 vs 19.7%, 63.3 vs 26.7%, 33.3 vs 4.9% and 14.4 vs 1.4%, respectively. CONCLUSION: Breastfed children had healthier habits than non-breastfed children in terms of the introduction of complementary foods.

  10. Seroprevalence of Toxoplasma gondii infection in captive mammals in three zoos in Mexico City, Mexico.

    Alvarado-Esquivel, Cosme; Gayosso-Dominguez, Edgar Arturo; Villena, Isabelle; Dubey, J P

    2013-09-01

    Antibodies to Toxoplasma gondii were determined in 167 mammals in three zoos in Mexico City, Mexico, using the modified agglutination test (MAT). Overall, antibodies to T. gondii were found in 89 (53.3%) of the 167 animals tested. Antibodies were found in 35 of 43 wild Felidae: 2 of 2 bobcats (Lynx rufus); 4 of 4 cougars (Puma concolor); 10 of 13 jaguars (Panthera onca); 5 of 5 leopards (Panthera pardus); 7 of 7 lions (Panthera leo); 2 of 3 tigers (Panthera tigris); 2 of 3 ocelots (Leopardus pardalis); 2 of 2 Sumatran tigers (Panthera tigris sumatrae); lof 2 Jaguarundi (Herpailurus jagouaroundi); but not in 0 of 2 oncillas (Leopardus tigrinus). Such high seroprevalence in wild felids is of public health significance because of the potential of oocyst shedding. Four of 6 New World primates (2 of 2 Geoffroy's spider monkeys [Ateles geoffroyi], 1 of 3 Patas monkeys [Erythrocebus patas], and 1 of 1 white-headed capuchin [Cebus capucinus]) had high MAT titers of 3,200, suggesting recently acquired infection; these animals are highly susceptible to clinical toxoplasmosis. However, none of these animals were ill. Seropositivity to T. gondii was found for the first time in a number of species. PMID:24063119

  11. Trasplante Renal: una mejor alternativa para los nefrópatas crónicos

    Fernando Renjel Claros

    2010-06-01

    Full Text Available El trasplante renal desde 1954, cuando se realizó el primer trasplante renal exitoso en gemelos monocigóticos en el “PeterBent Brigham Hospital”, hasta ahora se considera como la mejor alternativa para los pacientes que tienen Enfermedad Renal Crónica Avanzada, ya que restablece no solamente la salud del paciente con enfermedad renal, sino que lo reintroduce a las actividades sociales, laborales y hasta físicas. El trasplante renal es un tratamiento eficaz, de alto costo en nuestro medio, pero accesible y más económico en relación al financiamiento que se requiere para mantener un paciente en hemodiálisis.Actualmente el trasplante renal es realizado en varios centros hospitalarios en todo el mundo con grandes resultados, por lo que el objetivo de la presente revisión es prestar información sobre la selección del donante y receptor, las contraindicaciones del trasplante, el manejo pre y post-trasplante y las complicaciones que se puedan presentar.

  12. Nutrición en el niño cardiópata

    Carlos Alberto Velasco

    2007-03-01

    Full Text Available La clasificación de las enfermedades cardíacas pediátrica, en congénitas y adquiridas, restrictivas y no restrictivas, en cianóticas y no cianóticas, quirúrgicas y no quirúrgicas y agudas y crónicas, ha sido útil para determinar el impacto en el estado nutricional de los niños. El manejo nutricional del niño con cardiopatía congénita es complejo, debido a la restricción hídrica, a los elevados requerimientos calóricos y a la prevalencia de intolerancia a los alimentos. A pesar de esto, un estrecho seguimiento y muchos métodos de alimentación son esenciales para obtener unos óptimos resultados médicos, nutricionales y psicosociales.

  13. Marchenko-Pastur Theorem and Bercovici-Pata bijections for heavy-tailed or localized vectors

    Benaych-Georges, Florent

    2012-01-01

    The celebrated Marchenko-Pastur theorem gives the asymptotic spectral distribution of sums of random, independent, rank-one projections. Its main hypothesis is that these projections are more or less uniformly distributed on the first grassmannian, which implies for example that the corresponding vectors are delocalized, i.e. are essentially supported by the whole canonical basis. In this paper, we propose a way to drop this delocalization assumption and we generalize this theorem to a quite general framework, including random projections whose corresponding vectors are localized, i.e. with some components much larger than the other ones. The first of our two main examples is given by heavy tailed random vectors (as in a model introduced by Ben Arous and Guionnet or as in a model introduced by Zakharevich where the moments grow very fast as the dimension grows). Our second main example is given by vectors which are distributed as the Brownian motion on the unit sphere, with localized initial law. Our framewor...

  14. EFFECTS OF P APPLICATION ON N AND P ABSORPTION AND SUGAR ACCUMULATION BY 1-YEAR-OLD ALOE VERA IRRIGATED WITH SEAWATER%施磷对海水灌溉下一年生芦荟氮磷吸收及糖分积累的影响

    邵晶; 刘玲; 刘兆普; 宁建凤; 郑青松

    2008-01-01

    在对大田海水灌溉试验的基础上,进行海水灌溉下的肥料试验。库拉索芦荟(Aloe vera)是一种CAM光合碳同化途径的多年生旱生经济植物,具有一定的耐盐性。在国外,芦荟研究的成果被广泛应用在医药、保健、食品等行业,已形成一大产业。最近的研究报告表明,与其他植物一样,盐分胁迫造成芦荟体内盐分积累、营养元素缺失,

  15. ¡Cuídese, no meta la pata!: sexualidad juvenil en escolares de Medellín (Colombia

    Doris Elena Ospina Muñoz

    2013-12-01

    Full Text Available Objetivo: Discutir con escolares, mediante taller educativo, resultados de investigaciones sobre sexualidad juvenil e identificar ejes para la educación sexual y la formación de docentes. Metodología: Estudio cualitativo sobre sexualidad con escolares de grado 10º en Medellín, Colombia (2008-2011. Previo consentimiento se realizaron actividades educativas sobre imagen corporal, disonancia cognitiva, maternidad y paternidad adolescente, derechos de la comunidad LGBTI y ética sexual. Se analizaron evidencias escritas bajo la modalidad de discusión de expertos. Hallazgos: Los jóvenes reconocieron la sexualidad como asunto central que requiere apropiación del cuerpo, reflexividad y comunicación efectiva con padres y maestros; sin embargo, prevalece en ellos la visión trágica de la vivencia sexual. Conclusión: Los adolescentes requieren educación para la libertad, donde participen de espacios propuestos para ellos o creados por ellos, según sus necesidades y contextos y puedan tomar decisiones autónomas y responsables.

  16. ¡Cuídese, no meta la pata!: sexualidad juvenil en escolares de Medellín (Colombia)

    Doris Elena Ospina Muñoz; Margarita María Gómez Gómez; Marcela Carrillo Pineda

    2013-01-01

    Objetivo: Discutir con escolares, mediante taller educativo, resultados de investigaciones sobre sexualidad juvenil e identificar ejes para la educación sexual y la formación de docentes. Metodología: Estudio cualitativo sobre sexualidad con escolares de grado 10º en Medellín, Colombia (2008-2011). Previo consentimiento se realizaron actividades educativas sobre imagen corporal, disonancia cognitiva, maternidad y paternidad adolescente, derechos de la comunidad LGBTI y ética sexual. Se analiz...

  17. The WHO Collaborating Centre for Research and Control of Schistosomiasis at Niamey, Niger

    Chippaux J-P

    1997-01-01

    Full Text Available The Centre de Recherche sur les Méningites et les Schistosomes (CERMES is a research institute depending on the Organisation de Coordination et de Coopération pour la lutte contre les Grandes Endémies - a West African Organization for Public Health - devoted to the studies on schistosomiasis and meningitis. The staff includes 32 persons with 11 scientists and one financial officer. The activities of the CERMES involving schistosomiasis concern three research units: (a ecology of human and animal schistosomiasis transmission; the CERMES defined the different patterns of schistosomiasis transmission in Niger (involving African dry savana; in this field, we have shown, (i the existence of important variability in conditions of transmission of S. haematobium and, (ii natural hybridization between parasitic species of the ruminants (S. bovis and S. curassoni and genetic interaction between human and animal parasites; (b definition of morbidity indicators usable for rapid assessment methods, for appraisal of the severity of the disease and for the evaluation of the efficiency of control methods; we have established the correlation between ultrasonographic data and some cheap and simple field indicators; (c immune response and protective immunity induced by recombinant glutathion S-transferase (Sm28, Sb28 and Sh28 in homologous and heterologous animal models including goats, sheep and non human primates (Erythrocebus patas. In Niger, we participate in all control programs against schistosomiasis to define control strategies, to supervise operations and to participate in their evaluation with external experts. International collaborations constitute a frame including four laboratories in Africa and six laboratories in developed countries (Europe and USA

  18. The interplay between speed, kinetics, and hand postures during primate terrestrial locomotion.

    Patel, Biren A

    2010-02-01

    Nonprimate terrestrial mammals may use digitigrade postures to help moderate distal limb joint moments and metapodial stresses that may arise during high-speed locomotion with high-ground reaction forces (GRF). This study evaluates the relationships between speed, GRFs, and distal forelimb kinematics in order to evaluate if primates also adopt digitigrade hand postures during terrestrial locomotion for these same reasons. Three cercopithecine monkey species (Papio anubis, Macaca mulatta, Erythrocebus patas) were videotaped moving unrestrained along a horizontal runway instrumented with a force platform. Three-dimensional forelimb kinematics and GRFs were measured when the vertical force component reached its peak. Hand posture was measured as the angle between the metacarpal segment and the ground (MGA). As predicted, digitigrade hand postures (larger MGA) are associated with shorter GRF moment arms and lower wrist joint moments. Contrary to expectations, individuals used more palmigrade-like (i.e. less digitigrade) hand postures (smaller MGA) when the forelimb was subjected to higher forces (at faster speeds) resulting in potentially larger wrist joint moments. Accordingly, these primates may not use their ability to alter their hand postures to reduce rising joint moments at faster speeds. Digitigrady at slow speeds may improve the mechanical advantage of antigravity muscles crossing the wrist joint. At faster speeds, greater palmigrady is likely caused by joint collapse, but this posture may be suited to distribute higher GRFs over a larger surface area to lower stresses throughout the hand. Thus, a digitigrade hand posture is not a cursorial (i.e. high speed) adaptation in primates and differs from that of other mammals. PMID:19639641

  19. Psicopatología, crimen violento, cine y realidad: desmontando mitos sobre psicópatas y psicóticos

    José Manuel Pozueco Romero; María Elena García Baamonde; Juan Manuel Moreno Manso; Macarena Blázquez Alonso

    2015-01-01

    Psicosis, esquizofrenia, paranoia, personalidad múltiple y otro sinfín de términos son los que parecen coincidir con los conceptos coloquiales y peyorativos de locos, tarados, etc. Según numerosos autores, parece ser que la psicosis es la enfermedad mental más grave que existe, y, también, es evidente la cantidad de veces que ha sido (mal) utilizada para recrear centenares de películas; el ejemplo más claro de esto mismo lo tenemos en el famoso film de Alfred Hitchcock, Psicosis, que analizam...

  20. Synthesis of Biotin Linkers with the Activated Triple Bond Donor [p-(N-propynoylamino)toluic Acid] (PATA) for Efficient Biotinylation of Peptides and Oligonucleotides

    Martina Jezowska; Joanna Romanowska; Burcu Bestas; Ulf Tedebark; Malgorzata Honcharenko

    2012-01-01

    Biotin is an important molecule for modern biological studies including, e.g., cellular transport. Its exclusive affinity to fluorescent streptavidin/avidin proteins allows ready and specific detection. As a consequence methods for the attachment of biotin to various biological targets are of high importance, especially when they are very selective and can also proceed in water. One useful method is Hüisgen dipolar [3+2]-cycloaddition, commonly referred to as “click chemist...

  1. The Efflux Pump Inhibitor Reserpine Selects Multidrug-Resistant Streptococcus pneumoniae Strains That Overexpress the ABC Transporters PatA and PatB▿ †

    Garvey, Mark I.; Piddock, Laura J. V.

    2008-01-01

    One way to combat multidrug-resistant microorganisms is the use of efflux pump inhibitors (EPIs). Spontaneous mutants resistant to the EPI reserpine selected from Streptococcus pneumoniae NCTC 7465 and R6 at a frequency suggestive of a single mutational event were also multidrug resistant. No mutations in pmrA (which encodes the efflux protein PmrA) were detected, and the expression of pmrA was unaltered in all mutants. In the reserpine-resistant multidrug-resistant mutants, the overexpressio...

  2. Reflexiones sobre psicoprofilaxis quirúrgica en niños cardiópatas (II Cuestionamiento de la psicoprofilaxis como simple información.

    M Arrazola Aranzadi

    1989-01-01

    Full Text Available Describe las ansiedades de una niña de cinco años, a la hora de enfrentarse a la operación de corazón a la que iba a ser sometida y las dificultades para asumir la información acerca de lo que le iba a suceder. Se comentan los mecanismos de defensa que más utiliza, y su evolución psicológica hasta dos años después de la operación. Los autores son partidarios de una metodología individualizada, adaptada al funcionamiento mental del niño, en la práctica de la psicoprofilaxis quirúrgica.

  3. Phototherapy with low intensity laser in carrageenan-induced acute inflammatory process in mice paw - dosimetry studies; Fototerapia com laser em baixa intensidade em processo inflamatorio agudo induzido por carragenina em pata de camundongos - estudos de dosimetria

    Meneguzzo, Daiane Thais

    2010-07-01

    The importance of modulation of inflammation on the treatment of inflammatory diseases and the difficulty in determining the laser irradiation parameters has led us to study the effects of different protocols of phototherapy with low intensity laser (power, energy, time and place of irradiation) in the treatment and prevention of edema in acute inflammatory process using the experimental model of paw edema induced by carrageenan (CGN) in three strains of mice (Balb-c, Swiss and C57BL/6). The first stage of the study evaluated different combinations of energy (1J and 3J) with different powers (30, 60 and 100mW) in Balb-C mice paw irradiated 1 and 2h after injection of CGN. The second stage studied different combinations of location (foot, inguinal lymph nodes and both) and exposure time (2 and 1h before, 1h and immediately before the CGN, 1 and 2h and 3.5 and 4.5h after CGN) using fixed irradiation parameters (1J, 100mW, 35J/cm{sup 2}, spot area of 0.028 cm{sup 2}). The third stage compared different strains of mice Balb-c and C57BL/6) in the best local and time parameters found in step 2. At all stages, we evaluated the change in paw volume by plethysmography and inflammatory infiltrate by histomorphometry or analysis of myeloperoxidase (MPO). The results showed that laser phototherapy treated and prevented edema and modulated the inflammatory process with paw and inguinal lymph nodes irradiations accordingly with the parameters and mice strain used. (author)

  4. Pata es la traviesa : La cortesana Estefanía, el engaño mutuo y la sífilis en El casamiento engañoso

    Sáez, Adrián J.

    2012-01-01

    This article analizes the figure of doña Estefanía de Caicedo, woman who Campuzano gets married, justifying her immoral behaviour for her attitude and tricks («tapada», cosmet-ics, etc.). Furthermore, it is also studied her relation with syphilis, illness she passes on to the second lieutenant inside the scheme of mutual deceive presented in this cervantine novel.

  5. Anti-inflammatory activity of Momordica charantia in edema paw and in cortisol seric modulation; Potencial antiinflamatorio da Momordica charantia no edema de pata e na modulacao do cortisol serico

    Magnata, Simey S.L.P. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear]. E-mail: sfmagnata@terra.com.br; Correia, Marilia B.L.; Brandao, Jose Odinilson C.; Souza, Grace M.L.; Catanho, Maria Teresa J.A. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Biofisica e Radiobiologia; Terra, Daniele A.; Amorim, Lucia F. [Rio Grande do Norte Univ., Natal, RN (Brazil). Dept. de Fisiologia

    2005-07-01

    The first sources that the humanity disposed to disease's treatment was plants and herbs. The Momordica charantia, Melao de Sao Caetano (bitter melon), occur in South and Central America and in East, it has been used as an anti-diabetic agent, anti-tumor, anti-helmintic and anti-ulcerogenic. The objective of this study is to research the Momordica charantia's activity on inflammatory process and the change on cortisol hormone seric concentration. To evaluate the anti-inflammatory activity were used mice (n=5) in test groups (30,60,100,250 mg/kg of extract) and control (negative and positive) groups (AAS 250 mg/kg and NaCl 0,9%); the inflammatory agent (carrageenan 1% p/v, 0,1 mL) was injected into right hind paw planter surface, 30 min after, the groups received each dose IP of extract, AAS and solution saline respectively; 4 hour after the mice was sacrificed and the difference between right and left hind foot mass was measured. There was a significant reduction (p<0,05)in carrageenan-induced edema paw at test from control group, the best result was obtained at 60 mg/kg dose which inhibits edema formation by 50%. To determinate the cortisol concentrations male Wistar rats, were divided in three groups: control, test A (2 hours of treatment) and test B (4 hours of treatment). The control group received 0,25 mL of saline solution (NaCl) 0,9% and the test groups 0,25 mL of Momordica charantia's aqueous extract, obtained by decoction of green leaves, (31,16 mg/kg animal); all by via IP. After the treatment, the animals were sacrificed and the serum obtained for realization of dosages. The cortisol was determined through radioimmunoassay. The results showed a reduction on a average by 83,9% from control group. The Momordica charantia's extract showed a high anti-inflammatory effect and was capable of reducing the seric cortisol on normal rats. (author)

  6. LEVEL OF CHOLESTEROL AND FATTY ACIDS IN THE EGGS OF DIFFERENT SPECIES OF POULTRY. TEORES DE COLESTEROL E ÁCIDOS GRAXOS EM OVOS DE DIFERENTES ESPÉCIES DE AVES

    T. T. OLIVEIRA

    2008-08-01

    Full Text Available This work had as objective to evaluate the cholesterol level fatty acids of triacylglicerol and phosphofolipids of eggs of the different poultry species. The following results were observed: cholesterol: goose duck> turkey > chicken > quail. Fatty acids of triacylglicerols: palmitic acid: turkey > quail goose > duck chicken. Estearic acid: quail chicken> goose duck perua. Oleic acid : goose > chicken> quail duck turkey. α-Linoleic acid: chicken> turkey quail > goose duck. Arachidonic acid: turkey > quail duck> chicken> goose. Docosahexanoic acid: turkey> duck goose chicken > quail. Phospholipids of fatty acids: palmí]itic acid: duck> goose quail > chicken turkey. Estearic acid: chicken turkey > quail> goose > duck. Oleic acid: duck goose > quail > turkey> chicken. α-Linoleic acid: turkey > chicken quail > duck goose. Arachidonic acid: duck > goose > quail chicken > turkey. Docosahexanoic acid: chicken> goose > turkey> quail duck. These results can be of importance for food tables and dietetic treatment of patients.

    Este trabalho teve como objetivo avaliar o teor de colesterol, ácidos graxos de triacilgliceróis e de fosfolipídeos de ovos de diferentes espécies de aves. Foram observados os seguintes resultados: As concentrações de colesterol foram maiores na: pata ≅ gansa > perua > galinha > codorna. As concentrações de ácidos graxos de triacilgliceróis: ácido palmítico: perua> gansa codorna > galinha >pata. Ácido esteárico: codorna galinha > gansa pata perua. Ácido oléico: gansa > galinha >codorna pata perua. Ácido -linoléico: galinha >codorna > perua > gansa pata. Ácido araquidônico: perua > codorna pata > galinha> gansa. Ácido docosaexanóico: perua > pata gansa galinha > codorna. Ácidos graxos de fosfolipídeos: ácido palmítico: pata > gansa codorna > galinha perua. Ácido esteárico: galinha

  7. Coping religioso-espiritual e consumo de alcoólicos em hepatopatas do sexo masculino Coping religioso-espiritual y consumo alcohólico en hepatópatas de sexo masculino Religious-spiritual coping and the consumption of alcoholic beverages in male patients with liver disease

    Maria Evangelista Martins

    2012-12-01

    Full Text Available Estudo transversal realizado com o objetivo de avaliar uso do Coping Religioso-Espiritual (CRE e verificar suas possíveis modulações com o padrão de consumo de alcoólicos em pacientes atendidos em ambulatório de hepatologia entre abril e dezembro de 2009, utilizando o CAGE, o AUDIT e a escala CRE. Foram encontradas associações entre coping religioso-espiritual negativo (CREN e consumo de alcoólicos na vida no último ano e com a combinação resultante. Sujeitos identificados como CAGE negativos com uso de baixo risco no último ano tiveram frequência acima da esperada na categoria abaixo da mediana. Os identificados como CAGE positivo com uso de médio risco foram relativamente mais frequentes na categoria acima da mediana (p=0,017. Resultados reforçam a relevância do CREN na avaliação de eventos relacionados com a saúde.Estudio transversal realizado con el objetivo de evaluar el uso del Coping Religioso Espiritual (CRE y verificar sus posibles modulaciones con el estándar de consumo de alcohol en pacientes atendidos en ambulatorio de hepatología entre abril y diciembre de 2009, utilizando el CAGE, el AUDIT y la escala CRE. Se encontraron asociaciones entre coping religioso espiritual negativo (CREN y consumo de bebidas alcohólicas en la vida, en el último año y con la combinación resultante. Sujetos identificados como CAGE negativos con abuso de bajo riesgo en el último año tuvieron frecuencia por sobre la esperada en la categoría por debajo de la mediana. Los identificados como CAGE positivo con abuso de mediano riesgo fueron relativamente más frecuentes en la categoría por encima de la mediana (p=0,017. Los resultados refuerzan la importancia del CREN en la evaluación de eventos relacionados a la salud.This cross-sectional study was performed with the objective to evaluate the use of Religious Spiritual Coping (RSC and verify its relationship with the pattern of alcoholic beverage consumption in patients attending a liver disease outpatient clinic between April and December of 2009, using the CAGE, AUDIT and RSC Scale. Associations were observed between negative religious-spiritual coping (NRSC and the consumption of alcoholic beverages over the last year and with the resulting combination. Subjects identified as negative CAGE with low-risk consumption over the last year had a frequency above the expected in the category below the median. Those identified as positive CAGE with moderate-risk consumption were relatively more frequent in the category above the median (p=0.017. Results reinforce the relevance of the NRSC in the evaluation of health-related events.

  8. Inhibition of carrageenan-induced expression of tissue and plasma prekallikreins mRNA by low level laser therapy in a rat paw edema model Inibição da expressão de RNA mensageiro de pré-calicreínas tecidual e plasmática pela laserterapia em modelo de edema de pata induzido pela carragenina em ratos

    Moisés P. Silva; Flávia Bortone; Marcelo P. Silva; Thiago R. Araújo; Maricília S. Costa; José A. Silva Júnior

    2011-01-01

    BACKGROND: Low level laser therapy (LLLT) has been used clinically in order to treat inflammation, where tissue and plasma prekallikrein have crucial importance. Plasma prekallikrein (PPK) is synthesized by the hepatocytes and secreted into the bloodstream, where it participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. Tissue prekallikrein is associated with important disease states (including cancer, inflammation, and neurodeg...

  9. Inhibition of carrageenan-induced expression of tissue and plasma prekallikreins mRNA by low level laser therapy in a rat paw edema model Inibição da expressão de RNA mensageiro de pré-calicreínas tecidual e plasmática pela laserterapia em modelo de edema de pata induzido pela carragenina em ratos

    Moisés P. Silva

    2011-02-01

    Full Text Available BACKGROND: Low level laser therapy (LLLT has been used clinically in order to treat inflammation, where tissue and plasma prekallikrein have crucial importance. Plasma prekallikrein (PPK is synthesized by the hepatocytes and secreted into the bloodstream, where it participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. Tissue prekallikrein is associated with important disease states (including cancer, inflammation, and neurodegeneration and has been utilized or proposed as clinically important biomarker or therapeutic target of interest. OBJECTIVE: To evaluate if LLLT modulates tissue and plasma prekallikreins mRNA expression in the carrageenan-induced rat paw edema. METHODS: Experimental groups were assigned as followed: A1 (Control-saline, A2 (Carrageenan-only, A3 (laser 660nm only and A4 (Carrageenan + laser 660nm. Edema was measured by a plethysmometer. Subplantar tissue was collected for the quantification of prekallikreins mRNA by Real time-Polymerase Chain Reaction. RESULTS: A significantly decrease in the edema was observed after laser irradiation. Expression of prekallikreins increased after carrageenan injection. Tissue and plasma prekallikrein mRNA expression significantly decreased after LLLT's 660nm wavelength. CONCLUSION: These results suggest that expression of tissue and plasma prekallikreins is modulated by LLLT, which can be used in clinical practice due to its anti-inflammatory effects.CONTEXTUALIZAÇÃO: A laserterapia de baixa potência tem sido usada para o tratamento de processos inflamatórios diversos em que a calicreína tecidual e a plasmática possuem participação ativa. A pré-calicreína plasmática (PPK é sintetizada pelos hepatócitos e secretada na corrente sanguínea, onde participa da ativação da coagulação, fibrinólise, geração de cininas e inflamação. A pré-calicreína tecidual está associada com importantes doenças (incluindo câncer, inflamação e neurodegeneração e tem sido utilizada ou sugerida clinicamente como importante biomarcador ou alvo terapêutico. OBJETIVO: Avaliar se a laserterapia altera a expressão gênica da pré-calicreína tecidual e da plasmática no modelo de inflamação aguda induzida pela carragenina. MÉTODOS: Quarenta ratos foram separados em quatro grupos experimentais: A1 (controle, A2 (carragenina, apenas, A3 (laser 660nm, apenas e A4 (Carragenina + laser 660nm. O edema foi medido por um pletismômetro. Tecido subplantar foi coletado para a quantificação de RNA mensageiro (RNAm de pré-calicreínas tecidual e plasmática por PCR em tempo real. RESULTADOS: Observou-se uma diminuição significativa no volume de edema após irradiação com laser 660nm. A expressão de RNAm de pré-calicreínas tecidual e plasmática aumentou após a inoculação de carragenina, entretanto a expressão gênica das pré-calicreínas diminuiu significantemente após laserterapia de baixa potência de 660nm. CONCLUSÃO: Os resultados sugerem que a expressão de RNAm das pré-calicreínas tecidual e plasmática é modulada pela laserterapia de baixa potência, podendo ser alvo terapêutico para tratamento de processos inflamatórios.

  10. Removal of suspended solids from the effluents of a shrimp farm by the Blood Ark Anadara tuberculosa (Sowerby, 1833 Remoción de sólidos suspendidos en los efluentes de una granja camaronera por la almeja pata de mula Anadara tuberculosa (Sowerby, 1833

    Anselmo Miranda

    2009-08-01

    Full Text Available The potential of Anadara tuberculosa for bioremediation of shrimp farm effluents was evaluated in five field experiments performed in a semi-intensive shrimp farm in Sonora (NW Mexico, and yielded mean filtration, clearance and biodeposition rates of 33.10 mg/h/g, 0.41 L/h/g and 31.19 mg/h/g, respectively. This study demonstrates that A. tuberculosa adults can remove the particulate matter of a semi-intensive shrimp farms effluents.Se realizaron cinco experimentos en una granja de cultivo semi-intensivo de camarón ubicada en Sonora (Noroeste de México con el fin de verificar in situ el potencial de Anadara tuberculosa para la biorremediación de los efluentes de granjas camaroneras. Se obtuvieron tasas medias de filtración y de clarificación de 33.10 mg/h/g y 0.41 L/h/g y la de biodepositación fue 31.19 mg/h/g. Este estudio demuestra que individuos adultos de A. tuberculosa pueden remover la materia particulada de los efluentes de las granjas camaroneras semi-intensivas.

  11. Removal of suspended solids from the effluents of a shrimp farm by the Blood Ark Anadara tuberculosa (Sowerby, 1833) Remoción de sólidos suspendidos en los efluentes de una granja camaronera por la almeja pata de mula Anadara tuberculosa (Sowerby, 1833)

    Anselmo Miranda; Domeno Voltolina; Gildardo Izaguirre Fierro; Isidro Osuna López; Idalia Sandoval

    2009-01-01

    The potential of Anadara tuberculosa for bioremediation of shrimp farm effluents was evaluated in five field experiments performed in a semi-intensive shrimp farm in Sonora (NW Mexico), and yielded mean filtration, clearance and biodeposition rates of 33.10 mg/h/g, 0.41 L/h/g and 31.19 mg/h/g, respectively. This study demonstrates that A. tuberculosa adults can remove the particulate matter of a semi-intensive shrimp farms effluents.Se realizaron cinco experimentos en una granja de cultivo se...

  12. On the training of Brazilian homeopaths. Sobre la capacitación de los homeópatas brasileños. Sobre a formação dos homeopatas brasileiros.

    Renato Sampaio Azambuja

    2007-01-01

    Full Text Available Although the credibility of homeopathy is raising among the Brazilian general population and government and academic institutions, the training of homeopaths disagrees with the exigences presented by clinical practice. This article discusses a proposal to reformulate the pedagogical practice, centered on the student as the builder of knowledge. The training basic block would be the small group, composed by students and a tutor; all activities would be performed in the concrete practice situation. The full process would unfold in three stages: 1 deconstruction of previous knowledge and establishment of new notions; 2 deepening into the homeopathic specific features; 3 discussion of homeopathy philosophical and epistemological issues, as well as its conection to related areas.

  13. New species of Haematoloechus (Digenea: Plagiorchidae in the lung of the foothill yellow-legged frog Rana boylii (Anura, from Humboldt County, California, USA Especie nueva de Haematoloechus (Digenea: Plagiorchidae del pulmón de la rana de patas amarillas Rana boylii (Anura, de Humboldt County, California, Estados Unidos de América

    David Zamparo

    2011-06-01

    Full Text Available A new species of Haematoloechus is described from the lungs of Rana boylii from Humboldt County, California. The new species is similar to Haematoloechus buttensis, Haematoloechus kernensis, and Haematoloechus complexus in general course of the uterus and gonad shape. It is similar to H. buttensis by having a cirrus sac terminating midway between the posterior margin of the pharynx and the anterior margin of the ovary, and having a smaller oral/ventral sucker ratio; to H. complexus by having the genital pore ventral to the pharynx, and it is similar to H. kernensis by having a larger oral sucker to pharynx width ratio. The new species is unique by lacking an extra-cecal longitudinal uterine loop from the hind-body. Molecularly, the new species differs 1.04-1.15% in partial 28S sequence with respect to H. complexus, and a monophyletic grouping of these specimens in a phylogenetic analysis of all available sequence data consistent with the species-specific status proposed herein. Evidence is also presented to suggest that specimens identified as H. buttensis in Rana pretiosa from British Columbia, Canada represents a new, but still undescribed species. The importance of conducting biological inventories of helminths, along with continued monitoring of populations, and collections based taxonomy are related.Una especie nueva de Haematoloechus es descrita de los pulmones de Rana boylii de Humboldt County, California. La especie nueva guarda semejanza con Haematoloechus buttensis, Haematoloechus kernensis, y Haematoloechus complexus en la disposición general del útero y en la forma de las gónadas. Es similar a H. buttensis en que la bolsa del cirro finaliza entre el margen posterior de la faringe y el margen anterior del ovario, y en presentar una relación menor entre la ventosa oral y el acetábulo; a H. complexus por tener el poro genital ventral a la faringe, y a H. kernensis por tener una relación mayor del ancho de la ventosa oral contra la faringe. La especie nueva es única por carecer de asas uterinas extracecales longitudinales. Molecularmente, la especie nueva muestra 1.04-1.15% de diferencia en secuencias parciales de 28S con respecto H. complexus; esta información complementa las diferencias morfológicas. También se presenta evidencia para sugerir que ejemplares identificados como H. buttensis de Rana pretiosa en British Columbia, Canadá probablemente representan una especie nueva aún no descrita. Se aborda la importancia de la realización de inventarios biológicos de helmintos, el monitoreo continuo de las poblaciones y las colecciones basadas en la taxonomía.

  14. On how a dentist can also be a homeopath. Sobre cómo un cirujano dentista tambiém puede ser homeópata. Das formas do cirurgião-dentista ser também homeopata.

    Ruth Barbosa

    2003-01-01

    Full Text Available No Brasil, a possibilidade de atuação conjunta entre Homeopatia e Odontologia iniciou-se no final do século passado, comprovando que trocar informações e conhecimento é prática indispensável entre profissionais responsáveis e visionários. A Homeopatia oferece ao cirurgião-dentista uma filosofia que expande e aprofunda a observação de seu paciente. Ao mesmo tempo, a Odontologia assessora a remoção de obstáculos mecânicos à cura, deixando ao observador homeopata apenas o que é característico e peculiar ao paciente no ambiente estomatoglossognato-cranio-cervical.

  15. Training of homeopathic physicians: current changes. Capacitación del médico homeópata: implementando cambios. A formação do médico homeopata: implementando mudanças.

    Sandra Abrahão Chaim Salles

    2003-01-01

    Full Text Available Em nosso país, sendo a homeopatia reconhecida especialidade médica pelo Conselho Federal de Medicina desde 1980, a clínica homeopática em humanos deve ser praticada por médicos com especialização em homeopatia. A Associação Médica Homeopática Brasileira (AMHB, em convênio com a Associação Médica Brasileira (AMB, confere o título de especialista em homeopatia àqueles que, após cursarem a especialização, prestarem a prova para sua obtenção. Na verdade, outros profissionais, como dentistas, médicos veterinários e farmacêuticos, também podem se tornar homeopatas, contando também com a regulamentação de suas atividades pelas associações de cada categoria.

  16. Training of homeopathic physicians: current changes. Capacitación del médico homeópata: implementando cambios. A formação do médico homeopata: implementando mudanças.

    Sandra Abrahão Chaim Salles

    2003-01-01

    Em nosso país, sendo a homeopatia reconhecida especialidade médica pelo Conselho Federal de Medicina desde 1980, a clínica homeopática em humanos deve ser praticada por médicos com especialização em homeopatia. A Associação Médica Homeopática Brasileira (AMHB), em convênio com a Associação Médica Brasileira (AMB), confere o título de especialista em homeopatia àqueles que, após cursarem a especialização, prestarem a prova para sua obtenção. Na verdade, outros profissionais, como dentistas, mé...

  17. On how a dentist can also be a homeopath. Sobre cómo un cirujano dentista tambiém puede ser homeópata. Das formas do cirurgião-dentista ser também homeopata.

    Ruth Barbosa

    2003-01-01

    No Brasil, a possibilidade de atuação conjunta entre Homeopatia e Odontologia iniciou-se no final do século passado, comprovando que trocar informações e conhecimento é prática indispensável entre profissionais responsáveis e visionários. A Homeopatia oferece ao cirurgião-dentista uma filosofia que expande e aprofunda a observação de seu paciente. Ao mesmo tempo, a Odontologia assessora a remoção de obstáculos mecânicos à cura, deixando ao observador homeopata apenas o que é característico e ...

  18. Protein (Cyanobacteria): 227779 [PGDBj - Ortholog DB

    Full Text Available ZP_18822821.1 1117:4316 1118:2919 1125:192 1126:696 1160286:25 Putative peptidase PatA homolog (fragm...LSSFLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKVFRFTIDVSDLIPVTLGEVRSWSSPN ...

  19. Protein (Cyanobacteria): 227776 [PGDBj - Ortholog DB

    Full Text Available ZP_18845350.1 1117:4316 1118:2919 1125:192 1126:696 1160285:784 Putative peptidase PatA homolog (fragm...FLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKVFRFTIDVSDLIPVTLGEVRSWSSPY ...

  20. Protein (Cyanobacteria): 227763 [PGDBj - Ortholog DB

    Full Text Available ZP_10229400.1 1117:4316 1118:2919 1125:192 1160279:2410 Putative peptidase PatA homolog (fragm...ent) Microcystis sp. T1-4 MRRTLSSFLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKIFRFTIDVSDLIPVTLGEVRSWSSPY ...

  1. Advanced photoacoustic and thermoacoustic sensing and imaging beyond pulsed absorption contrast

    Gao, Fei; Feng, Xiaohua; Zheng, Yuanjin

    2016-07-01

    In this paper, we review the recent progress in the photoacoustic (PA) and thermoacoustic (TA) imaging domain. Going beyond the conventional investigation of optical/microwave absorption contrast, this review will focus more on the new developments of PA and TA imaging towards multi-contrast mechanisms, such as multimodal PA/TA imaging, viscosity imaging, temperature monitoring, Doppler detection of flow speed, etc. In addition, several interesting techniques utilizing PA/TA will be reviewed, including photoacoustic-guided optical focusing, electrical circuit modeling of PA/TA effect, TA imaging with coherent continuous-wave (CW) magnetic and radio-frequency (RF) excitations, as well as its nonlinear effect. Finally, some prospects about the further improvement of PA/TA imaging techniques are suggested, followed by the conclusion.

  2. Methow River Steelhead - Methow River Steelhead hatchery reform research

    National Oceanic and Atmospheric Administration, Department of Commerce — Steelhead in Pacific Northwest hatcheries are typically reared for release as 1-year-old smolts, rather than the 2and 3-year-old smolt life history patterns found...

  3. Estudio de las funciones verbales y aptitudes lingüísticas en la psicopatía

    Almeida Brites, José Manuel de

    2012-01-01

    [ES] Cleckley (1976) señaló la presencia de un lenguaje hueco en el psicópata como forma de manipular. Aunque puede repetir las palabras y decir que las comprende, aparentemente no existe ninguna forma de que pueda darse cuenta de que, en realidad, no las comprende. Su empleo del lenguaje indica dificultades para exponer los argumentos sin desvíos o incoherencias sustanciales. El objetivo de este trabajo consiste en evaluar las funciones verbales y aptitudes lingüísticas en varones psicópatas...

  4. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte II) Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part II)

    J.M. Pozueco Romero; S.L. Romero Guillena; N. Casas Barquero

    2011-01-01

    La Jurisprudencia española se encuentra frecuentemente ante dictámenes periciales en los que aparecen términos como psicópata, trastorno antisocial de la personalidad, personalidad psicopática, psicópata desalmado, psicopatía epileptoide, sociopatía, etc. De esta forma, no es infrecuente que los juristas (magistrados, jueces, fiscales, abogados) se hallen desorientados ante tanta terminología que, pese a todo, en absoluto se constituyen en sinónimos. La Doctrina, por su parte, disiente de la ...

  5. Delincuente sexual en serie y alteraciones psicopáticas: una relación ocasional Repeat sex offender and psychopathic changes: An incidental relationship

    M. Ventura Alvarez; J.A. Presentación Blasco

    2003-01-01

    Los delincuentes sexuales en serie son tomados frecuentemente como psicópatas, en parte como consecuencia de la creciente popularidad del término. Un delincuente sexual en serie es aquel que ha actuado sobre dos o más víctimas en diferentes fechas; un psicópata es un tipo de trastorno de la personalidad que exhibe un patrón duradero de conductas socialmente irresponsables que desprecian los derechos de los demás. El presente trabajo presenta un caso de violador en serie interrumpido precozmen...

  6. Susceptibility of laboratory primates to infection with Mansonella ozzardi from man.

    Orihel, T C; Lowrie, R C; Eberhard, M L; Raccurt, C; Kozek, W J; Tidwell, M A; Tidwell, M

    1981-07-01

    The study was undertaken to determine primates were susceptible to infection with Caribbean and/or Amazon strains of Mansonella ozzardi of man. Twenty-three animals including three chimpanzees, four squirrel monkeys, one capuchin, five rhesus and 10 patas monkeys each received, by subcutaneous or intraperitoneal injection, 25-170 infective larvae of M. ozzardi harvested either from infected Culicoides furens collected in Haiti or Simulium sp. (sanguineum complex) collected in the Colombian Amazon and transported to our laboratories in Louisiana. Patent infections were obtained in seven of 10 patas monkeys but not in any other species of primates. The prepatent period ranged in duration from 149-186 days with a mean of 168 days. All of the patas monkeys developed modest microfilaremias that persisted for as long as 1 year, the duration of our observations. Adult worms were obtained at necropsy from three of four patas monkeys. The worms were recovered from soakings of the carcass and skin rather than from the abdominal cavity and mesenteries. However, their precise habitat was not determined. PMID:7020456

  7. Lévy laws in free probability

    Barndorff-Nielsen, Ole E.; Thorbjørnsen, Steen

    2002-01-01

    This article and its sequel outline recent developments in the theory of infinite divisibility and Lévy processes in free probability, a subject area belonging to noncommutative (or quantum) probability. The present paper discusses the classes of infinitely divisible probability measures in classical and free probability, respectively, via a study of the Bercovici–Pata bijection between these classes.

  8. CMS Young Researchers Award 2013 and Fundamental Physics Scholars Award from the CMS Experiment

    Lapka, Marzena

    2014-01-01

    Photo 2: CMS Fundamental Physics Scholars (FPSs) 1st prize: Joosep Pata, from Estonian National Institue of Chemical Physics and Biophysics / Photo 1 and 3: CMS Young Researchers Award. From left to right: Guido Tonelli, Colin Bernet, Andre David, Oliver Gutsche, Dmytro Kovalskyi, Andrea Petrucci, Joe Incandela and Jim Virdee

  9. Relation between phylogeny of African green monkey CD4 genes and their respective simian immunodeficiency virus genes

    Fomsgaard, Anders; Müller-Trutwin, Michaela C.; Diop, Ousmane; Hansen, Jan; Mathiot, Christian; Corbet, Sylvie; Barré-Sinoussi, Francoise; Allan, Jonathan S.

    1997-01-01

    mangabeys, rhesus and pig-tail macaques, chimpanzees, and humans. Chimpanzees and humans consistently clustered together. Monkeys within the Cercopithecus genus formed a separate cluster which included pata monkeys, supporting its grouping as a member of Cercopithecus. Surprisingly, sooty mangabeys were...

  10. Singid letti! / Mari Kodres

    Kodres, Mari

    2012-01-01

    Hispaania armastatuimast ja hinnatuimast toiduainest jamón ibérico'st ehk Ibeeria singist, mida tuntakse ka nime all pata negra (eesti k 'must sõrg'). Tammetõrudega toidetud Ibeeria sea lihast valmistatud parimad singid valmivad Loode-Andaluusias Sierra de Aracenas

  11. SALINE WATER RESOURCES IN CLUJ-NAPOCA SURROUNDINGS

    B. CZELLECZ

    2016-03-01

    Full Text Available Saline waters are usually researched in those places where it is used for balneotherapy or other industrial purposes. The aim of this study is to describe the saline water sources from less known areas, as they are an important natural mineral water resource. Twenty nine water samples were analyzed from Cojocna-Pata-Sopor region, thirteen of them can be considered saline waters. The visited locations are 21, 15 and 3 km far from Cluj-Napoca. Highly concentrated springs are to be found in the old mine area from Pata village and in the slough from Cojocna. Beside the well known saline lakes from Cojocna, five other saline lakes were identified; most of them are having artificial origin.

  12. Late Quaternary Activity of the Sudetic Marginal Fault in the Czech Republic: A signal of Ice Loading?

    Štěpančíková, Petra; Rockwell, T.; Hartvich, Filip; Tábořík, Petr; Stemberk, Jakub; Ortuno, M.; Wechsler, N.

    Aachen : Grützner & Reicherter Geosolutions UG, 2013 - (Grützner, C.; Rudersdorf, A.; Pérez-López, R.; Reicherter, K.), s. 259-262 ISBN 978-3-00-042796-1. [International INQUA Meeting on Paleoseismology, Active Tectonics and Archeoseismology - PATA /4./. Aachen (DE), 09.10.2013-15.10.2013] R&D Projects: GA ČR GAP210/12/0573; GA MŠk LH12078 Institutional support: RVO:67985891 Keywords : paleoseismology * active tectonics * trenching * Sudetic Marginal Fault Subject RIV: DB - Geology ; Mineralogy https://www. dropbox .com/s/wv4q79mu4sjitfh/PATA%20Days%202013%20conference%20volume.pdf

  13. Experimental and theoretical studies on electrochemical synthesis of poly(3-amino-1,2,4-triazole)

    Highlights: ► The poly(3-amino-1,2,4-triazole) was electrochemically synthesized. ► The homogeneous, colorful polymer has higher thermal and electrochemical stability. ► The correlation was observed between experimental and theoretical data. - Abstract: The electrochemical synthesis of poly(3-amino-1,2,4-triazole) (PATA) on the platinum (Pt) electrode was achieved in ammonium oxalate solution by cyclic voltammetry technique. The conductivity of film was measured with four probe technique, the surface morphology was monitored with atomic force microscopy (AFM) and characterization was achieved by Fourier transform infrared spectroscopy (FT-IR) and UV–vis spectroscopy techniques. The thermal stability of polymer has also been investigated by the means of thermogravimetric analysis (TGA). The electrochemical stability of Pt/PATA was investigated in different buffer solutions. The quantum theoretical calculations employed and some parameters (dipole moment, EHOMO, ELUMO) were determined.

  14. The Kathmandu valley : A study in regional geography

    Haffner, Willibald

    1981-01-01

    Anyone studying the map of the Kathmandu valley is struck by the almost plastic contrast between the valley bottom and its mountainous, wooded frame dissected by U-shaped valleys. A naturally favourable situation, together with a position that controls the pass of one of the most important trade and pilgrimage routes in the central Himalayas provided decisive impulses for the development of the three largest towns of Nepal: Kathmandu, Pata and Bhaktapur. More than half of the 600.000 inhabita...

  15. Fluorescence of experimental atheromatous plaques with hematoporphyrin derivative.

    Spears, J R; Serur, J; Shropshire, D; Paulin, S

    1983-01-01

    Fluorescence of hematoporphyrin derivative (HPD) has been used clinically to localize malignant neoplasms because of its selective accumulation in these tissues. We tested the hypothesis that HPD may also be selectively concentrated within atheromatous plaques. 48 h after HPD injection in a variety of species, selective fluorescence of atheromatous plaques of the aorta was seen in each animal (rabbits and Patas monkey) exhibiting such lesions. No fluorescence could be demonstrated in aortic s...

  16. Mycorrhizal bioestimulation with essential oil on Enterolobium contorsiliquum and Bauhinia forficata seedlings in soil contaminated with copper

    Rodrigo Ferreira da Silva

    2015-06-01

    Full Text Available The use of native tree species inoculated with ectomycorrhizal fungus can be an alternative for revegetation of soil contaminated with copper. The objective was to evaluate the interference of eucalyptus essential oil copper and ectomycorrhiza on growth and quality of seedlings timbaúva-preta (Enterolobium contorsiliquum and pata-de-vaca (Bauhinia forficata. The study was conducted in greenhouse for 120 days using as substrate the layer of 0-20 cm of a Red Oxisol with very clayey texture. The experimental design was completely randomized factorial (2 x 2 x 2, and “ with and without “ inoculant ectomycorrhizal essential oil and addition of 150 mg kg-1 of copper in the soil . Was evaluated the plant height, stem diameter, dry mass of shoots, roots and total length and specific surface area and root seedling quality of relations between: shoot height and stem diameter, shoot height and dry mass of shoots and the quality index of Dickson. The formation of ectomycorrhiza was identified by visualization of fungal structures and surface morphology internal and external morphology of the root system. Addition of copper reduced de stems diameter and dry mass of de aerial part of the pata-de-vaca seedlings regardless of the addition of inoculant and oil. There was no formation of ectomycorrhiza, even when applied in the essential oil of seedlings timbaúva-preta and pata-de-vaca. Growth of timbaúva-preta seedlings is stimulated by the addition of 150 mg kg – 1 of copper and has a higher rate of seedling quality in relation to pata-de-vaca.

  17. Herodot zur skythischen Sprache

    Hinge, George

    2005-01-01

    Herodots skythiske etymologier for fokenavnene Arimaspoi og Oiorpata må opgives ("enøjet" = arima "en" + spu "øje" og "manddræbende" = oior "mand" + pata "dræbe"). Artiklens forfatter foreslår i stedet nye skythiske forklaringer (*arjataspāh "hesterig" og *aiwawarakāta "enbrystet"). Herodots falske...

  18. GenBank blastx search result: AK243453 [KOME

    Full Text Available (patA), PatB (patB), PatC (patC), adenylation/heterocyclization protein (patD), patellamide precursor protei...n (patE), PatF (patF), thiazoline oxidase/subtilisin-like protease (patG), and deoxyribopyrimidine photolyase genes, complete cds. BCT 2e-17 1 ... ...AK243453 J100070G09 AY986476.1 AY986476 Prochloron didemni subtilisin-like protein

  19. Clinically relevant fluoroquinolone resistance due to constitutive overexpression of the PatAB ABC transporter in Streptococcus pneumoniae is conferred by disruption of a transcriptional attenuator

    Baylay, Alison J.; Piddock, Laura J. V.

    2014-01-01

    Objectives Constitutive overexpression of patAB has been observed in several unrelated fluoroquinolone-resistant laboratory mutants and clinical isolates; therefore, we sought to identify the cause of this overexpression. Methods Constitutive patAB overexpression in two clinical isolates and a laboratory-selected mutant was investigated using a whole-genome transformation approach. To determine the effect of the detected terminator mutations, the WT and mutated patA leader sequences were clon...

  20. Mycorrhizal bioestimulation with essential oil on Enterolobium contorsiliquum and Bauhinia forficata seedlings in soil contaminated with copper

    Rodrigo Ferreira da Silva; Clovis Da Ros; Alex Dellai; Douglas Leandro Scheid; André Luis Grolli; Hazael Soranzo de Almeida

    2015-01-01

    The use of native tree species inoculated with ectomycorrhizal fungus can be an alternative for revegetation of soil contaminated with copper. The objective was to evaluate the interference of eucalyptus essential oil copper and ectomycorrhiza on growth and quality of seedlings timbaúva-preta (Enterolobium contorsiliquum) and pata-de-vaca (Bauhinia forficata). The study was conducted in greenhouse for 120 days using as substrate the layer of 0-20 cm of a Red Oxisol with very clayey texture. T...

  1. ‘BURLEY PINAR 2010’: PRIMER CULTIVAR CUBANO DE TABACO BURLEY RESISTENTE AL MARCHITAMIENTO POR FUSARIUM (Fusarium oxysporumY A OTRAS ENFERMEDADES DE IMPORTANCIA EN EL CULTIVO

    Vivaldo García

    2015-01-01

    Full Text Available Con el objetivo de obtener un cultivar de tabaco burley resistente al marchitamiento por fusarium, al moho azul (Peronospora hyocyami de Bary y a la pata prieta (Phytophthora parasitica Dast. var. Nicotianae Breda de Haan se hizo un cruzamiento en la Estación Experimental del Tabaco de San Juan y Martínez, Pinar del Río, durante la campaña tabacalera 2004-2005 entre los cultivares `NC 1151 ́ y `Ky 910 ́. La primera resistente al moho azul y al marchitamiento por fusarium, la segunda resistente a la pata prieta. Después de cinco generaciones de autofecundación y selección por el método genealógico se obtuvo la `Burley Pinar 2010 ́ que mostró resistencia al fusarium, al moho azul y a la pata prieta. En suelo infectado por fusarium la `Burley Pinar 2010 ́ superó a `Burley Habana 13 ́ en rendimiento

  2. Adsorption kinetic, equilibrium and thermodynamic investigations of Zn(II and Ni(II ions removal by poly(azomethinethioamide resin with pendent chlorobenzylidine ring

    Kumar P. Senthil

    2015-09-01

    Full Text Available This paper reports the application of poly(azomethinethioamide (PATA resin having the pendent chlorobenzylidine ring for the removal of heavy metal ions such as Zn(II and Ni(II ions from the aqueous solutions by adsorption technology. Kinetic, equilibrium and thermodynamic models for Zn(II and Ni(II ions adsorption were applied by considering the effect of contact time, initial metal ion concentration and temperature data, respectively. The adsorption influencing parameters for the maximum removal of metal ions were optimized. Adsorption kinetic results followed the pseudo-second order kinetic model based on the correlation coefficient (R2 values and closed approach of experimental and calculated equilibrium adsorption capacity values. The removal mechanism of metal ions by PATA was explained with the Boyd kinetic model, Weber and Morris intraparticle diffusion model and Shrinking Core Model (SCM. Adsorption equilibrium results followed the Freundlich model based on the R2 values and error functions. The maximum monolayer adsorption capacity of PATA for Zn(II and Ni(II ions removal were found to be 105.4 mg/g and 97.3 mg/g, respectively. Thermodynamic study showed the adsorption process was feasible, spontaneous, and exothermic in nature.

  3. Simulación de un Robot Hexápodo Bioinspirado en el Tenebrio

    Juan Pablo Rodríguez-Calderón

    2015-06-01

    Full Text Available Los insectos son base fundamental en el estudio de la robótica reactiva ya que estos poseen características biológicas y motrices que son de interés para ser implementadas en robots bioinspirados, teniendo en cuenta el desempeño de éstos en diferentes áreas. Por otra parte los animales hexápodos poseen omnidireccionalidad y estabilidad, debido a la formación del trípode de apoyo, el cual se crea en sus patas al dar un paso, lo cual les permite sobrepasar diferentes obstáculos con facilidad y velocidad constante. En este proyecto se implementa el sistema locomotor del insecto Tenebrio debido a la facilidad con que se pueden apreciar sus movimientos. Se analiza el desplazamiento de las patas del insecto en diferentes trayectorias, vistas y terreno plano, posteriormente se encontraron los parámetros, ecuaciones y restricciones que limitan los diferentes eslabones de cada una de las patas del Tenebrio, esto se realizó por medio de un análisis de imágenes. Finalmente la información recogida se implementa en la plataforma MATLAB para determinar las características de movimiento, estabilidad y desplazamiento.

  4. Toxoplasma gondii infection in lambs: high prevalence of live parasites, and genetic characterisation of T. gondii isolates revealed new genotypes

    Little information is available on the presence of viable Toxoplasma gondii in tissues of lambs worldwide. The prevalence of T. gondii was determined in 383 lambs (< 1 year old) from Maryland, Virginia, and West Virginia. Hearts of 383 lambs were obtained from a slaughter house on the day of killing...

  5. 17-Beta estradiol and 4-nonylphenol delay smolt development and downstream migration in Atlantic salmon, Salmo salar

    Madsen, Steffen S; Skovbølling, Søren; Nielsen, Christian;

    2004-01-01

    The effect of 17-beta estradiol (E2) and 4-nonylphenol (4-NP) on smoltification and downstream migration of Atlantic salmon was studied in an integrated laboratory and field study. In a stock of hatchery-raised 1-year-old salmon, smoltification progressed from February until late May as judged by...

  6. Investigation of the pathogenesis of transplacental transmission of Aleutian mink disease parvovirus in experimentally infected mink

    Broll, S.; Alexandersen, Søren

    1996-01-01

    The transplacental transmission of Aleutian mink disease parvovirus (ADV) was studied in experimental infection of 1-year-old female non-Aleutian mink. The ADV-seronegative female mink were inoculated,vith ADV prior to mating or after the expected implantation of the embryos during pregnancy. A...

  7. Prevalence of Corneal Astigmatism in Tohono O'odham Native American Children 6 Months to 8 Years of Age

    Harvey, Erin M.; Dobson, Velma; Miller, Joseph M.; Schwiegerling, Jim; Clifford-Donaldson, Candice E.; Green, Tina K.; Messer, Dawn H.

    2011-01-01

    The prevalence of corneal astigmatism in infants and young children who are members of a Native American tribe indicates that the mean amount of corneal astigmatism is higher than reported for non–Native American populations and increases from 1.43 D in 1-year-olds to nearly 2.00 D by school age.

  8. Autonomy and Children's Reactions to Being Controlled: Evidence that Both Compliance and Defiance May Be Positive Markers in Early Development

    Dix, Theodore; Stewart, Amanda D.; Gershoff, Elizabeth T.; Day, William H.

    2007-01-01

    This study examined reactions of 1-year-olds and young 2-year-olds to being controlled by mothers. Mothers' supportive behavior predicted children's willing compliance. However, contrary to research with older children, defiance was also associated with variables linked to maternal competence, specifically, mothers' supportive behavior,…

  9. The Affective Structure of Supportive Parenting: Depressive Symptoms, Immediate Emotions, and Child-Oriented Motivation

    Dix, Theodore; Gershoff, Elizabeth T.; Meunier, Leah N.; Miller, Pamela C.

    2004-01-01

    This study investigated the maternal concerns and emotions that may regulate one form of sensitive parenting, support for children's immediate desires or intentions. While reviewing a videotape of interactions with their 1-year-olds, mothers who varied on depressive symptoms reported concerns and emotions they had during the interaction. Emotions…

  10. Creating an Amazing Montessori Toddler Home Environment

    Woo, Stephanie

    2014-01-01

    The author states that raising her twins the Montessori way has made her life easy. Imagine two 1-year-olds eating entire meals on their own, setting their own tables by 20 months, and becoming potty-trained before 2. These are not statistics found in just one household. Children raised the Montessori way can take care of themselves and their…

  11. Psychosocial Aspects of Cleft Lip and Palate: Implications for Parental Education. Research Report 138.

    Kalland, Mirjam

    This study focused on the psychosocial aspects of cleft lip and/or palate on maternal emotional reactions and the family, with emphasis on the effect on the maternal-infant bond. Interviews were conducted with 40 mothers of 1-year-old infants with non-syndromic cleft lip and/or palate. The interviews were analyzed using the phenomenological…

  12. Cow's milk and children

    Milk and children; Cow’s milk allergy - children; Lactose intolerance - children ... You may have heard that cow's milk should not be given to babies younger than 1 year old. This is because cow's milk doesn't provide enough of certain ...

  13. Isolation of new species “Peptoniphilus phoceensis” from human gut

    Mourembou, G.; Traore, S.I.; J. Rathored; Khelaifia, S.; Lagier, J.C.; Michelle, C.; Raoult, D.; Million, M.

    2016-01-01

    Taxonogenomics coupled with culturomics leads to descriptions of new bacteria. Thanks to this strategy, we report the main characteristics of “Peptoniphilus phoceensis” strain SIT15, a new bacterium isolated from a stool sample of a 1-year-old healthy Senegalese boy.

  14. Orbital lymphomatoid granulomatosis - a rare cause of proptosis

    Du Toit, Jacqueline; Kilborn, Tracy [Department of Radiology, Red Cross Children' s Hospital, Rondebosch (South Africa); Eyssen, Ann van [Department of Oncology, Red Cross Children' s Hospital, Rondebosch (South Africa); Pillay, Komala [Department of Pathology, Red Cross Children' s Hospital, Rondebosch (South Africa)

    2015-07-15

    A 1-year-old girl with unilateral proptosis was found to have primary orbital lymphomatoid granulomatosis - a condition rarely occurring in children. This multisystem angiocentric, angiodestructive, lymphoproliferative disease typically involves the lungs, with ocular involvement being extremely uncommon. Our case serves to illustrate the imaging findings of this unusual condition and highlight a rare cause of proptosis. (orig.)

  15. One-Year-Olds Think Creatively, Just Like Their Parents

    Hoicka, Elena; Mowat, Rachael; Kirkwood, Joanne; Kerr, Tiffany; Carberry, Megan; Bijvoet-van den Berg, Simone

    2016-01-01

    Creativity is an essential human ability, allowing adaptation and survival. Twenty-nine 1-year-olds and their parents were tested on divergent thinking (DT), a measure of creative potential counting how many ideas one can generate. Toddlers' and parents' DT was moderately to highly correlated. Toddlers showed a wide range of DT scores, which were…

  16. CARDIAC AND BEHAVIORAL-RESPONSES OF LONG-TERM OBESE AND LEAN ZUCKER RATS TO EMOTIONAL-STRESS

    NYAKAS, C; BALKAN, B; STEFFENS, AB; BOHUS, B

    1995-01-01

    Obesity is known as a risk factor in stress-related cardiovascular pathology in man. The length of obesity can be an important interacting variable. Therefore, cardiac and behavioral responses to emotional stress were studied in 1-year-old, genetically obese (fa/fa) and lean (Fa/-) male Zucker rats,

  17. Doing Friendship during the Second Year of Life in a Swedish Preschool

    Engdahl, Ingrid

    2012-01-01

    A number of studies within early childhood education and care indicate the importance of social competence. This article focuses on how friendship is created among very young children in Swedish preschools. The study was carried out within a toddler unit with 15 children. Six 1-year-old children, three girls and three boys, were observed during…

  18. Multiple liver abscesses in a dog secondary to the liver fluke Metorchis conjunctus treated by percutaneous transhepatic drainage and alcoholization.

    Lemetayer, Julie D; Snead, Elizabeth C; Starrak, Greg S; Wagner, Brent A

    2016-06-01

    A 1-year-old German shepherd × husky cross dog was diagnosed with multiple liver abscesses and severe cholangitis secondary to the liver fluke Metorchis conjunctus. The dog was successfully treated with 2 percutaneous transhepatic drainage and alcoholization procedures, and a prolonged course of antibiotics and praziquantel. PMID:27247459

  19. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    Balsby, T.J.S.; Hansen, P.

    2010-01-01

    Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in fiv...

  20. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte I Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part I

    J.M. Pozueco Romero

    2011-09-01

    Full Text Available Tras más de 200 años de historia, el concepto de "psicopatía" ha venido experimentando una auténtica y variopinta metamorfosis terminológica. Exceptuando aquellos períodos del Medievo en los que se creía que la psicopatía y cualquier otra conducta y personalidad "anormales" eran bien de origen demoníaco, bien de corte estrictamente hereditarista-biologicista-fisionomista-antropométrico, el resto de enfoques teórico-investigadores han arrojado sobrada luz que, a día de hoy, y tras más de 200 años de historia amarga y controvertida sobre el término, nos permiten haber llegado a un consenso generalizado entre los estudiosos de la psicopatía desde el punto de vista clínico-forense y criminológico. Este primer trabajo o Parte I es una revisión en la que se pretende ahondar en los polémicos y muchas veces incomprobables orígenes del término "psicopatía". Por otro lado, y tras intensas investigaciones empíricas realizadas desde los años 70 y centradas fundamentalmente en la población penitenciaria, modernamente se ha comenzado a hablar, de manera distintiva, tanto de los psicópatas criminales como de los psicópatas integrados, habiéndose hallado que la diferencia principal entre ambos tipos de psicópatas estriba, sencillamente, en la concreta comisión de delitos, puesto que la estructura básica de personalidad es prácticamente la misma en ambos tipos de psicópatas. Finalmente, se hace muy necesario subrayar que el carácter antisocial de la personalidad y conducta se observa, por definición, en cualquier tipo de delincuentes, sean éstos o no psicópatas, un carácter antisocial que, por otro lado, no siempre ni necesariamente se observa entre los denominados psicópatas integrados.After more than 200 years of history, the concept of "psychopathy" has been undergoing an authentic and varied terminological metamorphosis. Except for those periods in the Medieval Age in which it was believed that psychopathy and other

  1. Evaluation of averted doses to infants by tap water restrictions after the Fukushima Daiichi nuclear power plant accident

    There has been some concern in reviewing the effectiveness of making decisions on the implementation of protective measures in emergency exposure situations. After the Fukushima Daiichi nuclear power plant accident, temporal changes in the concentration of iodine 131 in tap water were studied using published data from several authorities in Fukushima, Ibaraki, and Tokyo. Averted doses to infants (1-year-old children) due to the intake of iodine 131 through tap water restrictions were also evaluated. Consequently, it was found that the apparent half-life of iodine 131 in tap water was 2.8 days. The averted equivalent doses to the thyroids of 1-year-old children were found to have a maximum value of 8.3 mSv in a local area of Fukushima. Hence, the tap water restrictions implemented by the authorities were considered to be effective in the early phase of the emergency exposure situation. (author)

  2. Efeito do meloxicam sobre a lesão de isquemia e reperfusão em músculo esquelético de ratos Effect of meloxicam on ischemia-reperfusion injury in skeletal muscle of rats

    Vitor A. Uhle

    2000-01-01

    Full Text Available Os antiinflamatórios não esteroidais, derivados do piroxicam, agem como varredores de radicais livres de oxigênio em experimentos in vitro. O objetivo deste trabalho foi analisar o efeito do meloxicam em músculos esqueléticos de ratos submetidos à isquemia e reperfusão com base na análise de liberação de malondialdeído da membrana celular ( indicador de peroxidação lipídica provocada pelos radicais livres. Dezoito ratos Wistar foram divididos em 2 grupos de 9. O grupo I (grupo sham foi tratado previamente com 3g/kg de peso de solução fisiológica e o grupo II com 3g/kg de peso de meloxicam por via peritoneal. Após 5 min os ratos foram submetidos a 3h de isquemia total ( torniquete e 45 min de reperfusão das patas posteriores esquerdas. Colheram-se biópsias dos músculos isquêmicos e reperfundidos e das patas controles (contralaterais para a dosagem de malondialdeído. A análise das diferenças de concentração do malondiadeído nas patas controles e reperfundidas no grupo I (43,7± 60,7; n=9 em relação ao grupo II (21,7± 49,5; n=9 não mostrou alteração significante (p=0,3. Os dados obtidos, neste trabalho, mostram que o meloxicam não protege a musculatura esquelética dos danos causados pela isquemia e reperfusão, com base na análise do malondialdeído tissular após 3h de isquemia e 45 min de reperfusão.

  3. Characterization of Cr. gigas oysters mortalities according to the French Ifremer/REMORA monitoring network ; with complements from phytoplankton and meteorogolical data

    Fleury, Pierre-gildas; Mazurie, Joseph; Ropert, Michel; Soletchnik, Patrick; Le Coz, Florence

    2008-01-01

    The wide range of data from the French Ifremer/REMORA network, collected since 1993 allow a global characterization of mortalities of 1-year old and 2-years old cupped oysters Crassostrea gigas, that are cultivated in the main French oyster areas (Fleury et al, 2003), and thus a better understanding of the causes of these mortalities (Ifremer /MOREST project). The average annual mortalities on intertidal sites range from 10 to 20%. Most of the mortalities take place in Spring and Summer. ...

  4. Lesch-Nyhan Syndrome: a rare disorder of self-mutilating behavior

    Mrinal Gupta

    2014-01-01

    Full Text Available This paper describes Lesch-Nyhan syndrome in a 1-year-old boy. This X-linked recessive error of purine metabolism presents in infancy with a constellation of mental and developmental retardation, self-mutilating behavior, neurological features and abnormal urine uric acid: creatinine ratio. The basic defect is deficiency in phosphoribosyl transferase production but exact pathomechanism for clinical symptomatology remains un-elucidated. No specific medical treatment is available.

  5. Report on 1Y and 6M child models

    Meyer, F.; Deck, C.; Rodarius, C.; Meijer, R.; Yang, J.

    2011-01-01

    This document is the deliverable D.2.3.2 of the CASPER project. It has been done in the framework of WP2 “Child human body modeling” task 2.3 “Develop specific human segments and whole body models per age”. This task aims to provide the meshing of the whole body models of the 1 year old child (1 Y.O

  6. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    Balsby, Thorsten Johannes Skovbjerg; Hansen, Poul

    2009-01-01

    Abstract Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in five individual male Whitethroats Sylvia communis sampled as 1- and 2-year olds. These males increased the size of their element repertoire between their first and second year, but so...

  7. Effects of IBA and Putrescine on Root Formation of Olive Cuttings

    Elham Aslmoshtaghi; Ali Reza Shahsavar; Mohammad Reza Taslimpour

    2014-01-01

    Semi-hardwood cuttings of olive cv. ‘Tokhmkabki’ (low rooting ability) and cv. ‘Roghani’ (high rooting ability) were obtained from 1-year-old shoots. Cuttings were dipped in 2000, 4000, and 6000 mg L-1 IBA, 150 or 300 mg L-1 putrescine and their combination before rooting in greenhouse equipped with an automatic mist system. Rooting ability was evaluated four months after planting for each treatment. Satisfactory rooting occurred when IBA was applied with putrescine,...

  8. Intussusception in infancy and childhood: evaluation of a prognostic scoring pattern.

    Rege V; Deshmukh S; Borwankar S; Kulkarni B

    1991-01-01

    This is a retrospective analysis of 82 patients of intussusception in infancy and childhood. Males were more than females in the ratio 2.4 : 1, the ages varied from 2 months to 12 years. Majority (73%) were less than 1 year old. Commonest presentations were pain, vomiting, distension, palpable lump and blood and mucus in stools. The management of these patients varied from barium enema reduction (3 cases), reduction by surgery and manipulation (59 cases) and resection with primary anas...

  9. The Infestation of Ectoparasites (Hirstiella spp.) Treatment with Ivermectin Solition In a Green Iguana: Case Report

    YİPEL, Fulya ALTINOK

    2014-01-01

    The Infestation of Ectoparasites (Hirstiella spp.) Treatment with Ivermectin Solition In a Green Iguana: Case Report In this study; 1 year old green iguana (Iguana iguana) which brought to a private veterinary clinic for medical examination and treatment has been subject. Results of clinical, parasitological findings of iguana which has lethargy, anorexia, itching and skin discoloration in medical history. Hirstiella spp. was diagnosed by microscopic examination of collected superficial skin ...

  10. Lag screw stabilization of a cervical vertebral fracture by use of computed tomography in a horse

    A traumatic fracture of C2 was diagnosed radiographically in a 1-year-old German Warm-blood stallion. Fracture configuration was difficult to see on survey radiographs. Computed tomography yielded a more accurate assessment of the fracture and facilitated fracture repair with cortical lag screws. Precise screw placement, to avoid spinal cord damage, was obtained by use of computed tomography. Follow-up radiography revealed normal bone healing, and the horse was in dressage schooling 24 months after surgery

  11. Marginalia no. 21

    Library, Merrill-Cazier

    2006-01-01

    Issue Number 21: Autumn 2006 “AS THE LIBRARY SHAPES STUDENTS, STUDENTS SHAPE THE LIBRARY”-A message from Director, Linda Wolcott LET US EAT CAKE! MERRILL-CAZIER LIBRARY IS 1-YEAR OLD!-The Library holds a birthday party. IDEAS IN FLIGHT-Patrick Williams on a popular birdhouse exhibit by Darrin Brooks Interior Design students. BOOKS STUDIO EXHIBIT: BASIC BINDING & BEYOND-Dennise Gackstetter describes unique book as art exhibit MORE GALLERY SPACE: FOR STUDENT EXHIBITS- A LOT MORE ...

  12. Lymphedema secondary to filariasis

    A 1-year-old immunodeficient boy developed brawny edema of the left foot. Lymphoscintigraphy revealed no evidence of left inguinal activity following pedal injection of Tc-99m-Sn phosphate. Over the next two months, the patient developed lymphedema on the right and repeat scintigraphy demonstrated no movement of isotope from the dorsum of either foot. Subsequent studies identified microfilaria in a nocturnal blood smear, which were thought to represent Brugia beaveri acquired by mosquito transmission in Oklahoma

  13. Age and Diet Affect Gene Expression Profile in Canine Skeletal Muscle

    Middelbos, Ingmar S.; Brittany M Vester; Lisa K Karr-Lilienthal; Schook, Lawrence B; Swanson, Kelly S.

    2009-01-01

    We evaluated gene transcription in canine skeletal muscle (biceps femoris) using microarray analysis to identify effects of age and diet on gene expression. Twelve female beagles were used (six 1-year olds and six 12-year olds) and they were fed one of two experimental diets for 12 months. One diet contained primarily plant-based protein sources (PPB), whereas the second diet contained primarily animal-based protein sources (APB). Affymetrix GeneChip Canine Genome Arrays were used to hybridiz...

  14. Changes in Phytochemical Synthesis, Chalcone Synthase Activity and Pharmaceutical Qualities of Sabah Snake Grass (Clinacanthus nutans L.) in Relation to Plant Age

    Ali Ghasemzadeh; Alireza Nasiri; Jaafar, Hawa Z. E.; Ali Baghdadi; Izham Ahmad

    2014-01-01

    In the current study, changes in secondary metabolite synthesis and the pharmaceutical quality of sabah snake grass leaves and buds were considered in relation to plant age (1 month, 6 months, and 1 year old). The activity of the enzyme chalcone synthase (CHS, EC 2.3.1.74) was measured, as it is a key enzyme for flavonoid production. Significant differences in total flavonoid (TF) production were observed between the three plant growth periods and the different plant parts. The highest conten...

  15. Lymphedema secondary to filariasis

    Leonard, J.C.; Humphrey, G.B.; Basmadjian, G.

    1985-03-01

    A 1-year-old immunodeficient boy developed brawny edema of the left foot. Lymphoscintigraphy revealed no evidence of left inguinal activity following pedal injection of Tc-99m-Sn phosphate. Over the next two months, the patient developed lymphedema on the right and repeat scintigraphy demonstrated no movement of isotope from the dorsum of either foot. Subsequent studies identified microfilaria in a nocturnal blood smear, which were thought to represent Brugia beaveri acquired by mosquito transmission in Oklahoma.

  16. Magnetic resonance in diagnosis of ureterocele

    Nascimento, Humberto do; Hachul, Mauricio; Macedo Junior, Antonio [Universidade Federal de Sao Paulo (UNIFESP/EPM), SP (Brazil). Div. de Urologia]. E-mail: humbertojr1@aol.com

    2003-05-15

    Ultrasonography is the main non-invasive technique for screening of ureterocele, but presents some difficulties for its diagnosis. Other supplementary diagnostic methods have the disadvantage of being invasive or using ionizing radiation. Magnetic resonance (MR) has a high sensitivity for diagnosing urinary tract malformations in adults and children. We report one case of ureterocele in a 1-year old child with the purpose of presenting its diagnosis through MR. (author)

  17. Magnetic resonance in diagnosis of ureterocele

    Ultrasonography is the main non-invasive technique for screening of ureterocele, but presents some difficulties for its diagnosis. Other supplementary diagnostic methods have the disadvantage of being invasive or using ionizing radiation. Magnetic resonance (MR) has a high sensitivity for diagnosing urinary tract malformations in adults and children. We report one case of ureterocele in a 1-year old child with the purpose of presenting its diagnosis through MR. (author)

  18. Cardiopulmonary exercise testing – effective method for evaluation and recommendation of individualized exercise training in patients with metabolic syndrome

    Claudiu Avram; Mihaela Oraviţan; Lucian D. Hoble; Bogdan Almăjan-Guţă

    2011-01-01

    The present study aims to emphasize the role of cardiopulmonary exercise training (CPET) in evaluation and recommendation of individualized exercise training in patients with a metabolic syndrome. Methods: We performed a prospective longitudinal study of 9 months. The study group consisted of 28 young patients (21.3±3.1 years old) without contraindications to exercise, previously diagnosed with metabolic syndrome according to NCEP-ATPIII criteria. All patients were evaluating at baseline and ...

  19. Infant Cardiac CT Angiography with 64-Slice and 256-Slice CT: Comparison of Radiation Dose and Image Quality Using a Pediatric Phantom

    Lee, Yi-Wei; Yang, Ching-Ching; Mok, Greta S. P.; Wu, Tung-Hsin

    2012-01-01

    Background The aims of this study were to investigate the image quality and radiation exposure of pediatric protocols for cardiac CT angiography (CTA) in infants under one year of age. Methodology/Principal Findings Cardiac CTA examinations were performed using an anthropomorphic phantom representing a 1-year-old child scanned with non-electrocardiogram-gated (NG), retrospectively electrocardiogram-gated helical (RGH) and prospectively electrocardiogram-gated axial (PGA) techniques in 64-slic...

  20. Chronic granulomatous disease presenting as retinal mass

    Ahmad M. Mansour; Al Dairy, Mays; Hamam, Rola; Hidayat, Ahmed A

    2008-01-01

    1-year-old girl was admitted for fever of unknown origin. Funduscopy revealed juxtapapillary retinal inflammatory mass in one eye with a differential diagnosis of sarcoidosis, tuberculosis, retinoblastoma or metastatic disease. Retinal biopsy showed necrotizing granulomatous retinitis. Extensive workup and therapeutic trials failed to confirm the diagnosis of tuberculosis or sarcoidosis. Her 7-month brother and 4-year-old male cousin presented with nystagmus, poor vision, paravascular pigment...

  1. Femoral kontroll blant idrettsaktive kvinner : testutvikling og sammenheng med skadehistorikk

    Østvold, Mattis

    2011-01-01

    Purpose: Non-contact knee injuries are often the topic of discussion in relation to injury prevention. The purpose of this study was to develop a standardized test and a standardized analysis method for quantifying changes in the femoral control in a simple but reliable way. We also wanted to quantify the relationship between femoral control and injury history in the sample. Method: Female athletes (n = 95, age = 18 ± 1 years old) who were active in various sports, conducted two weak links...

  2. Macronuclear chromatin structure dynamics in Colpoda inflata (Protista, Ciliophora) resting encystment.

    Tiano, L; Chessa, M G; Carrara, S; Tagliafierro, G; Delmonte Corrado, M U

    1999-01-01

    The chromatin structure dynamics of the Colpoda inflata macronucleus have been investigated in relation to its functional condition, concerning chromatin body extrusion regulating activity. Samples of 2- and 25-day-old resting cysts derived from a standard culture, and of 1-year-old resting cysts derived from a senescent culture, were examined by means of histogram analysis performed on acquired optical microscopy images. Three groups of histograms were detected in each sample. Histogram classification, clustering and matching were assessed in order to obtain the mean histogram of each group. Comparative analysis of the mean histogram showed a similarity in the grey level range of 25-day- and 1-year-old cysts, unlike the wider grey level range found in 2-day-old cysts. Moreover, the respective mean histograms of the three cyst samples appeared rather similar in shape. All this implies that macronuclear chromatin structural features of 1-year-old cysts are common to both cyst standard cultures. The evaluation of the acquired images and their respective histograms evidenced a dynamic state of the macronuclear chromatin, appearing differently condensed in relation to the chromatin body extrusion regulating activity of the macronucleus. The coexistence of a chromatin-decondensed macronucleus with a pycnotic extrusion body suggests that chromatin unable to decondense, thus inactive, is extruded. This finding, along with the presence of chromatin structural features common to standard and senescent cyst populations, supports the occurrence of 'rejuvenated' cell lines from 1-year-old encysted senescent cells, a phenomenon which could be a result of accomplished macronuclear renewal. PMID:10439214

  3. ‘COROJO 2006’: NUEVA VARIEDAD CUBANA DE TABACO NEGRO (Nicotiana tabacum L.)

    Vivaldo García Morejón; Nancy Santana Ferrer; Humberto García Cruz; Emis Mena Padrón

    2013-01-01

    En la Estación Experimental del Tabaco, de San Juan y Martínez, Pinar del Río durante la campaña tabacalera 2001-2002, se realizó un cruzamiento sexual con el objetivo de obtener una variedad de tabaco negro con mayor rendimiento que la comercial ‘Criollo 98’, resistente al moho azul ( Peronospora hyocyami de Bary), a la pata prieta ( Phytophthora parasitica Dast. var . Nicotianae Breda de Haan), al virus del mosaico del tabaco (VMT) y a la necrosis ambiental. Después de cinco generaciones de...

  4. Caracterización comparativa a la faena de cinco híbridos experimentales de pollo campero con diferente genotipo materno

    Dottavio, Ana María; Advínculo, S. A.; Librera, J. E.; Romera, Bernardo Martín; Canet, Zulma E.; Di Masso, Ricardo

    2014-01-01

    Se evaluaron la proporción de pechuga, pata muslo y grasa abdominal y el rendimiento a la faena de machos pertenecientes a cinco grupos genéticos experimentales de pollos camperos. Los grupos provenían del cruzamiento entre gallos de la población sintética paterna AH’, mejorada por tasa de crecimiento y eficiencia alimenticia y gallinas de cinco poblaciones sintéticas maternas. Como grupo testigo se utilizaron machos contemporáneos de la versión tradicional de Campero INTA. Las aves producto ...

  5. A síndrome anserina Anserine syndrome

    Milton Helfenstein Jr; Jorge Kuromoto

    2010-01-01

    Dor no joelho é uma condição comum na clínica diária e a patologia anserina, também conhecida como pata de ganso, tem sido considerada uma das principais causas. O diagnóstico tem sido realizado de maneira eminentemente clínica, o que tem gerado equívocos. Os pacientes queixam-se tipicamente de dor na parte medial do joelho, com sensibilidade na porção ínferomedial. Estudos de imagem têm sido realizados para esclarecer se tais pacientes possuem bursite, tendinite ou ambos os distúrbios na reg...

  6. Post Mortem y Tony Manero

    Urrutia, Carolina

    2015-01-01

    Post Mortem, el tercer largometraje de Pablo Larraín, podría ser el preludio de su cinta anterior Tony Manero ; el momento en que el protagonista (en ambas instancias interpretado por Alfredo Castro), cae irreversiblemente en la locura y se vuelve psicópata. La apuesta en ambos filmes es extrema porque asume la representación y la relectura de una época extrema, donde la demencia que se activa con el régimen militar ya parece estar instalada en la sociedad que lo origina y que ahora simplemen...

  7. SALINE WATER RESOURCES IN CLUJ-NAPOCA SURROUNDINGS

    B. CZELLECZ; I. GÁBOR; L. RAVASZ; G. ȘCHIOPU; N. SZOPOS

    2016-01-01

    Saline waters are usually researched in those places where it is used for balneotherapy or other industrial purposes. The aim of this study is to describe the saline water sources from less known areas, as they are an important natural mineral water resource. Twenty nine water samples were analyzed from Cojocna-Pata-Sopor region, thirteen of them can be considered saline waters. The visited locations are 21, 15 and 3 km far from Cluj-Napoca. Highly concentrated springs are to be found in the ...

  8. Japan, quality tourist destiny: a learner option for Colima

    Irma Magaña Carrillo

    2007-01-01

    In this research feature presentation some results are presented as "A Propose Plan to implement a Culture with Quality Control in Tourism Business making Mexico an Attractive site in the Asia-Pacific market and Active within the PATA organism in the XXI Millennium". Which was performed in Japan from 2001 to 2004. This thesis acquires the category of qualitative and emergent and it arouse as a first attempt in reaching the point of a systematic application of the theory of the Model for Total...

  9. Productividad secundaria en los esteros de la barra de arena El Mogote en la Ensenada de La Paz, Baja California Sur, México Secondary productivity in the estuaries of El Mogote sand bar in Ensenada de La Paz, Baja California Sur, Mexico

    Jorge A. López-Rocha; Esteban F. Félix-Pico; Martín E. Hernández-Rivas

    2012-01-01

    Los ecosistemas de manglar son un hábitat crítico para numerosas especies y su productividad es importante por su contribución de detritos orgánicos y su producción secundaria. El objetivo del trabajo fue definir indicadores de productividad secundaria para establecer una línea base que permita medir alteraciones en el sistema de manglar por posibles perturbaciones naturales o antropogénicas. Como indicadores se escogieron los moluscos bivalvos pata de mula, Anadara tuberculosa y el ostión de...

  10. Potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da nimesulida por vitaminas do complexo B

    L. A. Rodrigues; J. F. Fracasso; C. E. Siqueira

    2009-01-01

    Investigou-se os efeitos de algumas vitaminas B associadas ao diclofenaco ou nimesulida, na contorção abdominal em camundongos e edema de pata em ratos apenas com a nimesulida ou sua associação com algumas vitaminas B. Verificou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B

  11. Efeito do tratamento com algumas vitaminas B na potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da talidomida

    L. A. Rodrigues; P. H.B. Godói; C. E. Siqueira; M. C. Longo; J. F. Fracasso; N. M.K. NAKAEMA

    2009-01-01

    Mostrou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], isoladas ou administradas conjuntamente, não inibiu o edema de pata produzido pela carragenina em ratos, nem as contorções abdominais produzidas pelo ácido acético em camundongos. Por outro lado, o ...

  12. Actividad antinociceptiva, anti-inflamatoria y relajante muscular de (+)-curcufenol aislado de la esponja marina didiscus oxeata

    Salama, Ahmed; Toscano, Mariela; Del Valle, Martha; Vargas, Erika

    2008-01-01

    Mediante el método de edema plantar inducido por carragenina en la pata de la rata, (+)-curcufenol aislado de la esponja marina Didiscus oxeata mostró una actividad antiinflamatoria moderada, en las dosis de 100, 150 y 200 mg/kg administradas por vía oral, mientras que la actividad antinociceptiva fue confirmada por el método de contorsiones inducidas por ácido acético en ratones mostrando un efecto analgésico muy alto, en las dosis de 50, 100, 150 y 200 mg/kg administradas por vía oral, en c...

  13. Resultados de la cirugía del LCA : platias mixtas biológicas-sintéticas

    Manzano Serrano, Emilio

    1995-01-01

    Se estudian 58 casos de lesiones de ligamento cruzado anterior (LCA), aisladas o combinadas que dan lugar a inestabilidad anterior de la rodilla. Se realizan reconstrucciones intraarticulares con plastia mixta de tendones de la pata de ganso con aumento de fibra sintética de polipropileno trenzado (Kennedy-Lad) o de poliester de polietilenotereftalato (Leeds-Keio), durante el periodo comprendido entre 1988-1992, con un seguimiento mínimo de dos años. Las dos técnicas difieren en el paso artic...

  14. El anciano con cardiopatía terminal

    Martínez Sellés Oliveria Soares, Manuel

    2009-01-01

    El objetivo de este documento es aportar un punto de vista experto que permita un mejor conocimiento de la situación y una mejora en el manejo y la toma de decisiones en los últimos días de vida del paciente de edad avanzada que sufre una cardiopatía. Los cardiópatas ancianos constituyen un grupo heterogéneo y es necesaria una valoración exhaustiva, especialmente de los factores que condicionan el pronóstico (cardiopatía, comorbilidad, situación funcional y datos de fragilidad) antes de tomar...

  15. La "Dea Artio" celta y la "Artemis" griega: Un aspecto religioso de la afinidad celto-iliria

    Ruipérez, Martín S.

    2009-01-01

    En una partida de estatuillas romanas de bronce encontradas en 1832 en Muri, en las inmediaciones de Berna (Suiza), se hallaban una figura de osa, una diosa sentada teniendo una patera con frutas, una cesta, un árbol tortuoso y un pedestal con la inscripción Deae Artioni/ Licinia Sabinilla. En seguida se vio que la diosa, el cesto y el árbol tenían su sitio señalado en el pedestal, pero hasta 1899 no se reconstruyó el grupo en su integridad al probar Vionnet que las patas de la osa habían dej...

  16. Potencial antioxidante in vitro das folhas da Bauhinia ungulata L.

    Cristiane da Silva Paula; Vanessa Cristina Dias Canteli; Beatriz Cristina Konopatzki Hirota; Ranieri Campos; Vinícius Bednarczuk de Oliveira; Milena Kalegari; Cristiane Bezerra da Silva; Geciani Miriam Silva; Obdúlio Gomes Miguel; Marilis Dallarmi Migue

    2014-01-01

    A Bauhinia ungulata L. (Pata de Vaca) é uma planta nativa do Brasil, encontrada principalmente na região Amazônica, Cerrado e Mata Atlântica, utilizada popularmente no tratamento do diabetes. Este trabalho descreve uma análise in vitro do potencial antioxidante do extrato bruto etanólico e frações (hexano, clorofórmio, acetato de etila e hidroalcoólica residual) obtidos de folhas desta espécie, através de três metodologias distintas: 1) captura de radical orgânico 2...

  17. Diseño y control reactivo de robots caminantes sobre terreno natural

    Nabulsi Abussaid, Samir

    2008-01-01

    En las últimas décadas se ha constatado el creciente interés que presentan los robots caminantes, tanto desde el punto de vista de la investigación básica como de sus potenciales aplicaciones. Una de las principales características de los robots equipados con patas es su capacidad para poder desplazarse sobre una amplia variedad de terrenos no estructurados. Esta particularidad los hace muy atractivos e interesantes para su aplicación práctica como robots de servicios en los que se requiere l...

  18. Esquemas cognitivos en personas con conducta de juego patológico y su relación con experiencias de crianza

    Ana Estévez; Esther Calvete

    2007-01-01

    Este estudio evaluó si las personas con juego patológico presentaban esquemas negativos disfuncionales y recordaban estilos de crianza negativos en sus padres y madres durante su infancia. Participó una muestra de 167 ludópatas (77,2% hombres y 22,8% mujeres) y un grupo de contraste de 167 personas sin ludopatía (71,1% hombres y 28,9% mujeres). Se obtuvieron medidas de esquemas cognitivos negativos y de estilos parentales. Los resultados mostraron que las personas con juego patológico puntuab...

  19. Efecto de melatonina exógena en procesos inflamatorios agudos y crónicos en ratas

    Rocha, Nadir de la; Rotelli, Alejandra Ester; Pelzer, Lilian

    2002-01-01

    Se investigó la influencia de melatonina (4 mg/kg) en la inflamación aguda usando el modelo de edema de pata en rata y en la inflamación crónica mediante la prueba del granuloma y artritis inducida por adyuvante. Melatonina inhibió el edema producido por carragenina en el modelo agudo, pero no presentó acción inhibitoria en la fase proliferativa de la prueba del granuloma y en la fase aguda y crónica de la artritis inducida por adyuvante. Estos resultados sugieren que melatonina, a la m...

  20. Grupos de Discusión y HJ-Biplot: Una Nueva Forma de Análisis Textual

    Daniel Caballero Julia; Purificación Vicente Galindo; Mª Purificación Galindo Villardón

    2014-01-01

    Este trabajo da un paso más allá en la integración de métodos cualitativos de investigación y técnicas cuantitativas analizando Grupos de Discusión desde una perspectiva multivariante con el apoyo del HJ-Biplot. Una propuesta metodológica que combina la codificación cualitativa con un nuevo valor matemático de caracterización. La propuesta se aplica al estudio de las representaciones en el discurso sobre Calidad de Vida de los ludópatas.

  1. Informe de nuevas variedades IT-2004: NUEVA VARIEDAD DE TABACO NEGRO CUBANO (Nicotiana tabacum L.

    E. Espino

    2005-01-01

    Full Text Available La nueva variedad de tabaco negro cubana 'IT-2004' posee un potencial de rendimiento de 2370 kg.ha-1 (700 qq/cab., con 20-22 hojas aprovechables por planta, es altamente resistente al moho azul, la pata prieta y necrosis ambiental y resistente a la sequía. Su calidad organoléptica responde al patrón del tabaco negro cubano, aunque con una fortaleza media, de ligera a medianamente fuerte, lo que permite su utilización como productora de materia prima para la industria cigarrera nacional.

  2. COMPOSICIÓN QUIMICA DE LA LECHE, DIGESTIBILIDAD in vitro DE LA MATERIA SECA Y PRODUCCIÓN EN VACAS ALIMENTADAS CON GRAMÍNEAS SOLAS O ASOCIADAS CON Lotus uliginosus

    A. Morales

    2013-01-01

    Full Text Available La presente investigación tuvo como objetivo evaluar el uso de la leguminosa Lotus uliginosus como alternativa de inclusión dentro de las praderas en dos ecorregiones estratégicas de la sabana de Bogotá. en cada finca se evaluaron cuatro tratamientos: 1 kikuyo solo (P. clandestinum, 2 kikuyo asociado con trébol pata de pájaro ( P.clandes-tinum + L. uliginosus, 3 festuca alta sola (F. arundinacea y 4 Festuca alta asociada con trébol pata de pájaro (F. arundinacea + L. uliginosus. el número de bovinos varió de acuerdo a la capacidad de carga de cada finca. se utilizaron animales que se encontraban en el segundo tercio de lactancia durante un período experimental de siete días. en cada tratamiento se determinó la producción (L/día y calidad de leche (% de grasa, proteína y sólidos totales; en la pastura se evaluó la composición química (Ms, Fdn, Fda y la digestibilidad in vitro de la materia seca (divMs. se midió el consumo voluntario. en la finca Megaleche la producción de biomasa presentó diferencias significativas (P<0,05 entre los tratamientos destacándose el tratamiento del kikuyo solo; la calidad nutricional de las pasturas también presentó diferencias (P<0,04 destacándose el tratamiento de kikuyo + trébol pata de pájaro, asociación que también se destacó en consumo voluntario (P< 0.05 y producción de leche (P<0,05. en la finca Colega el contenido de proteína del forraje presentó diferencias cuando las gramíneas se asociaron con el trébol pata de pájaro (P<0,001. se concluyó que la introducción del Lotus en las praderas mejoró la producción de leche y consumo de materia seca en los animales.

  3. El concepto de "Constitución" en el Río de La Plata (1750-1850)

    Noemí Goldman

    2007-01-01

    Este artículo estudia los cambios y permanencias en el significado del concepto de constitución en el Río de la Plata en un arco temporal de importantes cambios políticos. En sus particulares modulaciones semánticas, el concepto da cuenta del conflictivo proceso de revolución, guerras de independencia y disputas en torno al ejercicio y a la definición de la soberanía entre los pueblos que emergieron de la crisis de la Monarquía española de 1808. En efecto, el Río de la Pata ...

  4. Estado da arte de Bauhinia forficata Link (Fabaceae) como alternativa terapêutica para o tratamento do Diabetes mellitus

    Graziella Silvestre Marques; Larissa Araújo Rolim; Lariza Darlene Santos Alves; Caio César de Andrade Rodrigues Silva; Luiz Alberto Lira Soares; Pedro José Rolim-Neto

    2013-01-01

    O Diabetes mellitus, por tratar-se de uma doença crônica e por apresentar um crescimento acentuado na sociedade brasileira, tornou-se alvo da comunidade científica na busca de novas alternativas terapêuticas. Diversos estudos estão sendo desenvolvidos com o objetivo de comprovar as aparentes propriedades farmacológicas de espécies vegetais empregadas no tratamento desta enfermidade. Sendo assim, a Bauhinia forficata Link, comumente conhecida como pata-de-vaca, figur...

  5. Dicty_cDB: Contig-U01479-1 [Dicty_cDB

    Full Text Available EMATOLOGICAL MALIGNANCY. 36 0.11 2 ( DI141804 ) Prognostic for hematological malignancy. 36 0.11 2 ( CS247571 ) Sequence 23 from Pat...A: 40 X1: 6 (11.9 bits) X2: 15 (29.7 bits) S1: 12 (24.3 bits) S2: 15 (30.2 bits) dna update 2009. 4.28 Homolog...( FD457023 ) EGGBB39TR Haematobia irritans eggs Haematobia irr... 46 5e-05 2 ( FD451921 ) EGGAE38TR Haematobia irritans eggs Haemato...bia irr... 46 5e-05 2 ( FD451498 ) EGGAB75TR Haematobia irritans eggs Haematobia irr...tt ttattniasspngiptttttttgitstnhndattstiptnddgtsnatrw*wcd--

  6. En búsqueda de un desarrollo regional sustentable: propuesta de una comunidad turística rural, Moctezuma, Sonora

    Grajeda Bustamante, Gabriela; García Porchas, Mercedes; Santiago Hernández, Víctor Guadalupe; Córdova Yánez, Alejandro

    2010-01-01

    Moctezuma, municipio ubicado en la zona serrana del estado de Sonora a 175 kilómetros de la capital; es reconocido aparte de su trabajo artesanal de talabartería por ser el lugar en el que confluyen aproximadamente 16 municipios de la zona serrana; es desde este ayuntamiento que se enmarca la diferencia entre poblaciones o municipios de la sierra baja y sierra alta; con una población de 4322 habitantes para el 2005 según datos del INEGI, fundado en 1644 con descendencia ópata, Moctezuma cobra...

  7. Free Completely Random Measures

    Collet, Francesca

    2011-01-01

    Free probability is a noncommutative probability theory introduced by Voiculescu where the concept of independence of classical probability is replaced by the concept of freeness. An important connection between free and classical infinitely divisibility was established by Bercovici and Pata (1999) in form of a bijection, mapping the class of classical infinitely divisible laws into the class of free infinitely divisible laws. A particular class of infinitely divisible laws are the completely random measures introduced by Kingman (1967). In this paper, a free analogous of completely random measures is introduced and, a free Poisson process characterization is provided as well as a representation through a free cumulant transform. Furthermore, some examples are displayed.

  8. Propuesta de una guía de práctica clínica integral entre homeopatía y alopatía de la patología más prevalente en el servicio de hospitalización pediátrica

    León Álvarez, Gissela

    2011-01-01

    Se realizó el ejercicio de adaptación de una guía de práctica clínica de Bronquiolitis utilizando una herramienta epidemiológica nueva denominada procedimiento ADAPTE, con este ejercicio se pretende crear un modelo de atención que integre los conocimientos en medicina alopática convencional y los de Homeopatía, que permita a los médicos pediatras y homeópatas en ejercicio cumplir con el requerimiento legal para la habilitación de sus consultorios. Durante el proceso se realizó la determina...

  9. Antocianinas em extratos vegetais: aplicação em titulação ácido-base e identificação via cromatografia líquida/espectrometria de massas

    Wesson Guimarães

    2012-01-01

    Full Text Available Anthocyanins extracted from picao, quaresmeira, petunia, flamboyant, purple ipe, lobeira, pata de vaca, jaboticaba, purple cabbage and jambul were evaluated as natural acid-base indicators. Anthocyanins in extracts were identified using HPLC/MS. Clear, rapid change in color at final-point titration was observed for extracts but only picao showed strong change in pH. Indirect determination of carbonate in limestone using a natural indicator was performed and results compared with phenolphthalein indicator and potentiometer titration. Optimal results were obtained with picao but other extracts showed good accuracy and precision.

  10. La globalización y su impacto en la economía de la educación en el sistema educativo público de Puerto Rico

    Pizarro Figueroa, J.

    2010-01-01

    En este mundo globalizado la educación se constituye en un factor indispensable pata el crecimiento del ser humano y su sociedad. La educación es determinante para el crecimiento económico, social y ecológico de un país. En este ensayo presentamos un análisis sobre la economía de la educación. A tales fines, comenzaremos discutiendo el concepto de la globalización y sus características, tanto sus ventajas como desventajas. Posteriormente, analizaremos la economía de la educación en el Sistema...

  11. Glucose metabolism in rats submitted to skeletal muscle denervation

    Wilton Marlindo Santana Nunes

    2005-07-01

    Full Text Available This study analyzed the local and systemic effects of immobilization by denervation of the skeletal muscle on glucose metabolism. The rats were submitted to section of the right paw sciatic nerve. A reduction was observed in glucose uptake by the isolated soleus muscle of the denervated paw after 3 and 7 days, but not after 28 days in relation to the control animals. There was no difference after 3 and 7 days in glucose uptake by the soleus muscle of the opposite intact paw in relation to the control. There was increased glucose uptake in the same paw 28 days after denervation. The rate of glucose removal in response to exogenous insulin after 28 days of denervation was significantly higher than in control animals and those observed after 3 and 7 days of denervation. These results suggest that immobilization by denervation interfered not only in glucose metabolism in the skeletal muscle involved but also in other tissues.O estudo analisou os efeitos locais e sistêmicos da imobilização por desnervação do músculo esquelético sobre o metabolismo glicidico. Ratos foram submetidos à secção do nervo ciático da pata direita. Observou-se redução da captação de glicose pelo músculo sóleo isolado da pata desnervada após 3 e 7 mas não após 28 dias em relação a animais controle. Não houve diferença após 3 e 7 dias na captação de glicose pelo músculo sóleo da pata contralateral intacta em relação ao controle. Houve aumento da captação de glicose nesta mesma pata 28 dias após a desnervação. A taxa de remoção da glicose em resposta à insulina exógena após 28 dias de desnervação foi significantemente superior à do controle e àquelas observadas após 3 e 7 dias da desnervação. Esses resultados sugerem que a imobilização por desnervação interfere não só no metabolismo da glicose no músculo esquelético envolvido como também em outros tecidos.

  12. 14C-AMS as a tool for the investigation of mercury deposition at a remote Amazon location

    We present results of the atmospheric mercury deposition rate in the Amazon region during the last 43 000 years. Lake sediment samples were collected from the Lagoa da Pata, a small and remote lake in northern Brazilian Amazon. The samples were divided in sub-samples, for C, Hg, N and 14C-AMS analyses. Three main paleoclimatic events could be identified. The mercury accumulation rates were found to be larger during the periods of the Holocene and Pleistocene associated with high temperatures and frequency of forest fires

  13. Denitrification capacity of bioreactors filled with refuse at different landfill ages

    The denitrification capacity of refuse at different landfill ages in bioreactor landfill system was studied. Three reactors filled with 1-year-old refuse (R1), 6-year-old refuse (R6) and 11-year-old refuse (R11), respectively, were operated in the experiment. Nitrate solution (1000 mg NO3--N L-1) was added into each reactor. The results showed that the reactors were all able to consume nitrate. However, 1-year-old refuse in R1 had both a higher nitrate reduction rate and concentration of N2. In addition, vertical differences in nitrate removal along the depth of R1 were observed. The bottom-layer refuse and the middle-layer refuse both showed higher efficiency in nitrate depletion than the top layer. Furthermore, N2O accumulation was found in R11 with the concentration up to 19.3% of the released gas. These results suggested that 1-year-old refuse, which was partly degraded, was more suitable to use as denitrification medium.

  14. Sex and age differences in meat composition of Yeso sika deer (Cervus nippon yesoensis) reared for a short period after capture in the wild.

    Hayashida, Maki; Souma, Kousaku; Sugo, Kazuki; Araki, Shin-Ichi; Ishizaka, Fumiaki; Ueda, Masami; Kasai, Takamasa; Masuko, Takayoshi

    2015-02-01

    Yeso sika deer captured in winter around Lake Akan in Hokkaido were reared for 8-10 months at Tokyo University of Agriculture in Abashiri. Six 1-year-old females and males and six 2-year-old or older (adult) females and males were slaughtered and their carcasses were processed. The chemical composition, mineral contents and fatty acid composition of the loin were measured. No marked influence of gender or age was noted in the chemical composition of loin. In the mineral contents, significant differences were noted. The potassium and sulfur contents were lower and the sodium content was higher in adult deer meat (P < 0.05, respectively) and the potassium content was higher in male deer meat (P < 0.05). Arsenic, cadmium or lead were not detected. In the unsaturated fatty acid, a significant interaction was detected (P < 0.05), and it was high in 1-year-old female deer meat and low in 1-year-old male deer meat. Significant gender or age differences were noted only in the mineral contents in the loin of deer reared for a short period after capture. PMID:25186458

  15. Asymmetric processing of durational differences - electrophysiological investigations in Bengali.

    Roberts, Adam C; Kotzor, Sandra; Wetterlin, Allison; Lahiri, Aditi

    2014-05-01

    Duration is used contrastively in many languages to distinguish word meaning (e.g. in Bengali, [pata] 'leaf' vs. [pat:a] 'whereabouts'). While there is a large body of research on other contrasts in speech perception (e.g. vowel contrasts and consonantal place features), little work has been done on how durational information is used in speech processing. In non-linguistic studies of low-level processing, such as visual and non-linguistic acoustic pop-out tasks, an asymmetry is found where additional information is more readily detected than missing information. In this study, event-related potentials were recorded during two cross-modal auditory-visual semantic priming studies, where nonword mispronunciations of spoken prime words were created by changing the duration of a medial consonant (real word [dana] 'seed'>nonword [dan:a]). N400 amplitudes showed an opposite asymmetric pattern of results, where increases in consonantal duration were tolerated and led to priming of the visual target, but decreases in consonantal duration were not accepted. This asymmetrical pattern of acceptability is attributed to the fact that a longer consonant includes all essential information for the recognition of the original word with a short medial consonant (a possible default category) and any additional information can be ignored. However, when a consonant is shortened, it lacks the required durational information to activate the word with the original long consonant. PMID:24726333

  16. Environmental Equity through Negotiation: A Case Study on Urban Landfills and the Roma Community

    Petrescu-Mag, Ruxandra Mălina; Petrescu, Dacinia Crina; Oroian, Ioan Gheorghe; Safirescu, Ovidiu Călin; Bican-Brișan, Nicoleta

    2016-01-01

    The paper discusses the necessity to bring environmental equity within the Pata Rât Roma community in Northwest Romania, relying on the answers to three questions: “Does environmental equity exist in Pata Rât?”, “How can it be attained?”, and “To what extent can it be brought to the targeted people?” It was shown how a trio of factors tailors the destiny of Roma inhabitants: being a minority, their ethnicity, and the fact they are living on and off what society rejects and dumps—a landfill. The framing of the environmental equity concerns within a vision considering negotiation as the most adequate means to attain it is a novel approach. Further on, the results of the study can fuel win-win solutions in environmental equity. The information abstracted from a set of indicators, assessed through an evaluation matrix, represents a beneficial platform for future bottom-up decisions concerning landfill residents. Three action options were analyzed: on-site living opportunities—that resulted to be preferred, off-site living opportunities, and “Do nothing”. The analysis provides qualitative evidence that the evaluation of environmental equity is largely subjective, because of its complexity and specificity related to geographical, historical, cultural characteristics, and political interests. PMID:27314371

  17. Estudio del comportamiento térmico y la composición de aceites para el curtido de cueros

    Grompone, M. A.

    2000-06-01

    Full Text Available The leather industry uses fatty materials to give leather certain characteristics. Neatsfoot oil, a material with variable cost and disponibility, has been used traditionally. Samples of neatsfoot, chicken, fish and rice bran oils are studied in this work. They are evaluated as potential raw materials for leather tanning derivatives, according to their thermal behaviour (Cold Test and DSC and main fatty acids composition (GC. Some seem adequate for that purpose, while others could be modified through thermal fractionation.La industria del cuero utiliza materiales grasos que otorgan determinadas características al cuero. Tradicionalmente se ha usado, entre otros, el aceite de patas de vacuno, producto cuya disponibilidad y costo son muy variables. En este trabajo se estudiaron muestras de distintos aceites de patas de vacuno, de pollo, de pescado y de salvado de arroz. Fueron evaluadas como potenciales materias primas para la obtención de derivados para el curtido de cueros, en función de su comportamiento térmico (“Cold Test” y DSC, y su composición en ácidos grasos principales (GC. Algunos de los aceites estudiados aparecen como adecuados para dicho uso, mientras que otros podrían ser mejorados por fraccionamiento térmico.

  18. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte II Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part II

    J.M. Pozueco Romero

    2011-12-01

    Full Text Available La Jurisprudencia española se encuentra frecuentemente ante dictámenes periciales en los que aparecen términos como psicópata, trastorno antisocial de la personalidad, personalidad psicopática, psicópata desalmado, psicopatía epileptoide, sociopatía, etc. De esta forma, no es infrecuente que los juristas (magistrados, jueces, fiscales, abogados se hallen desorientados ante tanta terminología que, pese a todo, en absoluto se constituyen en sinónimos. La Doctrina, por su parte, disiente de la visión tradicionalmente ya asentada en la Jurisprudencia de que los psicópatas sean sujetos inimputables. Muchos penalistas conocen bien los textos y estudios psicológicos y psiquiátricos que al respecto existen, y en ellos suelen basarse para establecer ciertas diferencias que aparentemente son sutiles. Una de las controversias más prolongadas es si los términos trastorno antisocial de la personalidad y psicopatía son la misma entidad. En la revisión de esta Parte II también se pretende ahondar en y remarcar esas sutiles diferencias, ya que se ha demostrado reiteradamente que ambas entidades diagnósticas, si bien comparten algunos rasgos en común, no son el mismo concepto ni comportan las mismas consecuencias. Asimismo, se analiza la enconada polémica que existe en torno a la frecuente asociación entre psicopatía y consumo de drogas, una polémica que parece sentar sus orígenes en esa misma confusión terminológica entre psicopatía y trastorno antisocial de la personalidad. Finalmente, se revisa la bibliografía relativa a la criminalidad de los psicópatas, haciendo especial referencia tanto al caso de los delincuentes comunes como al caso de los asesinos en serie y otros delincuentes violentos, sin perder de vista la posición que actualmente tienen los psicópatas a nivel penológico, doctrinal y jurisprudencial.Spanish jurisprudence is frequently faced with the fact that in some expert reports appear terms like psychopath

  19. Efeito analgésico de antagonistas do receptor da histamina H1 em modelo de dor provocada por formalina em ratos Efecto analgésico de antagonistas del receptor de la histamina H1 en un modelo de dolor provocado por formalina en ratones Analgesic effects of H1 receptor antagonists in the rat model of formalin-induced pain

    Hazem Adel Ashmawi

    2009-08-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Os receptores de histamina mediam vias nociceptivas principalmente no sistema nervoso central. Alguns estudos mostraram efeito analgésico de antagonistas de receptor de histamina no sistema nervoso periférico. Não está claro se o efeito analgésico local é classe específico ou droga específico. MÉTODO: Para responder a essa questão, utilizamos três diferentes antagonistas do receptor H1 (pirilamina, prometazina e cetirizina administrados diretamente na pata do rato, pela via intraperitoneal ou por bloqueio de nervo periférico em modelo de dor induzida por formalina. Observamos o efeito das drogas no comportamento do número de elevações da pata. RESULTADOS: Na fase I, a pirilamina local diminuiu o número de elevações da pata de forma dose-dependente. Na dose mais alta, a diminuição foi de 97,8%. Para a prometazina, a diminuição foi de 92% e para cetizirina, 23,9%. Na fase II, a pirilamina diminuiu o número de elevações da pata em 93,5%, a prometazina em 78,2% e a cetirizina em 80,1%. A administração dos fármacos por via intraperitoneal não alterou o comportamento doloroso. Quando utilizadas para bloqueio de nervo periférico, na fase I, a pirilamina diminuiu o número de elevações da pata em 96,7%, a prometazina em 73,3% e a cetirizina em 23,9%. Na fase II, a pirilamina levou à diminuição de 86,6%, a prometazina de 64,4% e a cetirizina de 19,9%. CONCLUSÕES: Os resultados mostraram que os antagonistas de receptor da histamina H1 apresentam efeitos analgésicos locais, diferentes do efeito sistêmico, sendo um deles anti-inflamatório e classe específico e o outro específico para prometazina e pirilamina, semelhante a efeito clínico anestésico local.JUSTIFICATIVA Y OBJETIVOS: Los receptores de histamina intermedian las vías nociceptivas, principalmente en el sistema nervioso central. Algunos estudios arrojaron un efecto analgésico de antagonistas de receptor de histamina en el

  20. Survey of food consumption by infants in Aomori prefecture

    We are collecting sociological data in relation to the estimation of radiation dose by radionuclides released from the nuclear fuel cycle facilities in Rokkasho-mura, Aomori Prefecture. This survey on the daily food intake by infants in Aomori Prefecture over a two-year period (1995-1996) is a continuation of a previous survey on individuals (≥ 5 years old). We investigated 179 infants in the age group around 4 years old and 181 infants in the age group around 1 year old. They were living in families belonging to three different groups of primary occupations: fishery workers, farmers and other occupations. The average total daily food consumption of the age group around 4 years old was about 958 grams/day/person (g/d/p), which was weighted according to the number of families in each of the three types of occupations in Aomori Prefecture. There was no significant difference shown for occupation and area. The consumption rates of marine, agricultural and livestock products and other products were around 45, 388, 256 and 268 g/d/p, respectively. Families of fishery workers showed a higher consumption of marine products, and families of farmers showed a higher consumption of agricultural products. The average total daily food consumption of the age group around 1 year old was about 627 g/d/p. The consumption rates of marine, agricultural and livestock products and other products were around 26, 251, 201 and 150 g/d/p, respectively. Compared with individuals over 5 years old, food consumption of the age group around 4 years old was about one-half, and the age group around 1 year old was about one-third. Consumption rates of marine products and agricultural products were low, and livestock products and other products were high in infants. As the age group became lower, the ratio of the quantity of dairy products became higher. (author)

  1. Unravelling the importance of forest age stand and forest structure driving microbiological soil properties, enzymatic activities and soil nutrients content in Mediterranean Spanish black pine(Pinus nigra Ar. ssp. salzmannii) Forest.

    Lucas-Borja, M E; Hedo, J; Cerdá, A; Candel-Pérez, D; Viñegla, B

    2016-08-15

    This study aimed to investigate the effects that stand age and forest structure have on microbiological soil properties, enzymatic activities and nutrient content. Thirty forest compartments were randomly selected at the Palancares y Agregados managed forest area (Spain), supporting forest stands of five ages; from 100 to 80years old to compartments with trees that were 19-1years old. Forest area ranging from 80 to 120years old and without forest intervention was selected as the control. We measured different soil enzymatic activities, soil respiration and nutrient content (P, K, Na, Mg, Cr, Mn, Fe, Co, Ni, Cu, Zn, Pb and Ca) in the top cm of 10 mineral soils in each compartment. Results showed that the lowest forest stand age and the forest structure created by management presented lower values of organic matter, soil moisture, water holding capacity and litterfall and higher values of C/N ratio in comparison with the highest forest stand age and the related forest structure, which generated differences in soil respiration and soil enzyme activities. The forest structure created by no forest management (control plot) presented the highest enzymatic activities, soil respiration, NH4(+) and NO3(-). Results did not show a clear trend in nutrient content comparing all the experimental areas. Finally, the multivariate PCA analysis clearly clustered three differentiated groups: Control plot; from 100 to 40years old and from 39 to 1year old. Our results suggest that the control plot has better soil quality and that extreme forest stand ages (100-80 and 19-1years old) and the associated forest structure generates differences in soil parameters but not in soil nutrient content. PMID:27099995

  2. Effect of the activity of the Brazilian polyherbal formulation: Eucalyptus globulus Labill, Peltodon radicans Pohl and Schinus terebinthifolius Radd in inflammatory models

    Karina C.P. Medeiros

    2007-03-01

    Full Text Available The Brazilian polyherbal formulation (BPF is composed by dyes of Eucalyptus globulus Labill, Peltodon radicans Pohl and Schinus terebinthifolius Raddi in alcohol at 13.3° GL. The formulation is popularly used in Paraíba state, Brazil since 1889 and it is used as an antiseptic and anti-inflammatory medicine. The aim of this study was to evaluate the anti-inflammatory property of the polyherbal formulation. For this purpose it was used the12-O-tetradecanoylphorbol 13-acetate (TPA and capsaicin-induced mouse ear edema and the carrageenan-induced rat paw edema. The BPF at dose of 26 mL/Kg inhibited both 12-O-tetradecanoylphorbol 13-acetate (TPA and capsaicin-induced ear edema by 49% (p O medicamento fitoterápico brasileiro - BPF é composto de corantes das plantas Eucalyptus globulus Labill, Peltodon radicans Pohl e Schinus terebinthifolius Raddi em alcool a 13,3° GL. Este medicamento é popularmente usado no estado da Paraíba, Brasil desde 1889 como anti-séptico e antiinflamatório. O objetivo deste estudo foi avaliar a propriedade antiinflamatória deste medicamento fitoterápico. Para tal, foram utilizadas as técnicas de edema de orelha em camundongos induzido por 12-O-tetradecanoilforbol 13-acetato (TPA ou capsaicina e o edema de pata de rato induzido por carragenina. O BPF na dose de 26 mL/kg inibiu tanto edema de orelha induzido por TPA como por capsaicina a 49% (p < 0.05 e 24% (p < 0.01 respectivamente. Estudos preliminares utilizando a técnica de edema de pata induzido por carragenina demonstraram que a administração oral também inibiu o edema de pata em aproximadamente 29%. Os resultados demonstraram que o medicamento fitoterápico brasileiro (BPF apresentou propriedades antiinflamatórias e a melhor dose foi aquela que é usada pela população.

  3. Potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da nimesulida por vitaminas do complexo B

    L. A. Rodrigues

    2009-01-01

    Full Text Available

    Investigou-se os efeitos de algumas vitaminas B associadas ao diclofenaco ou nimesulida, na contorção abdominal em camundongos e edema de pata em ratos apenas com a nimesulida ou sua associação com algumas vitaminas B. Verificou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], isoladas ou administradas conjuntamente, não inibiu o edema de pata produzido pela carragenina em ratos, nem as contorções abdominais produzidas pelo ácido acético em camundongos. Por outro lado, a nimesulida [5mg/kg] reduziu o edema de pata em ratos, e a associação das três vitaminas à este fármaco, mas não as vitaminas administradas isoladamente, potencializou seus efeitos nos tempos de duas, três e quatro horas após a carragenina. As contorções abdominais em camundongos foram inibidas pelas doses de 25 ou 50mg/kg de diclofenaco. A associação das três vitaminas ou apenas da cianocobalamina, potencializou as duas doses do diclofenaco utilizadas. As contorções abdominais foram reduzidas também pelo nimesulida [5mg/kg] e a associação das três vitaminas, ou cada uma das vitaminas administradas isoladamente, foram capazes de potencializar os efeitos do nimesulida. É provável que a diferença no mecanismo de ação destes fármacos seja responsável pela diferença dos efeitos das vitaminas. O presente trabalho aponta para a realização de novos estudos com o uso destes antiinflamatórios, combinados com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], em doenças inflamatórias crônicas, na tentativa de reduzir a dose destes fármacos e conseqüentemente diminuindo seus efeitos colaterais. Palavras-chave: diclofenaco; nimesulida; contorção abdominal; edema, cianocobalamina; tiamina.

  4. Changes in astigmatism between the ages of 1 and 4 years: a longitudinal study.

    Abrahamsson, M; Fabian, G.; Sjöstrand, J

    1988-01-01

    Changes in astigmatism during development were studied in 299 infants with astigmatism as they grew from 1 to 4 years of age. All consecutive cases of 1-year-old infants with an astigmatism of 1.0 D or more in at least one eye found at an ophthalmic screening survey were selected for follow-up. The cycloplegic refraction was longitudinally followed at yearly intervals. During development there was no decrease in the degree of hypermetropia, but there was a significant decrease in the incidenc...

  5. Seasonal changes in the amount of carbohydrates and photosynthetic activity of Pinus pumila Regal on alpine in central Japan

    Kibe,Takeshi; Masuzawa, Takehiro

    1992-01-01

    Branches and needles of Pmus pumila REGEL were collected from a site in the Yatsugatake mountain range in central Japan They were divided into current, 1-year-old, 2-year-old and 3-year-old parts Then, soluble carbohydrate (total sugars and starch) included in each of them was analyzed by SOMOGYI-NELSON method Photosynthetic rate of needles was measured by an infrared CO_2 gas analyzer Total sugar contents of branches and needles showed high levels in the winter season, but starch content lev...

  6. A case of congenital hypothyroidism presented with dysmyelinization findings

    Sevil Ar Yuca; Cahide Ylmaz; Avni Kaya; Lokmanstyol; Ertan Sal; Yasar Cesur; Hseyin Caksen

    2014-01-01

    The central nervous system is one of the most crucial targeted systems of hyphotiroidism where tissues undergo various broad developmental processes such as neuronal and glial cellular differentiation, migration and myelinization.However brain images are mainly normal.In this article we present findings related to a1-year-old girl who has been referred to our outpatient clinic with complaints of slowing of movement and lack of interest.She was diagnosed with hypothyroidism.Her brain magnetic resonance image obtained during diagnosis displayed dysmyelinization.It showed improvement afterNa-L thyroxin therapy during follow up.

  7. Transgenic overexpression of ADAM12 suppresses muscle regeneration and aggravates dystrophy in aged mdx mice

    Jørgensen, Louise Helskov; Jensen, Charlotte Harken; Wewer, Ulla M;

    2007-01-01

    ADAM12 could be a candidate for nonreplacement gene therapy of Duchenne muscular dystrophy. We therefore evaluated the long-term effect of ADAM12 overexpression in muscle. Surprisingly, we observed loss of skeletal muscle and accelerated fibrosis and adipogenesis in 1-year-old mdx mice transgenically......Muscular dystrophies are characterized by insufficient restoration and gradual replacement of the skeletal muscle by fat and connective tissue. ADAM12 has previously been shown to alleviate the pathology of young dystrophin-deficient mdx mice, a model for Duchenne muscular dystrophy. The observed...... regeneration as a possible factor in development of muscular dystrophy....

  8. Evaluation of Mird and Marinelli formalisms in the radiation dosimetry for thyroid of adults and children using 131I (radioiodine)

    Using MIRD formalism and Cristy-Eckerman representation for the thyroid adults, children of 15, 10, 5, 1 year old and newborn it is shown that the total dose absorbed by the gland due to 131I(iodine) is its self-dose. Their results are not significantly different from those reported by the formalism MARINELLI (self-dose), which uses a sphere as glandular representation. Consequently, the kinetic model to the gland is a single compartment and the thyroid can be represented as a sphere

  9. Excretion of diazepam and its metabolites in human milk during withdrawal from combination high dose diazepam and oxazepam.

    Dusci, L J; Good, S M; Hall, R W; Ilett, K F

    1990-01-01

    The excretion of diazepam, N-desmethyldiazepam, temazepam and oxazepam in breast milk was studied during withdrawal of a 22-year-old patient from combined high dose diazepam and oxazepam therapy. Concentrations of these benzodiazepines in plasma from both the woman and her nursing infant (1 year old) were also documented. Diazepam, N-desmethyldiazepam, temazepam and oxazepam were found in the maternal plasma and milk with mean milk: plasma ratios of 0.2, 0.13, 0.14 and 0.10 respectively. It w...

  10. Some features of one-year-old tart Cherry shoots of cv. Sehattenmorelle

    Dariusz Świetlik; Kazimierz Słowik; Sebastian Rejman

    2013-01-01

    The purpose of this study was to obtain data on the relationship between the length of 1-year-old shoots and their fruiting, and both their terminal and lateral growtn produced in the current year. The measurements were taken in 1977 and 1979 from the tart cherry trees of cv. Schattenmorelle grafted of Prunus mahaleb L. or Prunus avium L. grown in loose sandy soil. In 1977 there were more shoots of over 30 cm than in 1979. The longer the shoots, the more lateral shoots were there. Only the sh...

  11. Some features of one-year-old tart Cherry shoots of cv. Sehattenmorelle

    Dariusz Świetlik

    2013-12-01

    Full Text Available The purpose of this study was to obtain data on the relationship between the length of 1-year-old shoots and their fruiting, and both their terminal and lateral growtn produced in the current year. The measurements were taken in 1977 and 1979 from the tart cherry trees of cv. Schattenmorelle grafted of Prunus mahaleb L. or Prunus avium L. grown in loose sandy soil. In 1977 there were more shoots of over 30 cm than in 1979. The longer the shoots, the more lateral shoots were there. Only the shortest shoots (1-10 cm bore more fruit per unit length as compared to the longer shoots.

  12. Disease: H00771 [KEGG MEDICUS

    Full Text Available gene) Catterall WA, Dib-Hajj S, Meisler MH, Pietrobon D Inherited neuronal ion channelopathies: new windows ...lalgia (IEM) is characterized by intense episodic burning pain associated with redness and warmth of the affected extremities and in... many instances occurs as an autosomal dominant trait. Symptoms of IEM can start as ...early as 1 year old (early-onset), or in adults (adult-onset), and both types have been described in... families and in sporadic cases. Pharmacotherapy has been largely ineffective, and partia

  13. Perineal Accessory Scrotum with Congenital Lipoma: A Rare Case Report

    Souvik Chatterjee

    2012-01-01

    Full Text Available A case of accessory scrotum in a 1-year-old boy is reported because of its rarity. A boy presented with a tumor mass attached with scrotum-like skin on its tip in the right side of perineum between the scrotum and anus. Both testes had descended into the scrotum. There was no other urological anomaly. Histological findings of the tumor indicated perineal lipoma, and the scrotum-like portion accessory scrotum. An overview of sequences during the normal development of male external genitalia has been provided and the deranged mechanism resulting in this anomaly has been reviewed with hypothesis regarding etiology of accessory scrotum.

  14. Perfil dos pacientes atendidos na Clínica de Odontopediatria do Curso de Odontologia da ULBRA Canoas/RS

    Suzana Sommer; Ana Graciela Zuchetto de Barros; Gabriela Couto de Lima; Elizabete da Silva Viana; Paulo Floriani Kramer

    2008-01-01

    The objective of this present study was to characterize the patients profi le carried out in the clinical of Pediatric Dentistry from ULBRA Dental School. The manuals of 454 patients aged 3-12 years old attended during the fi rst semester of 2006, were analyzed. Demographical variations, social-economical, clinics and therapeutic data were collected and organized in a database for a describing statistical analysis. According to the data the mean of sample was age 8.1 years old. Haul of that, ...

  15. Brain CT scanning of children with purulent meningitis

    Nine of 21 children with purulent meningitis showed abnormal findings in brain CT when admitted. All of abnormal group were less than 12 months of age, but 75 % of normal group were after 1 year old. The period of positive CRP was longer and the level of sugar in CSF was lower in abnormal group when compared with normal group. Because convulsion and EEG abnormalities were observed similary in both groups, it may be hard to suggest the organic changes of brain by clinically. It will be better to perform brain CT scanning as soon as possible on the beginning of purulent meningitis. (author)

  16. Failure of peritoneal and gallbladder shunts in a child with craniopharyngioma

    Julie Woodfield

    2013-01-01

    Full Text Available A 1-year-old girl with craniopharyngioma required external drainage of 40-50 mL/h of cerebrospinal fluid (CSF after biopsy and cyst fenestration. She developed CSF ascites following insertion of a ventriculoperitoneal (VP shunt and a distended painful gallbladder following ventriculogallbladder shunt insertion. Revision to a ventriculoatrial shunt was required. This is the first time a craniopharyngioma has been reported to cause increased CSF production. The potential mechanisms of CSF overproduction and the difficulties managing the large volume of CSF in a young child are discussed.

  17. Brain stem hypoplasia associated with Cri-du-Chat syndrome

    Hong, Jin Ho; Lee, Ha Young; Lim, Myung Kwan; Kim, Mi Young; Kang, Young Hye; Lee, Kyung Hee; Cho, Soon Gu [Dept. of Radiology, Inha University Hospital, Inha University School of Medicine, Incheon (Korea, Republic of)

    2013-12-15

    Cri-du-Chat syndrome, also called the 5p-syndrome, is a rare genetic abnormality, and only few cases have been reported on its brain MRI findings. We describe the magnetic resonance imaging findings of a 1-year-old girl with Cri-du-Chat syndrome who showed brain stem hypoplasia, particularly in the pons, with normal cerebellum and diffuse hypoplasia of the cerebral hemispheres. We suggest that Cri-du-Chat syndrome chould be suspected in children with brain stem hypoplasia, particularly for those with high-pitched cries.

  18. Brain stem hypoplasia associated with Cri-du-Chat syndrome

    Cri-du-Chat syndrome, also called the 5p-syndrome, is a rare genetic abnormality, and only few cases have been reported on its brain MRI findings. We describe the magnetic resonance imaging findings of a 1-year-old girl with Cri-du-Chat syndrome who showed brain stem hypoplasia, particularly in the pons, with normal cerebellum and diffuse hypoplasia of the cerebral hemispheres. We suggest that Cri-du-Chat syndrome chould be suspected in children with brain stem hypoplasia, particularly for those with high-pitched cries.

  19. Composition and stability of coyote families and territories in North Dakota

    Allen, S.H.; Hastings, J.O.; Kohn, S.C.

    1987-01-01

    Coyote (Canis latrans) families studied in North Dakota during 1976 to 1978 contained three or more adults during the spring-summer season, and they occupied large contiguous, non-overlapping territories. Coyote territories averaged 61 km2 during the spring-summer season and 30 km2 during fall-winter season. Three of four families occupied territories that were similar in size for two consecutive years; however, boundaries changed within individual families when one or both alpha adults were killed. All coyotes replacing dead alpha adults were 1 year old.

  20. Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival

    Cheng Tan; Tatsuya Takayama; Naohisa Takaoka; Hiromi Fujita; Miki Miyazaki; Takayuki Sugiyama; Seiichiro Ozono

    2014-01-01

    OBJECTIVE To investigate the relationship between gender differences in fatty acid-binding protein7 (FABP7) and BRN2 (POU class 3 homeobox 2) expression in renal cell carcinoma (RCC) and the prognosis of patients with RCC. MATERIALS AND METHODS immunohistochemical (IHC) staining as well as reverse transcription-polymerase chain reaction (RT-PCR) was performed in renal tissues from 103 patients (83 men, mean age = 63.6 years old; 20 women, mean age = 63.1 years old) underwent radical nephrecto...

  1. Comparative studies on the growth of pinus brutia in pure and mixed plantations

    Hasan, S.M.; Al-Saraf, M.J.; Khalil, M.T.

    1980-01-01

    In trials in a semi-arid poor soil in Hammam Al-Alil, Mosul, Iraq, 2-year-old P. brutia transplants were planted in two blocks at 1x1 spacing. One block was interplanted with 1-year-old Acacia farnesiana. There was n.s.d. in growth of P. brutia between the 2 blocks at the end of the first or second year, but height growth in the mixed stand was significantly greater than in the pure stand after 3 growing seasons. (Refs. 10).

  2. Ecological aspects of cattle tick control in central Zambia.

    Pegram, R G; Lemche, J; Chizyuka, H G; Sutherst, R W; Floyd, R B; Kerr, J D; McCosker, P J

    1989-07-01

    In ecological studies in central Zambia, both climate and ecotype affected population dynamics of tick species. Below average rainfall for several years caused a suppression in numbers of Rhipicephalus appendiculatus Neumann adults. Reduction in rainfall leading to changes in grazing patterns is thought to have been responsible for an increase in numbers of Amblyomma variegatum Fabricius adults in a grassland habitat. There were reasonable correlations between numbers of each tick species on individual hosts over 1 year old. However, there were no relationships between numbers of ticks and bovine lymphocyte antigens (BoLA). PMID:2519677

  3. Two renal tumors in cottontail rabbits (Sylvilagus floridanus).

    Carlton, W W; Dietz, J M

    1977-01-01

    Renal tumors were found in two cottontail rabbits (Sylvilagus floridanus) about 1 year old. One tumor was intimately associated with the kidney and consisted of isolated ductular and tubular structures within an abundant connective tissue stroma and was diagnosed as a hamartoma of urogenital origin. The second was composed of epithelial cells arrange as alveolar structures with papillary projections, epithelium that was less differentiated into tubules and ducts, and neoplastic epithelial cells in solid sheets. The diagnosis of renal adenocarcinoma was based on the histologic features as metastasis had not occurred. PMID:850992

  4. Pelizaeus Merzbacher Disease: the First Genetically Approved Case Report from Iran

    Mahmoud-Reza Ashrafi

    2011-09-01

    Full Text Available Background:Classic Pelizaeus-Merzbacher disease is a rare x-linked disorder of proteolipid protein expression first described clinically in 1885. This disease is characterized by abnormal eye movements, very slow motor development and involuntary movements. The causative gene is PLP1. Case Presentation:A 1-year-old boy was referred to our clinic due to abnormal eye movements. He had horizontal and flickering eye oscillation, psychomotor retardation, hypotonia and head nodding. We found hypomyelination in brain MRI.Conclusion:The possibility of Pelizaeus-Merzbacher disease should be considered in boys with abnormal eye movements, psychomotor retardation and hypotonia.

  5. Pelizaeus–Merzbacher Disease: The First Genetically Approved Case Report from Iran

    Hooman Alizadeh

    2011-09-01

    Full Text Available Background:Classic Pelizaeus-Merzbacher disease is a rare x-linked disorder of proteolipid protein expression first described clinically in 1885. This disease is characterized by abnormal eye movements, very slow motor development and involuntary movements. The causative gene is PLP1. Case Presentation:A 1-year-old boy was referred to our clinic due to abnormal eye movements. He had horizontal and flickering eye oscillation, psychomotor retardation, hypotonia and head nodding. We found hypomyelination in brain MRI. Conclusion:The possibility of Pelizaeus-Merzbacher disease should be considered in boys with abnormal eye movements, psychomotor retardation and hypotonia.

  6. Aneurysm of the superficial femoral artery in an infant

    An isolated arterial aneurysm in childhood is extremely rare. We report a 1-year-old girl with an aneurysm of the right superficial femoral artery, presenting as an asymptomatic mass of the thigh. The aneurysm involved the whole superficial femoral artery (9 cm in length), and surgical treatment would have required replacement of the affected artery. Conservative treatment was chosen, influenced by the patient's rapid growth at that time. Non-invasive, 3-D contrast-enhanced magnetic resonance angiography (MRA) was useful as an alternative to conventional angiography for detailed evaluation of the femoral arteries, including the aneurysm. (orig.)

  7. Development of Duchenne-type cardiomyopathy. Morphologic studies in a canine model.

    Valentine, B A; Cummings, J. F.; Cooper, B. J.

    1989-01-01

    The development of cardiac lesions was studied in xmd dogs aged from 1 day to 6 years. Cardiac lesions were not present in dystrophic dogs up to 3 months of age. Foci of mineralization were first seen at 6.5 months. A 1-year-old dog had foci of myocyte hypercontraction. Linear and anastomosing fibrosis was present in all dogs 1 year of age or older, most prominently and most consistently within the subepicardial region of the left ventricular (LV) free wall, the LV papillary muscles, and the ...

  8. The arbuscular mycorrhizal status of poplar clones selected for phytoremediation of soils contaminated with heavy metals

    Takacs, T.; Radimszky, L.; Nemeth, T. [Research Inst. for Soil Science and Agricultural Chemistry of the Hungarian Academy of Sciences, Budapest (Hungary)

    2005-04-01

    The aim of this work was to study the colonization of indigenous arbuscular mycorrhizal fungi (AMF) species in fine-roots of poplar clones. Roots of 7 poplar clones were sampled from a 1-year-old trial established at an industrial site strongly polluted with heavy metals at Balatonfuezfoe, Hungary. The poplar clones have shown variable degrees of colonization by AMF, suggesting differential host susceptibility or mycorrhizal dependency. After outplanting the percentage of poplar survival was strongly correlated with the frequency of AMF infection. Two clones that survived at the lowest ratio after outplanting had not been colonized by AMF in contrast to those which survived to a much higher extent. (orig.)

  9. Plant species richness and floristic composition change along a rice-pasture sequence in subsistence farms of Brazilian Amazon, influence on the fallows biodiversity (Benfica, State of Para)

    Mitja, Danielle; Miranda, L. D. S.; Velasquez, Elena; Lavelle, Patrick

    2008-01-01

    Along the Amazonian pioneer front in the Brazilian state of Pari, smallholder farmers manually clear primary rain forest every year to grow rice prior to sowing pastures that they will use for 5-20 years. Species richness and floristic composition of the weedy species were studied in 20 plots along a farming succession, from rice fields, to 1-year-old, 4-8-year-old and over 10-year-old pastures planted to Brachiaria brizantha. In the early phases of the farming cycle reduction in the average ...

  10. Evaluation of Mird and Marinelli formalisms in the radiation dosimetry for thyroid of adults and children using {sup 131I} (radioiodine); Evaluacion de las dosimetrias Mird y de Marinelli en el estimado de dosis de radiacion para tiroides de adultos y ninos cuando se usa {sup 131}I (yoduro)

    Vasquez, A.M.; Rocha, J.J.; Castillo, D.C.; Gomez, M.A.; Mendoza, A.A.; Rabanal, M.J.; Cruz, S.J. [Universidad Nacional de Trujillo (UNT-UCV), Trujillo (Peru). Grupo de Fisica Medica

    2013-11-01

    Using MIRD formalism and Cristy-Eckerman representation for the thyroid adults, children of 15, 10, 5, 1 year old and newborn it is shown that the total dose absorbed by the gland due to {sup 131}I(iodine) is its self-dose. Their results are not significantly different from those reported by the formalism MARINELLI (self-dose), which uses a sphere as glandular representation. Consequently, the kinetic model to the gland is a single compartment and the thyroid can be represented as a sphere.

  11. 99mTc DTPA renogram indentifies Bochdalek hernia with an intra thoracic kidney as its content

    Padma, Subramanyam; Pande, Shantanu R.; Sundaram, Palaniswamy Shanmuga

    2014-01-01

    Congenital diaphragmatic hernia (CDH) is a rare anomaly with reported incidence of 1 in 16,000 and is associated with herniation of stomach, intestinal loops, spleen, and kidney through a chest wall defect. We report a case of 1-year-old male child with history of recurrent fever and non-visualization of left kidney on ultrasonogram. Patient was referred to us to look for ectopic left kidney.99mTc-diethylenetriaminepentaacetic acid renogram was performed. An ectopically placed intrathoracic l...

  12. First Case Report of Canthariasis in an Infant Caused by the Larvae of Lasioderma serricorne (Coleoptera: Anobiidae)

    Mokhtar, Aida Syafinaz; Sridhar, Ganiga Srinivasaiah; Mahmud, Rohela; Jeffery, John; Lau, Yee Ling; Wilson, John-James; Abdul-Aziz, Noraishah Mydin

    2016-01-01

    We report an unusual cause of gastrointestinal infection occurring in a 1-year-old infant patient who was brought to a public hospital in Kuala Lumpur, Malaysia. Larvae passed out in the patient’s feces were confirmed by DNA barcoding as belonging to the species, Lasioderma serricorne (F.), known as the cigarette beetle. We postulate that the larvae were acquired from contaminated food and were responsible for gastrointestinal symptoms in the patient. To our knowledge, this the first report of human canthariasis caused by larvae of L. serricorne. PMID:27208008

  13. Neurological morbidity in vaccine-associated paralytic poliomyelitis in Brazil from 1989 up to 1995 Morbidade neurológica em poliomielite paralítica pós vacinal no Brasil de 1989 a 1995

    Elza Dias-Tosta; Carlos Santos Kückelhaus

    2004-01-01

    We collected 30 cases of vaccine associated paralytic poliomyelitis (VAPP) from 4081 cases of acute flaccid palsies cases notified from 1989 to 1995 to the Brazilian Ministry of Health. There were 30 VAPP cases with 56% of children younger than 1 year old, 56.7% of female. 46% of cases were reported in the Northeast. Ten P2 vaccine virus, 8 P3 and 2 P1 and associations amongst them were isolated. The clinical pattern in 60 days was: monoplegia (16), paraplegia (6), tetraplegia (5), hemiplegia...

  14. Phenobarbitone induced drug reaction with eosinophilia and systemic symptoms (DRESS: a case report

    Navreet K. Natt

    2013-06-01

    Full Text Available Drug reaction with eosinophilia and systemic symptoms (DRESS is a life threatening cutaneous drug reaction with visceral involvement and hematological abnormalities. Being a rare side effect, it is often under-reported and misdiagnosed. The fatal adverse drug reaction is associated most commonly with aromatic anti-epileptics phenytoin, carbamazepine and less frequently with phenobarbitone. Here, we report a case of phenobarbitone induced DRESS in a 1 year old male child. He succumbed to fulminant hepatic failure inspite of being put on steroids, hepatoprotectives, antibiotics and ventilatory support. [Int J Basic Clin Pharmacol 2013; 2(3.000: 333-335

  15. Familial dysautonomy (Riley-Day syndrome

    Edward R. Tonholo Silva

    1994-03-01

    Full Text Available Familial dysautonomia, also known as Riley-Day syndrome, is a disorder of autonomic nervous system with an autosomal recessive mode of inheritance. Reduction and/or loss of unmyelinated and small myelinated fibers is found, as reduction of dopamine beta-hydroxylase in blood. The diagnosis is based on clinical features: diminished lacrimation, insensitivity to pain, poor temperature control, abolished deep tendon reflexes, postural hypotension, vomiting attacks, poor motor coordenation, and mental retardation. The treatment is symptomatic and many children die during the first years of life, usually as a result of repeated aspiration pneumonia. We report the case of a 1 year-old child with familial dysautonomia.

  16. Vitamin D Status: A Different Story in the Very Young versus the Very Old Romanian Patients

    Chirita-Emandi, Adela; Socolov, Demetra; Haivas, Carmen; Calapiș, Anca; Gheorghiu, Cristina; PUIU, Maria

    2015-01-01

    Background In Romania (latitude 48°15’N to 43°40’N), vitamin D supplementation is common practice mostly in infants 0-1 year old. No published information is available regarding epidemiological data on vitamin D status in the Romanian population for a wide age range and geographical territory. In this context, we aimed to evaluate the seasonal and age variation of vitamin D status in a large Romanian population. Methods 6631 individuals from across Romania had performed 7544 vitamin D assessm...

  17. ‘COROJO 2006’: NUEVA VARIEDAD CUBANA DE TABACO NEGRO (Nicotiana tabacum L.

    Vivaldo García Morejón

    2013-01-01

    Full Text Available En la Estación Experimental del Tabaco, de San Juan y Martínez, Pinar del Río durante la campaña tabacalera 2001-2002, se realizó un cruzamiento sexual con el objetivo de obtener una variedad de tabaco negro con mayor rendimiento que la comercial ‘Criollo 98’, resistente al moho azul ( Peronospora hyocyami de Bary, a la pata prieta ( Phytophthora parasitica Dast. var . Nicotianae Breda de Haan, al virus del mosaico del tabaco (VMT y a la necrosis ambiental. Después de cinco generaciones de autofecundación y selección por el método genealógico se obtuvieron siete variedades resistentes. El cruce originó la nueva variedad `Corojo 2006 ́ que superó a la `Criollo 98 ́.

  18. Propriedades farmacológicas do extrato etanólico de Eremanthus erythropappus (DC. McLeisch (Asteraceae Pharmacological properties of the ethanol extract from Eremanthus erythropappus (DC. McLeisch (Asteraceae

    Marcelo S. Silvério

    2008-09-01

    Full Text Available O presente trabalho investigou as propriedades antinociceptiva, antiinflamatória e antiulcerogênica do extrato etanólico dos galhos de E. erythropappus. Foram realizados os testes de contorções abdominais induzidas por ácido acético; tempo da lambida da pata induzida por formalina; placa quente; edema de pata induzido por carragenina; lesões ulcerativas induzidas por indometacina e etanol. As doses de 50, 100 e 200 mg/kg inibiram as contorções em 43,07%, 69,34% e 70,07%, respectivamente. O tempo da lambida da pata foi reduzido em ambas as fases nas doses testadas, enquanto o tempo de latência da placa quente teve efeito significativo na dose de 200 mg/kg. O edema de pata foi reduzido em 23,81% (100 mg/kg e 47,62% (200 mg/kg. O índice ulcerativo das lesões induzidas por indometacina foi reduzido na dose de 100 mg/kg e 200 mg/kg, enquanto a dose de 200 mg/kg teve efeito significativo sobre o volume e o pH do suco gástrico. O índice ulcerativo e o volume do suco gástrico, induzidos por etanol, foram reduzidos na dose de 200 mg/kg, enquanto o pH do suco gástrico aumentou nas doses de 100 e 200 mg/kg. Os resultados indicam que o extrato etanólico de E. erythropappus avaliado pode constituir alvo potencial para uso em terapias da dor, da inflamação e de úlcera.The present work investigated the antinociceptive, anti-inflammatory and antiulcerogenic activities of Eremanthus erythropappus ethanol extract. The tests were carried out by acetic acid writhing, paw licking induced by formalin, hot plate, indomethacin- and ethanol-induced ulcer. The doses of 50, 100 and 200 mg/kg inhibited the contortions in 43.07, 69.34 and 70.07%, respectively. Both phases of paw lick were reduced at the tested doses, while reaction time at hot plate had significant effect at 200 mg/kg. The paw edema was decreased in 23.81% (100 mg/kg and 47.62% (200 mg/kg. The index of ulceration induced by indomethacin was reduced at the doses of 100 and 200 mg

  19. Órdenes de no reanimar y cuidados paliativos en pacientes fallecidos en un servicio de cardiología : ¿Qué podemos mejorar?

    Martínez Sellés Oliveria Soares, Manuel

    2010-01-01

    Con el objetivo de evaluar el uso de órdenes de no reanimar y de cuidados paliativos en cardiópatas, registramos 198 muertes consecutivas en nuestro servicio. En 113 (57%) se decidió no reanimar, se reflejó en la historia clínica en 102 (90,3%) y en 74 (65,5%) en las hojas de enfermería. Se informó a 5 pacientes (4,4%) y a 95 familias (84,1%). El uso de medidas paliativas fue escaso en pacientes no reanimables, 56 (49,6%) recibieron cloruro mórfico y 5 (4,4%), asistencia espiritual. Sin embar...

  20. Beklemishevia hispaniola n. sp., nuevo representante de la Cohorte Palaeosomata (Acari, Oribatei en España

    Pérez-Iñigo, C.

    1996-12-01

    Full Text Available A new species of oribatid mite (Acari, Oribatei belonging to the family Ctenacaridae (Cohors Palaeosomata is described; this species was recorded several times in Spain as Beklemishevia galeodula Zachvatkin, 1945. The new species is easily distinguishable from the mentioned one because of the presence of three claws in every leg, a noticeable pigidial neotrichy and the absence of short, almost spiniform, setae on the pygidium.Se describe una nueva especie de oribátido (Acari, Oribatei perteneciente a la familia Ctenacaridae (Cohorte Palaeosomata que habia sido citada varias veces en España como Beklemishevia galeodula Zachvatkin, 1945, y de la que se diferencia por presentar tres uñas en todas las patas, una acentuada neotriquia pigidial y carecer de setas cortas espiniformes en el pigidio.

  1. La globalización y su impacto en la economía de la educación en el sistema educativo público de Puerto Rico

    Pizarro Figueroa, J.

    2010-01-01

    Full Text Available En este mundo globalizado la educación se constituye en un factor indispensable pata el crecimiento del ser humano y su sociedad. La educación es determinante para el crecimiento económico, social y ecológico de un país. En este ensayo presentamos un análisis sobre la economía de la educación. A tales fines, comenzaremos discutiendo el concepto de la globalización y sus características, tanto sus ventajas como desventajas. Posteriormente, analizaremos la economía de la educación en el Sistema Educativo Público del Estado Libre Asociado de Puerto Rico (territorio no incorporado de los Estados Unidos de América. Cómo la economía incide en la educación y viceversa. Finalmente, presentaremos las conclusiones producto de este ensayo.

  2. Productividad secundaria en los esteros de la barra de arena El Mogote en la Ensenada de La Paz, Baja California Sur, México Secondary productivity in the estuaries of El Mogote sand bar in Ensenada de La Paz, Baja California Sur, Mexico

    Jorge A. López-Rocha

    2012-04-01

    Full Text Available Los ecosistemas de manglar son un hábitat crítico para numerosas especies y su productividad es importante por su contribución de detritos orgánicos y su producción secundaria. El objetivo del trabajo fue definir indicadores de productividad secundaria para establecer una línea base que permita medir alteraciones en el sistema de manglar por posibles perturbaciones naturales o antropogénicas. Como indicadores se escogieron los moluscos bivalvos pata de mula, Anadara tuberculosa y el ostión de mangle, Crassostrea palmula. Se realizaron muestreos en tres esteros de agosto de 2007 a julio de 2009. Se estimó la abundancia y la producción secundaria con base en el incremento de biomasa. Para la estimación del incremento en peso se usaron las tasas de crecimiento individual obtenidas mediante un análisis de distribuciones de frecuencia de tallas. La abundancia promedio fue de 1.27 y 510 ind · m-2 de la pata de mula y ostión de mangle respectivamente. Se estimó una tasa de crecimiento de 4.91 mm · mes-1 (3.67 g · mes-1 para la pata de mula y de 3.80 mm · mes-1 (0.18 g · mes-1 para el ostión de mangle. La producción secundaria promedio de pata de mula fue de 4.51 g · m-2 · mes-1 y fue mayor durante la primavera, mientras que para el ostión de mangle fue de 97.9 g · m-2 · mes-1, registrándose la máxima producción durante el verano. Los resultados obtenidos demuestran que estos indicadores de calidad del bentos son adecuados para medir alteraciones al sistema de manglar de la Ensenada de La Paz, B. C. S., México.Mangrove ecosystems are critical habitats for many species, and their productivity is important because of their contribution of organic detritus and secondary production. The objective of this study was to identify suitable indicators of secondary productivity of mangrove systems, in order to establish a baseline for measuring changes in the mangrove system due to natural or anthropogenic potential disturbances. The

  3. : ESSAI D'INTERPRETATION

    Chamoux, Marie Noëlle

    2006-01-01

    Este capítulo presenta, a partir del léxico y de textos en náhuatl del siglo XVI, las formas que usaban los aztecas pata expresar los conocimientos técnicos, la pericia, la enseñanza y el aprendizaje. Subrayaban la habilidad para planificar y anticipar la acción técnica. Daban criterios de lo "bello" y de lo "bien hecho". En sus discursos, daban relieve a los aspectos cognitivos y psicológicos, más que a lo manual, y insistían en las cualidades éticas. Ce chapitre présente, à partir du lex...

  4. Efeito analgésico de longa duração da dipirona sobre a hiperalgesia persistente induzida pela constrição do nervo ciático em ratos: participação do óxido nítrico Long term analgesic effect of dipyrone on the persistent hyperalgesia induced by chronic constriction injury of sciatic nerve in rats: involviment of nitric oxide

    Fábio José Reis; Noeli Pereira Rocha

    2006-01-01

    O efeito analgésico de longa duração da dipirona foi avaliado em um modelo de dor neuropática assim como a participação da via óxido nítrico-GMPc neste mecanismo analgésico. Uma única administração intraplantar de dipirona (80 µg), no 14º dia após a instalação da hiperalgesia neuropática induzida pela constrição do nervo ciático exerceu um efeito analgésico, significativo e de longa duração. A inibição da óxido nítrico sintetase com L-NAME (50 ou 100 µg/pata), ou do óxido nítrico (NO) endógen...

  5. Baja Andesia: sed y poéticas tramontinas. Un desvío etnográfico a mano alzada

    Pedro Araya

    2007-07-01

    Full Text Available Si yo fuese dromedario no tendría sed. ¿Qué hora es ?Vicente Huidobro1.El antropólogo-poeta-ponencista despierta luego de un sueño intranquilo. Tiene sed. Algo recuerda. Un escozor, dice, un poco antes, en la misma, como de ron, como de vino y el fumadero de las caras ; como si, apenas, algo de lo exagerado de una opinión, entre una cosa y la otra, hubiera olvidado. Sabe que debe hablar aquella misma mañana. Sabe. La pata de los caballos, piensa. La tribu estará reunida. No la suya. No se sus...

  6. Assessing locomotion deficiency in broiler chicken Medida de deficiência locomotora em frango de corte

    Irenilza de Alencar Nääs

    2010-04-01

    Full Text Available Locomotion deficiencies in broiler production cause poor welfare and lead to change in drinking and feeding behavior with consequent loss in weight gain. This research aimed to assess locomotion deficiencies in broiler chicken by analyzing the vertical peak force on both feet during walk. A chamber was built with an inlet ramp, a horizontal walkway in the middle and an outlet ramp. In the walkway a thin mat with piezoelectric crystal sensors was placed to record the step vertical peak force of the feet while walking on the force platform. The measurement system consisted of a mat with electronic sensors and software that allowed real time recording of the forces and the processing and analysis of data. Footage was taken from two digital video cameras and used for gait scoring. Forty male broilers were chosen at random, grown under similar rearing conditions and farms, with age varying from 49 to 28 days (ten birds of same age to be used in the trial. Measurement consisted of inducing the bird to walk on the force platform which automatically registered the peak vertical force of the steps. Results showed that the gait score increased with the weight and age of the birds. Peak force asymmetry was found for each foot, independent of age or gait score. Although not identified visually in the broilers, the peak vertical force values differed in both right and left feet leading to slow and uneven walking. Walking deficiency was more severe in older birds.Deficiência em locomoção é hoje um dos problemas mais importantes na produção de frangos de corte. É causa de baixo bem-estar e leva a alteração no comportamento de bebida e alimentação, com conseqüente perda de ganho de peso. Mediram-se deficiências locomotoras em frango de corte por meio da análise do pico de força plantar vertical em ambas as patas, durante a caminhada. Foi construída uma câmara com uma rampa de entrada, uma área horizontal de passagem e uma rampa de saída. Na

  7. Crítica de Libros.

    Fernando Colina Pérez

    1981-01-01

    Full Text Available

    PRESENTACION y ENSEÑANZAS DE SCHREBER, Daniel Paul Schreber -«Memorias de un Neurópata» -Ediciones Petrel. Buenos Aires -1978

    LA TEORIA COMO FICCION, Maud Mannoni -Editorial Crítica -1980

    MAS ALLA DE LA SOCIOLOGIA: EL GRUPO DE DISCUSION: TEORIA y CRITICA, Jesús Ibáñez -Ed. Siglo XXI -Madrid, 1979.

    LA SEXUALIDAD -Jean Laplanche

    EL ORDEN PSIQUIATRICO -Robert Castel -Ediciones La Piqueta. Madrid, 1980 -Colección «La Genealogía del Poder», dirigida por Julia Varela y Fernando Alvarez Uría

  8. El Sulfato de Magnesio prepinzamiento aórtico como preservador energético en cirugía cardíaca

    Santos Gracia, José Juan

    2003-01-01

    Hay evidencia de un déficit crónico de magnesio en la población mundial atribuido a ingestión deficitaria. En los cardiópatas, la utilización de drogas depletoras agrava este déficit y contribuye a la aparición de arritmias malignas. El magnesio ha sido recomendado en el tratamiento del Infarto Agudo del Miocardio por preservar la energía de la célula cardíaca isquémica o reperfundida desde la era “pretrombolítica” y en todas las variantes de arritmias. Sin embargo, su utilización en cardioci...

  9. Relation between phylogeny of African green monkey CD4 genes and their respective simian immunodeficiency virus genes

    Fomsgaard, Anders; Müller-Trutwin, Michaela C.; Diop, Ousmane;

    1997-01-01

    An apparent species-specific relatedness of SIVagm suggests a coevolution with their natural hosts. However, the exact species or subspecies classification of African green monkeys, AGM, is uncertain because current classification schemes rely on phenotype markers, while more definitive genetic...... data are lacking. In this study, the CD4 protein involved in tissue type recognition was gentically cloned and sequence from PBMC RNA from all AGM species, including Barbados green monkeys (BGM). Phylogenetic trees were constructed that also included genomic CD4 nucleotide sequences from patas, sooty......, tantalus, vervets, grivets, and sabaeus formed separate subgroups with BGM grouping closely with vervets. The branching order of the AGM species was related to that of their respective SIVagm env sequences. The study suggests a strong correlation between CD4 phylogeny and the susceptibility of the host...

  10. Cardiopatías y embarazo

    Francisco de Jesús Valladares Carvajal

    2011-01-01

    Full Text Available La cardiopatía es la causa más frecuente de muerte materna indirecta en el mundo. Es decir, la presencia de enfermedad cardíaca no excluye el embarazo, pero aumenta el riesgo para la madre y para el feto y requiere de un tratamiento especial. Los cambios hemodinámicos propios del embarazo pueden hacer sospechar la presencia de enfermedad cardíaca, por lo que es importante conocer los síntomas y signos indicadores de cardiopatía estructural en la mujer embarazada. La morbimortalidad materna dependerá del tipo de cardiopatía y de la capacidad funcional en el momento de la concepción. De otro lado las gestaciones en madres cardiópatas se han asociado también a mayor incidencia de problemas para el feto, y por tanto, de un aumento de la mortalidad perinatal.

  11. The Law of Large Numbers for the Free Multiplicative Convolution

    Haagerup, Uffe; Möller, Sören

    2013-01-01

    In classical probability the law of large numbers for the multiplicative convolution follows directly from the law for the additive convolution. In free probability this is not the case. The free additive law was proved by D. Voiculescu in 1986 for probability measures with bounded support and...... extended to all probability measures with first moment by J.M. Lindsay and V. Pata in 1997, while the free multiplicative law was proved only recently by G. Tucci in 2010. In this paper we extend Tucci’s result to measures with unbounded support while at the same time giving a more elementary proof for the...... case of bounded support. In contrast to the classical multiplicative convolution case, the limit measure for the free multiplicative law of large numbers is not a Dirac measure, unless the original measure is a Dirac measure. We also show that the mean value of lnx is additive with respect to the free...

  12. Avaliação do efeito antiparasitário do omeprazol na prevenção do desenvolvimento de lesões cutâneas em hamsters infectados por Leishmania brasiliensis Evaluation of omeprazole's antiparasitary effect preventing the development of cutaneous lesions due to Leishmania brasiliensis in hamsters

    Hélio Amante Miot

    2005-12-01

    Full Text Available FUNDAMENTOS: A leishmaniose tegumentar americana permanece doença endêmica em diversas regiões brasileiras. A sobrevivência do parasita no interior dos macrófagos se deve, em parte, pela atividade de uma K+/H+-ATPase de membrana que pode ser inibida pelo omeprazol. OBJETIVOS: Avaliar a eficácia do omeprazol na prevenção do desenvolvimento de lesões de leishmaniose em hamsters. MÉTODOS: Empregaram-se 18 hamsters, divididos em três grupos: o grupo L recebeu apenas a inoculação de L. brasiliensis na pata anterior direita, o grupo O recebeu apenas doses diárias de 0,4mg de omeprazol subcutâneo, e o grupo L+O recebeu o inóculo de leishmanias e o tratamento com omeprazol desde o dia da inoculação. O estudo foi conduzido por 42 dias, realizaram-se medidas dos diâmetros das patas semanalmente, e, ao final do estudo, foram realizados esfregaços das lesões para verificação dos parasitas. RESULTADOS: Os hamsters dos grupos L e L+O desenvolveram lesões de leishmaniose tegumentar havendo ulceração em duas patas do grupo L e uma do grupo L+O. Ao final do estudo, a mobilidade e vitalidade no grupo L foram menores que em L+O, e estas menores que no grupo O. Os diâmetros das patas inoculadas nos grupos L e L+O foram significativamente maiores que no início do estudo (pBACKGROUND: Cutaneous leishmaniasis remains an endemic disease in several brazilian regions. The parasite’ survival in macrophages is due to a membrane K+/H+-ATPase that can be inhibited by omeprazole. OBJECTIVES: Evaluate omeprazole’s efficacy preventing the development of cutaneous leishmaniasis in hamsters. METHODS: Eighteen hamsters were divided in 3 groups: the L group received an inoculation of L. brasiliensis on right paw, the O group received daily 0,4mg omeprazole subcutaneously, and L+O group received both omeprazole and the inocule. The study was performed in 42 days, and the measurements of the diameter of paws were done weekly. At the end of the study

  13. Estudo histológico e histoquímico da pele de jurará Kinosternon scorpioides scorpioides (Testudines: Kinosternidae)

    Ana L Abreu-Silva; José A. Silva; Katiene R.S. Souza; Débora M.S. Santos; José G. Pereira; Rafael C. Carvalho; Ambrosio, Carlos E; Miglino, Maria A

    2014-01-01

    O objetivo do presente trabalho foi analisar histológica e histo- químicamente a pele do jurará (Kinosternon scorpioides scorpioides). Foram utilizados seis animais (três machos e três fêmeas). Os animais foram eutanasiados com dose letal de tiopental sódico a 2,5%, para colheita de fragmentos de pele mole das patas e pescoço do animal, que após a fixação em líquido de Bouin, foram incluídos em parafina e corados pelas técnicas de hematoxilina-eosina, Giemsa, Sirius red, Reticulina de Gomori ...

  14. A relevância dos conteúdos petcare para os utilizadores nas plataformas digitais

    Carvalho, Marta Sofia Saldanha de

    2016-01-01

    A maioria dos lares portugueses já conta com a presença de animais de estimação, assistindo-se assim a uma maior consciencialização para cuidar e garantir qualidade de vida aos seus companheiros, na sua maioria de quatro patas. A consciencialização dos direitos dos animais, os novos hábitos e estilo de vida contribuíram para o aumento da adoção de animais domésticos, que hoje em dia já são considerados por muitos como membros da família. Esta dissertação de mestrado centra-se n...

  15. Dinâmica espacial da clorose variegada dos citros em três regiões do Estado de São Paulo

    Laranjeira Francisco F

    2004-01-01

    Full Text Available A Clorose Variegada dos Citros (CVC tem sido considerada a mais importante doença citrícola no Brasil, mas diversos aspectos de sua epidemiologia ainda não são bem conhecidos. O presente trabalho objetivou estudar o arranjo espacial das plantas afetadas, visando caracterizar a dinâmica da doença em três regiões do Estado de São Paulo (Noroeste, Centro e Sul. Por meio de avaliação de sintomas visuais, foram mapeados, quinzenalmente, três talhões de laranja-doce (Citrus sinensis Pêra enxertada em limão Cravo (Citrus limonia, em três regiões do Estado de São Paulo, desde julho de 1998 até dezembro de 2000. Para o estudo da dinâmica espacial, foram aplicadas as seguintes análises: seqüências ordinárias; áreas isópatas; lei de Taylor modificada; índice de dispersão e análise de dinâmica e estrutura de focos. As seqüências ordinárias indicaram uma tendência à aleatoriedade na maioria das avaliações, indicando baixa transmissão a plantas imediatamente vizinhas. A análise de áreas isópatas mostrou pouca formação de focos compactos, numa tendência à uniformidade da incidência da CVC. As demais análises demonstraram pouca diferença no padrão espacial da doença entre as regiões, que pode ser considerado levemente agregado.

  16. Processing of Phonemic Consonant Length: Semantic and Fragment Priming Evidence from Bengali.

    Kotzor, Sandra; Wetterlin, Allison; Roberts, Adam C; Lahiri, Aditi

    2016-03-01

    Six cross-modal lexical decision tasks with priming probed listeners' processing of the geminate-singleton contrast in Bengali, where duration alone leads to phonemic contrast ([pata] 'leaf' vs. [pat:a] 'whereabouts'), in order to investigate the phonological representation of consonantal duration in the lexicon. Four form-priming experiments (auditory fragment primes and visual targets) were designed to investigate listeners' sensitivity to segments of conflicting duration. Each prime derived from a real word ([k(h)[symbol: see text]m]/[g(h)en:]) was matched with a mispronunciation of the opposite duration (*[k(h)[symbol: see text]m:]/*[g(h)en]) and both were used to prime the full words [k(h)[symbol: see text]ma] ('forgiveness') and [g(h)en:a] ('disgust') respectively. Although all fragments led to priming, the results showed an asymmetric pattern. The fragments of words with singletons mispronounced as geminates led to equal priming, while those with geminates mispronounced as singletons showed a difference. The priming effect of the real-word geminate fragment was significantly greater than that of its corresponding nonword singleton fragment. In two subsequent semantic priming tasks with full-word primes a stronger asymmetry was found: nonword geminates (*[k(h)[symbol: see text]m:a]) primed semantically related words ([marjona] 'forgiveness') but singleton nonword primes (*[ghena]) did not show priming. This overall asymmetry in the tolerance of geminate nonwords in place of singleton words is attributed to a representational mismatch and points towards a moraic representation of duration. While geminates require a mora which cannot be derived from singleton input, the additional information in geminate nonwords does not create a similar mismatch. PMID:27089807

  17. Differences in MRI findings between subgroups of recent-onset childhood arthritis

    Kirkhus, Eva [Oslo University Hospital, Rikshospitalet, Department of Radiology, Oslo (Norway); Flatoe, Berit; Smith, Hans-Joergen [Oslo University Hospital, Rikshospitalet and University of Oslo, Faculty of Medicine, Department of Radiology, Oslo (Norway); Riise, Oeystein [Oslo University Hospital, Rikshospitalet, Department of Pediatrics, Oslo (Norway); Reiseter, Tor [Oslo University Hospital, Ullevaal, Department of Radiology, Oslo (Norway)

    2011-04-15

    MRI is sensitive for joint inflammation, but its ability to separate subgroups of arthritis in children has been questioned. Infectious arthritis (IA), postinfectious arthritis (PA), transient arthritis (TA) and juvenile idiopathic arthritis (JIA) are subgroups that may need early, different treatment. To determine whether MRI findings differ in IA, PA/TA and JIA in recent-onset childhood arthritis. Fifty-nine children from a prospective study of incidence of arthritis (n = 216) were, based on clinical and biochemical criteria, examined by MRI. Joint fluid, synovium, bone marrow, soft tissue and cartilage were scored retrospectively and analysed by Pearson chi-square test and logistic regression analysis. Fifty-nine children had MRI of one station. IA was suggested by bone marrow oedema (OR 7.46, P = 0.011) and absence of T1-weighted and T2-weighted low signal intensity synovial tissue (OR 0.06, P = 0.015). Furthermore, soft-tissue oedema and reduced contrast enhancement in the epiphyses were more frequent in children with IA. JIA correlated positively with low signal intensity synovial tissue (OR 13.30, P < 0.001) and negatively with soft-tissue oedema (OR 0.20, P = 0.018). No significant positive determinants were found for PA/TA, but bone marrow oedema, soft-tissue oedema, irregular thickened synovium and low signal intensity synovial tissue was less frequent than in IA/JIA. In children with high clinical suspicion of recent onset arthritis, there was a significant difference in the distribution of specific MRI features among the diagnostic groups. (orig.)

  18. Differences in MRI findings between subgroups of recent-onset childhood arthritis

    MRI is sensitive for joint inflammation, but its ability to separate subgroups of arthritis in children has been questioned. Infectious arthritis (IA), postinfectious arthritis (PA), transient arthritis (TA) and juvenile idiopathic arthritis (JIA) are subgroups that may need early, different treatment. To determine whether MRI findings differ in IA, PA/TA and JIA in recent-onset childhood arthritis. Fifty-nine children from a prospective study of incidence of arthritis (n = 216) were, based on clinical and biochemical criteria, examined by MRI. Joint fluid, synovium, bone marrow, soft tissue and cartilage were scored retrospectively and analysed by Pearson chi-square test and logistic regression analysis. Fifty-nine children had MRI of one station. IA was suggested by bone marrow oedema (OR 7.46, P = 0.011) and absence of T1-weighted and T2-weighted low signal intensity synovial tissue (OR 0.06, P = 0.015). Furthermore, soft-tissue oedema and reduced contrast enhancement in the epiphyses were more frequent in children with IA. JIA correlated positively with low signal intensity synovial tissue (OR 13.30, P < 0.001) and negatively with soft-tissue oedema (OR 0.20, P = 0.018). No significant positive determinants were found for PA/TA, but bone marrow oedema, soft-tissue oedema, irregular thickened synovium and low signal intensity synovial tissue was less frequent than in IA/JIA. In children with high clinical suspicion of recent onset arthritis, there was a significant difference in the distribution of specific MRI features among the diagnostic groups. (orig.)

  19. Comportamiento reproductivo y mutilaciones en el cangrejo de las rocas Grapsus grapsus (Linnaeus, 1758 (Crustacea, Decapoda

    Leonardo Romero

    2013-06-01

    Full Text Available El presente trabajo analiza información de las mudas y observaciones del comportamiento reproductivo de G. grapsus, relacionando las frecuencias de mutilaciones y el comportamiento caní- bal observado en las cópulas. Las colectas de mudas y observaciones sobre las cópulas se llevaron a cabo entre diciembre de 1990 y diciembre de 2001, en 200 m de una orilla rocosa al sur de la Bahía de Ancón, Lima, Perú. G. grapsus vive en grupos de número variable y asociados a grietas donde los individuos buscan refugio. El comportamiento de cortejo observado fue el de "búsqueda-intercepción" he incluyó diferencias como la defensa de territorios no temporales, largas persecusiones e intercepción por varios machos. Un total de 312 cópulas fueron observadas siendo más frecuentes durante el verano. Un total de once intentos de cópula produjeron la muerte de los individuos, siete fueron machos. En todo el periodo de estudio se colectaron un total de 8421 mudas de las cuales 418 presentaban mutilaciones o heridas en el cefalotórax o abdomen. No se observan diferencias significativas entre las tallas de mutilados de ambos sexos. El 73% de las mudas mutiladas presentan una sola mutilación, el 20% presentan dos mutilaciones y el 6% tres; se encontraron mudas hasta con siete apéndices mutilados. Las frecuencias de mutilaciones son significativamente mayores en machos. Las mutilaciones de las quelas y la segunda pata caminadora son más frecuentes en machos, mientras que en las hembras las mutilaciones de la cuarta y tercera pata caminadora son más frecuentes. Se propone que las mutilaciones se producen durante los intentos de cópula, principalmente por diferencias entre el tamaño de los individuos.

  20. Efeitos farmacológicos e toxicológicos do extrato de Posoqueria acutifolia Mart. (Rubiaceae em roedores

    O. V. SOUSA

    2009-01-01

    Full Text Available

    O presente trabalho investigou os efeitos farmacológicos e toxicológicos do extrato metanólico dos galhos de Posoqueria acutifolia. Foram realizados os testes de contorções abdominais, formalina, placa quente, edema de pata e pleurisia, bem como para a toxicidade aguda. As doses de 100, 200 e 400 mg/kg inibiram as contorções abdominais. No teste da formalina, a dose de 400 mg/kg reduziu o tempo de lambida da primeira fase, enquanto este efeito foi observado nas doses de 200 e 400 mg/kg sobre a segunda fase. O tempo de permanência sobre a placa quente aumentou na dose de 400 mg/kg, embora a dose de 200 mg/kg também tenha tido efeito significativo após 90 minutos de tratamento. Houve uma redução do edema de pata, do volume do exsudato e da migração leucocitária nas doses testadas. O extrato testado não foi tóxico nas doses avaliadas. Portanto, o extrato metanólico de P. acutifolia exibe efeitos analgésico e antiinflamatório, o que poderia estar relacionado a seu uso na medicina popular. Palavras-chave: Posoqueria acutifolia; Rubiaceae; efeito analgésico; efeito antiinflamatório; toxicidade aguda.

  1. PMCV and PRV occurrence in wild and farmed fish in Denmark

    Mikkelsen, Susie Sommer; Arnö, J.; Bruun, Morten Sichlau

    family of Reoviridae, while Piscine myocarditis virus (PMCV) is a double-stranded RNA virus of the Totiviridae family. Wild and farmed salmon and trout have not been tested for PRV or PMCV in Denmark before, but both viruses are found in Norway, where they are suspected of causing Heart and Skeletal......Every year salmon are restocked in the 7 rivers Storå, Skjern Å, Varde Å, Sneum Å, Kongeå, Ribe Å and Gudenåen. Six-month-old and 1-year-old salmon for about 2 mio. Kr (€268000) are restocked every year. The salmon are restocked in both the main rivers as well as the larger inlets. 6-month......-old salmon are restocked in smaller rivers where the spawning and growth is ideal. They are released from a boat drifting downstream between September and October. 1-year-old smolt are restocked in a few places in the main rivers in April. They are restocked in large numbers to provide better protection...

  2. Consumers’ perception and knowledge of food safety: results of questionnaires accessible on IZSalimenTO website

    Amaranta Traversa

    2015-04-01

    Full Text Available The present survey was undertaken to investigate consumers’ knowledge of the main foodborne agents and dietary regimen during pregnancy. Data were collected using monthly questionnaires available on IZSalimenTO website between March 2013 and January 2014. Hepatitis A virus questionnaire: 20 respondents (77% recognized berries as foodstuff linked to the outbreak of hepatitis A. The majority correctly indicated as precautionary advice to boil berries before consumption. Botulism questionnaire: 29 respondents (62% indicated pesto as food involved in botulism alert in July 2013. The risk of infant botulism in infant less than 1 year old due to honey consumption is known by 24 respondents (51%. Main foodborne disease questionnaire: the risk of infection by Salmonella after the consumption of foods made with raw eggs is known by the majority (94%; N=17 as well as the treatments to be applied in order to make fresh fish safe from parasites (76%. Pregnancy questionnaire: 20 respondents (74% believed that washing vegetables and fruits with sodium bicarbonate or chlorate solution is able to inactivate Toxoplasma; only 4 (15% reported both raw meat and vegetables washed with sodium bicarbonate as food at risk. Results indicate that all consumers should be trained on behaviour and dietary regimen to be adopted in pregnancy and in infant <1 year old. The website may be considered as a useful tool to assess consumers’ knowledge: both the news section and the contents published may be a source of information and education for consumers on food safety.

  3. Epidemiological study of non-systemic parasitism in dogs in southeast Mediterranean Spain assessed by coprological and post-mortem examination.

    Martínez-Carrasco, C; Berriatua, E; Garijo, M; Martínez, J; Alonso, F D; de Ybáñez, R Ruiz

    2007-01-01

    The prevalence and risk factors of non-systemic canine ecto- and endoparasitism and anthelminthic use in Murcia located at the centre of the Spanish Mediterranean coastal arch, was investigated by coprology and necropsy in up to 275 pet, city shelter and stray dogs in 2001-2004. Faecal parasite stages were detected in 25% of dogs. Species frequency was 6-10% for Toxocara canis, Ancylostomatidae spp., Toxascaris leonina and Isospora canis, and 0.4-1% for Trichuris vulpis, Giardia lamblia, and Dipylidium caninum. Logistic regression indicated that the risk of intestinal parasitism was highest for dogs 1 year old, in the middle to low weight range and kept at the city shelter. Although risk factors varied according to the species, T. canis was most common in <1 year old and Ancylostomatidae spp. was more prevalent in older dogs. This suggests that the dominant species was Uncinaria spp. and not the more zoonotically important Ancylostoma spp. This was further supported by necropsy findings; however, the degree of agreement between post-mortem and coprological examination for intestinal parasites was generally poor. Necropsy revealed 10%G. lamblia, 12%Taenia spp. 38%D. caninum infections. Fleas, ticks and lice were also found in 38%, 6% and 2% of necropsied stray dogs. These results demonstrate the need for an urgent parasite control programme at the city dog shelter and the need to improve the owner's education on zoonotic risks, the proper use of anthelminthics, and other parasite control practices. PMID:17542962

  4. Prevalence of Giardia intestinalis and other zoonotic intestinal parasites in private household dogs of the Hachinohe area in Aomori prefecture, Japan in 1997, 2002 and 2007.

    Itoh, Naoyuki; Kanai, Kazutaka; Hori, Yasutomo; Hoshi, Fumio; Higuchi, Seiichi

    2009-12-01

    An epidemiological study on canine intestinal parasites was undertaken to evaluate changes in the prevalence among private household dogs from the Hachinohe region of Aomori prefecture, Japan, in 1997, 2002 and 2007, using the formalin-ethyl acetate sedimentation technique. The risk of zoonotic transmission from household dogs to humans was also discussed. All intestinal parasites detected in the present study (Giardia intestinalis, Isospora spp., Toxocara canis, Ancylostoma caninum, Trichuris vulpis and Strongyloides stercoralis) showed no changes in prevalence over the past 10 years based on analysis considering canine epidemiological profiles. In particular, prevalence of Giardia intestinalis in dogs under 1 year old, derived from pet shops/breeding kennels and kept indoors was unchanged, remaining at a high level of >15.0% at each time point. Toxocara canis also showed no changes in the group of dogs under 1 year old, bred by private owners and kept outdoors, and the prevalence was >10.0% every year. The present results indicate that the prevalence of Giardia intestinalis and other intestinal parasites in private household dogs has not always decreased, and the potential for direct parasitic zoonotic transmission from dogs to humans may be relatively high level, than from the environment (indoors and outdoors). We recommend careful surveillance of intestinal parasites and aggressive use of anthelminthic in private household dogs under considering the epidemiological factors. PMID:19934595

  5. Larval Pacific herring, Clupea pallasii (Valenciennes), are highly susceptible to viral haemorrhagic septicaemia and survivors are partially protected after their metamorphosis to juveniles

    Hershberger, P.K.; Gregg, J.; Pacheco, C.; Winton, J.; Richard, J.; Traxler, G.

    2007-01-01

    Pacific herring were susceptible to waterborne challenge with viral haemorrhagic septicaemia virus (VHSV) throughout their early life history stages, with significantly greater cumulative mortalities occurring among VHSV-exposed groups of 9-, 44-, 54- and 76-day-old larvae than among respective control groups. Similarly, among 89-day-1-year-old and 1+year old post-metamorphosed juveniles, cumulative mortality was significantly greater in VHSV-challenged groups than in respective control groups. Larval exposure to VHSV conferred partial protection to the survivors after their metamorphosis to juveniles as shown by significantly less cumulative mortalities among juvenile groups that survived a VHS epidemic as larvae than among groups that were previously nai??ve to VHSV. Magnitude of the protection, measured as relative per cent survival, was a direct function of larval age at first exposure and was probably a reflection of gradual developmental onset of immunocompetence. These results indicate the potential for easily overlooked VHS epizootics among wild larvae in regions where the virus is endemic and emphasize the importance of early life history stages of marine fish in influencing the ecological disease processes. ?? 2007 The Authors.

  6. The essential oil qualitative and quantitative composition in the needles of Pinus sylvestris L. growing along industrial transects

    The aim of this study was to evaluate composition of the essential oils in the needles of Pinus sylvestris growing in the areas affected by a cement factory (CF), and an oil refinery (OR). Volatile components of the needles were analyzed by GC and GC/MS. The most heavily polluted CF stand had significantly higher concentration of γ-Terpinene, Caryophyllene oxide in the current-year needles, while higher concentration of δ-3-Carene, α-Terpinene, γ-Terpinene and Terpinolene was documented for 1-year-old needles. The most heavily polluted OR stand had a significantly higher concentration of Sabinene + β-Pinene, 1-epi-Cubenol in the current-year needles and a significantly higher concentration of Camphene, Sabinene + β-Pinene, Myrcene, α-Cadinene, 1-epi-Cubenol in the 1-year-old needles than the least polluted site. Along transects an increase in the amount of some diterpenes and a decrease in the components of the shorter chain essential oils was observed. These effects could be at least partially attributed to SO2. - Quantities of components of essential oil in the needles of Scots pine growing around two factories are described in relation to pollution

  7. Uptake and translocation of 54Mn and 65Zn applied on foliage and bark surfaces on balsam fir (Abies balsamea (L.) Mill.) seedlings

    Uptake and translocation of 54Mn and 65Zn in balsam fir [Abies balsamea (L.) Mill.] seedlings were studied with the radioisotopes applied directly on shoot or main-stem surfaces in a growth chamber. Concentration and distribution of the absorbed radioisotopes in different plant parts depended on distances between source (the application site) and sink (the rest of the seedling), as well as on tissue growth activity. Acidic wetness significantly enhanced radioisotope absorption. 54Mn and 65Zn were found to be concentrated primarily in 1-year old needles at the middle and top levels of the seedling crown. There were significant (P < 0.05) differences in accumulation (Bq g−1) between 54Mn and 65Zn in needles and twigs from foliar uptake. The absorption by seedlings (including the washed application shoot) 70 days after application was 24–32% of the remaining activities for 54Mn and 25–30% for 65Zn. Less than 1% of the absorbed isotopes was translocated from the bark application sites to other plant organs, whereas more than 54% of the activity absorbed at 1-year old shoots moved to the rest of the seedling. (author)

  8. Hepatopatía crónica asociada a fibrosis quística: gasto energético en reposo, factores de riesgo y repercusión en la evolución de la enfermedad Chronic liver disease associated with cystic fibrosis: energy expended at rest, risk factors and impact on the disease's progress

    S. Tabernero da Veiga

    2004-02-01

    Full Text Available Introducción y objetivos: La fibrosis quística es la enfermedad recesiva más frecuente. Existen diferentes alteraciones hepatobiliares; la más importante es el desarrollo de obstrucción biliar y fibrosis periportal. El objetivo es valorar la influencia de la hepatopatía en el estado nutricional, la evolución de la enfermedad y los factores de riesgo asociados. Ámbito: Unidad de Nutrición del Servicio de Gastroenterología del Hospital Infantil La Paz. Material y métodos: Estudio longitudinal prospectivo con 53 pacientes valorados en tres momentos durante 3 años; al inicio, al año y a los 3 años. Solo 37 se siguieron los 3 años. Se realizan 111 mediciones que incluyen: análisis de la composición corporal, del gasto energético, de la ingesta y de las pérdidas energéticas así como balance nitrogenado. Simultáneamente se realizan pruebas de función respiratoria y se valora la presencia de reagudización respiratoria. Resultados: 37 pacientes, 19 mujeres y 18 varones (edad media 13,04 años ± 3,28. Doce (32,43% fueron diagnosticados de hepatopatía (edad media 12,16 años ± 3,86 DS, 11 varones, 1 mujer de los cuales 1 presentó íleo meconial, 5 eran homocigotos, 5 heterocigotos y los 2 restantes presentaban otras mutaciones. Los hepatópatas presentan parámetros antropométricos mejores o similares que los pacientes sin hepatopatía (p NS. Media del índice de Waterlow en hepatópatas: 93,62% ± 7,87 DS; no hepatópatas: 93,06% ± 10,97 DS (p NS. Media de FEV1 en hepatópatas: 88,81 ± 27,32 DS; no hepatópatas: 75,21 ± 27,92 DS (p Introduction and goals: Cystic fibrosis is the most frequent recessive disease. There are various hepato-biliary alterations, of which the most important is the development of biliary obstruction and periportal fibrosis. The goal is to assess the influence of liver disease on the nutritional status, the progress of the disease and the associated risk factors. Scope: Nutrition Unit of the

  9. Vitamin D Status: A Different Story in the Very Young versus the Very Old Romanian Patients

    Chirita-Emandi, Adela; Socolov, Demetra; Haivas, Carmen; Calapiș, Anca; Gheorghiu, Cristina; Puiu, Maria

    2015-01-01

    Background In Romania (latitude 48°15’N to 43°40’N), vitamin D supplementation is common practice mostly in infants 0-1 year old. No published information is available regarding epidemiological data on vitamin D status in the Romanian population for a wide age range and geographical territory. In this context, we aimed to evaluate the seasonal and age variation of vitamin D status in a large Romanian population. Methods 6631 individuals from across Romania had performed 7544 vitamin D assessments (2012-2014) in a chain of private laboratories. Vitamin D (25-hydroxyvitamin D2 and 25-hydroxyvitamin D3) was measured using High Performance Liquid Chromatography. Vitamin D levels were classified as severe deficiency100ng/ml. Results Male to female ratio was 1:2.9. Age ranged from 0 to 85 years. Mean vitamin D levels increased from April (26.3ng/ml) to September (35.6ng/ml) and decreased from October (33.5ng/ml) to March (24.4 ng/ml). Overall 40% had sufficient vitamin D, while the rest were insufficient 33%, deficient 22%, severely deficient 4% and 1% potentially harmful (of them 81% under 1 year old). Males compared to females showed higher percentages of sufficiency (47% vs. 38%). Children 0- 2 years presented the highest percentage of vitamin D sufficiency (77%). Lowest percentages (21%) of sufficiency were in people 80-84 years. Conclusion In Romania, suboptimal vitamin D levels are common (59%), especially in older age, wintertime and in women. Vitamin D supplementation would be most warranted from January to April in the Romanian population. 25-hydroxyvitamin D levels>100ng/ml were relatively prevalent in children 0-1 year old (17.3%). This was attributed to supplementation errors and the fact that high-risk individuals were more likely to visit for medical check-up. Nonetheless, it stresses the need to increase awareness of the importance of preventing Vitamin D supplementation administration errors in the young. PMID:26024516

  10. CO2 uptake of Opuntia ficus-indica (L. Mill. whole trees and single cladodes, in relation to plant water status and cladode age

    Giorgia Liguori

    2013-02-01

    Full Text Available Most of net photosynthesis determinations in Opuntia ficus-indica come from measurements on individual cladodes. However, they have limitations when used to scale up to whole canopy gas exchange, because a large variability of carbon assimilation may occur within the canopy, due to, among others, differences in cladode age and intercepted radiation or individual cladode response to abiotic stresses. The aim of this work was to evaluate the application of open gas exchange chambers, simultaneously applied around the whole canopy, to measure net CO2 uptake, continuously over a 24 h period, in single Opuntia ficus-indica (L. Mill. potted trees and in relation with their water status. Net CO2 uptake was also measured for single cladodes differentiated by age. O. ficus-indica trees continued their photosynthetic activity 60 days after the irrigation was stopped, when soil water content was lower than 5%. At this stage, current-year and 1-year-old cladodes had become flaccid but still the daily net CO2 uptake of non-irrigated trees kept the same rate than at the beginning of the experiment, while watered trees had doubled their net CO2 uptake. The highest instantaneous rates and total daily net CO2 uptake for both well-watered and non-irrigated trees occurred 60 days after the onset of the dry period, when maximal instantaneous rates were 11.1 in well-watered trees and 8.4 mol m–2 s–1 in non-irrigated trees. During the drought period, the chlorenchyma fresh weight decreased by 45% and 30%, in 1- and 2-yearold drought cladodes respectively, and marginally increased in currentyear ones (+20%. Net CO2 uptake for 1-year-old and 2-year-old cladodes changed only at highest photosynthetic photon flux density and temperatures, and average seasonal net CO2 uptake of 2-year-old cladodes was 15% lower than for 1-year-old ones. Whole-tree gas exchange measurements applied for the first time to O. ficus-indica indicated that whole cactus pear trees maintain