WorldWideScience

Sample records for 1-year-old erythrocebus patas

  1. Locomotor Anatomy and Behavior of Patas Monkeys (Erythrocebus patas with Comparison to Vervet Monkeys (Cercopithecus aethiops

    Adrienne L. Zihlman

    2013-01-01

    Full Text Available Patas monkeys (Erythrocebus patas living in African savanna woodlands and grassland habitats have a locomotor system that allows them to run fast, presumably to avoid predators. Long fore- and hindlimbs, long foot bones, short toes, and a digitigrade foot posture were proposed as anatomical correlates with speed. In addition to skeletal proportions, soft tissue and whole body proportions are important components of the locomotor system. To further distinguish patas anatomy from other Old World monkeys, a comparative study based on dissection of skin, muscle, and bone from complete individuals of patas and vervet monkeys (Cercopithecus aethiops was undertaken. Analysis reveals that small adjustments in patas skeletal proportions, relative mass of limbs and tail, and specific muscle groups promote efficient sagittal limb motion. The ability to run fast is based on a locomotor system adapted for long distance walking. The patas’ larger home range and longer daily range than those of vervets give them access to highly dispersed, nutritious foods, water, and sleeping trees. Furthermore, patas monkeys have physiological adaptations that enable them to tolerate and dissipate heat. These features all contribute to the distinct adaptation that is the patas monkeys’ basis for survival in grassland and savanna woodland areas.

  2. Interspecific and temporal variation of ant species within Acacia drepanolobium ant domatia, a staple food of patas monkeys (Erythrocebus patas) in Laikipia, Kenya.

    Isbell, Lynne A; Young, Truman P

    2007-12-01

    The ants that live in the swollen thorns (domatia) of Acacia drepanolobium are staple foods for patas monkeys (Erythrocebus patas). To obtain a better understanding of these insects as resources for patas monkeys, we sampled the contents of 1,051 swollen thorns (ant domatia) over a 22-month period from December 1999 to September 2001, in Laikipia, Kenya. First, we confirmed that of the four species of ants that live on A. drepanolobium, Crematogaster sjostedti, the competitively dominant ant in this system, does not rear significant brood in the swollen thorns and is therefore not a major food item of patas monkeys. Second, across the other three species that do use swollen thorns for rearing their brood, C. nigriceps, C. mimosae, and Tetraponera penzigi, the number of worker ants per swollen thorn increased with increasing competitive dominance. Third, although there was considerable month-to-month variation in the number of workers, immatures, and especially alates (winged reproductives) within species, there was less variation across species because ant production was asynchronous. Variation in domatia contents was poorly related to rainfall for each of the three species. Finally, distal thorns held more alates and fewer workers than interior thorns, and branches higher off the ground held more alates and more workers than lower branches. For the numerically dominant C. mimosae, higher branches held significantly more immature ants than did lower branches. Ants are reliable food resources for patas monkeys, and are probably more reliable than many plant resources in this highly seasonal environment. We estimate that patas monkeys may get as much as a third of their daily caloric needs from these ants year-round. As ants and other insects are widely consumed by primates, we suggest that greater consideration be given to species differences in animal food choices and that further studies be conducted to examine the degree to which ants influence energy intake and

  3. Metabolism and pharmacokinetics of the combination Zidovudine plus Lamivudine in the adult Erythrocebus patas monkey determined by liquid chromatography-tandem mass spectrometric analysis

    Because of their similarity to humans, non-human primates constitute useful preclinical models in which to examine potential human drug toxicities. Antiretroviral nucleoside reverse transcriptase inhibitor (NRTI) toxicity is currently under investigation in Erythrocebus patas monkeys, and whereas NRTI pharmacokinetics have been studied in other monkey species, pharmacokinetics for Zidovudine plus Lamivudine (AZT/3TC) dosing have not been reported in the patas. Here we present 24 h serum pharmacokinetic parameters after a single oral exposure to the combination of AZT (40 mg) and 3TC (24 mg), doses equivalent to a human daily dose of Combivir (registered) . The patas (n = 3) AZT/3TC pharmacokinetic profiles were similar to those seen in other primate species. Average maximum serum concentrations (Cmax) for AZT and 3TC were 2.35 and 2.65 μg/ml, respectively, and were observed at 0.83 h (Tmax). Cmax was 13.34 μg/ml for the AZT-glucuronide (AZT-G) and was 0.023 μg/ml for the potentially toxic minor metabolite 3'-amino-3'-deoxythymidine (AMT), both occurring at about 1 h after dosing. Similar elimination half-times, 0.70 and 0.68 h-1, were found for AZT and AZT-G, respectively, while 3TC was eliminated about half as fast (0.33 h-1) resulting in AUC(0-∞) values of 6.97 μg/ml h for 3TC, 2.99 μg/ml h for AZT, 20.5 μg/ml h for AZT-G and 0.002 for AMT 6.97 μg/ml h. This study shows similar metabolism and pharmacokinetics for oral administration of AZT/3TC in the adult patas monkey, other primate species and humans. The data validate the use of the patas monkey for studies of NRTI toxicity

  4. Influence of environment enrichment to the behaviors of Erythrocebus patas in captive%环境丰容对赤猴行为分配影响的研究

    陈霖; 叶安城; 池章伟

    2014-01-01

    In 2011, the 3 male and 3 female Erythrocebus patas raised in Fuzhou Zoo suffered from such unhealthy growing conditions as unitary behavior, coarse hairs, dry and ruptured tails and claudication, etc. They were transferred to a cage with certain environment enrichment and stayed for one year. Compared with the conditions in the previous cage, the allocations of Erythrocebus patas' day-time behaviors of foraging and sports increase by 61.3% and 213.2% respectively, and their walking and resting time decrease by 41.2% and 26.7% respectively. Now, the Erythrocebus patas have fine hairs, their tails recover to normal conditions, and claudication basically disappears.%2011年初福州动物园饲养的3公3雌赤猴出现行为单一、毛发粗糙、尾部干枯断裂、见有跛行等不良生长状况。为了改变猴群出现的不良状况,福州动物园将赤猴转移至新兽舍饲养,该新兽舍有较大的活动空间、良好的植被覆盖,还在新兽舍中安置有假山、攀网、跑道等设施供赤猴锻炼。此外,还将赤猴部分饲料由定点投喂改为抛洒投喂。经过约一年适应,赤猴昼间行为分配相较旧笼时觅食和运动行为分别提高61.3%、213.2%;行走和休息时间分别减少41.2%、26.7%,猴群被毛良好,尾部恢复正常,跛行现象基本消失。

  5. Emotional Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... & Stages > Toddler > Emotional Development: 1 Year Olds Ages & Stages Listen Español Text ...

  6. Social Development: 1 Year Olds

    ... in Action Medical Editor & Editorial Advisory Board Sponsors Sponsorship Opporunities Spread the Word Shop AAP Find a Pediatrician ... Ages & Stages > Toddler > Social Development: 1 Year Olds Ages & Stages Listen Español Text ...

  7. Language Development: 1 Year Olds

    ... Stages Listen Español Text Size Email Print Share Language Development: 1 Year Olds Page Content Article Body ... assured, it’s not your imagination. He’s developing his language and comprehension skills right on schedule. This giant ...

  8. Nutritional benefits of Crematogaster mimosae ants and Acacia drepanolobium gum for patas monkeys and vervets in Laikipia, Kenya.

    Isbell, Lynne A; Rothman, Jessica M; Young, Peter J; Rudolph, Kathleen

    2013-02-01

    Patas monkeys (Erythrocebus patas) are midsized primates that feed extensively on the gum of Acacia drepanolobium and the ants are housed in swollen thorns of this Acacia. Their diet resembles that expected more of smaller bodied primates. Patas monkeys are also more like smaller bodied primates in reproducing at high rates. We sought to better understand the convergence of patas monkeys with smaller bodied primates by comparing their feeding behavior on ants and gum with that of closely related, sympatric vervets (Chlorocebus pygerythrus), and analyzing the nutrient content of the gum of A. drepanolobium and of Crematogaster mimosae, the most common ant species eaten by patas monkeys in Laikipia, Kenya. All occurrences of feeding and moving during focal animal sampling revealed that 1) patas monkeys seek A. drepanolobium gum but vervets avoid it; 2) both species open swollen thorns most often in the morning when antsare less active; 3) patas monkeys continually feed onswollen thorns and gum while moving quickly throughout the day, whereas vervets reduce their consumption of these items and their travel rate at mid-day, and; 4) vervets eat young swollen thorns at a higher rate than patas monkeys. Patas monkeys are able to spend little time acquiring substantial amounts of energy, protein, and minerals from A. drepanolobium gum and C. mimosae ants each day. These findings, when coupled with evidence of causes of infant and adult female mortality, suggest that reproductive success of female patas monkeys is more immediately affected by illness, disease, interactions between adults and infants, and access to water than by food. PMID:23280312

  9. Mitochondrial compromise in 3-year old patas monkeys exposed in utero to human-equivalent antiretroviral therapies.

    Liu, Yongmin; Shim Park, Eunwoo; Gibbons, Alexander T; Shide, Eric D; Divi, Rao L; Woodward, Ruth A; Poirier, Miriam C

    2016-08-01

    Antiretroviral (ARV) drug therapy, given during pregnancy for prevention of mother-to-child transmission of human immunodeficiency virus 1 (HIV-1), induces fetal mitochondrial dysfunction in some children. However, the persistence/reversibility of that dysfunction is unclear. Here we have followed Erythrocebus patas (patas) monkey offspring for up to 3 years of age (similar in development to a 15-year old human) after exposure of the dams to human-equivalent in utero ARV exposure protocols. Pregnant patas dams (3-5/exposure group) were given ARV drug combinations that included zidovudine (AZT)/lamivudine (3TC)/abacavir (ABC), or AZT/3TC/nevirapine (NVP), for the last 10 weeks (50%) of gestation. Infants kept for 1 and 3 years also received drug for the first 6 weeks of life. In offpsring at birth, 1 and 3 years of age mitochondrial morphology, examined by electron microscopy (EM), was compromised compared to the unexposed controls. Mitochondrial DNA (mtDNA), measured by hybrid capture chemiluminescence assay (HCCA) was depleted in hearts of patas exposed to AZT/3TC/NVP at all ages (P < 0.05), but not in those exposed to AZT/3TC/ABC at any age. Compared to unexposed controls, mitochondrial reserve capacity oxygen consumption rate (OCR by Seahorse) in cultured bone marrow mesenchymal fibroblasts from 3-year-old patas offspring was ∼50% reduced in AZT/3TC/ABC-exposed patas (P < 0.01), but not in AZT/3TC/NVP-exposed patas. Overall the data show that 3-year-old patas sustain persistent mitochondrial dysfunction as a result of perinatal ARV drug exposure. Environ. Mol. Mutagen. 57:526-534, 2016. © 2016 Wiley Periodicals, Inc. PMID:27452341

  10. Parental spanking of 1-year-old children and subsequent child protective services involvement✩

    Lee, Shawna J.; Grogan-Kaylor, Andrew; Berger, Lawrence M.

    2014-01-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once ...

  11. Development of newborn and 1-year-old reference phantoms based on polygon mesh surfaces

    The purpose of this study is the development of paediatric reference phantoms for newborn and 1-year-old infants to be used for the calculation of organ and tissue equivalent doses in radiation protection. The study proposes a method for developing anatomically highly sophisticated paediatric phantoms without using medical images. The newborn and 1-year-old hermaphrodite phantoms presented here were developed using three-dimensional (3D) modelling software applied to anatomical information taken from atlases, textbooks and images provided by the Department of Anatomy of the Federal University of Pernambuco, Brazil. The method uses polygon mesh surfaces to model body contours, the shape of organs as well as their positions and orientations in the human body. Organ and tissue masses agree with corresponding data given by the International Commission on Radiological Protection for newborn and 1-year-old reference children. Bones were segmented into cortical bone, spongiosa, medullary marrow and cartilage to allow for the use of μCT images of trabecular bone for skeletal dosimetry. Anatomical results show 3D images of the phantoms’ surfaces, organs and skeletons, as well as tables with organ and tissue masses or skeletal tissue volumes. Dosimetric results present comparisons of organ and tissue absorbed doses or specific absorbed fractions between the newborn and 1-year-old phantoms and corresponding data for other paediatric stylised or voxel phantoms. Most differences were found to be below 10%. (paper)

  12. A rare case of peripheral T-cell lymphoma in 1-year-old child

    Vignesh Kandakumar

    2011-01-01

    Full Text Available Peripheral T-cell lymphoma (PTCL represents approximately 12% of lymphoid neoplasms. They are even rarer in children and represent only 1% of Non-Hodgkin′s lymphoma in this age group. We report a case of PTCL in a 1-year-old female child for its rarity.

  13. A rare case of peripheral T-cell lymphoma in 1-year-old child

    Vignesh Kandakumar; Prasanth Ganesan; Peush Bajpai; Rejiv Rajendranath; Sagar Tenali; Urmila Majhi; Ponni Sivaprakasam

    2011-01-01

    Peripheral T-cell lymphoma (PTCL) represents approximately 12% of lymphoid neoplasms. They are even rarer in children and represent only 1% of Non-Hodgkin′s lymphoma in this age group. We report a case of PTCL in a 1-year-old female child for its rarity.

  14. Parental spanking of 1-year-old children and subsequent child protective services involvement✩

    Lee, Shawna J.; Grogan-Kaylor, Andrew; Berger, Lawrence M.

    2015-01-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once in the past month. Spanking at age 1 was associated with increased odds of subsequent CPS involvement (adjusted odds ratio=1.36, 95% CI [1.08, 1.71], ppunishment, professionals who work with families should counsel parents not to spank infants and toddlers. For optimal benefits, efforts to educate parents regarding alternative forms of discipline should begin during the child's first year of life. PMID:24602690

  15. Traumatic spinal epidural hematoma in a 1-year-old boy.

    Tarbé de Saint Hardouin, A-L; Grévent, D; Sainte-Rose, C; Angoulvant, F; Chéron, G

    2016-07-01

    Traumatic spinal epidural hematoma is uncommon in children, making rapid diagnosis difficult. In this report, we present a case of traumatic cervical epidural hematoma in a 1-year-old boy, diagnosed with computed tomography scanning and magnetic resonance imaging (MRI). Management was conservative and the lesion regressed spontaneously. The presentation in childhood is often nonspecific. MRI is the imaging modality of choice for diagnosing these lesions. Conservative treatment has to be considered in cases with a benign clinical course and provided that the patient is followed up neurologically with repeated MRI. PMID:27266638

  16. Parental spanking of 1-year-old children and subsequent child protective services involvement.

    Lee, Shawna J; Grogan-Kaylor, Andrew; Berger, Lawrence M

    2014-05-01

    The majority of U.S. parents spank their children, often beginning when their children are very young. We examined families (N=2,788) who participated in a longitudinal community-based study of new births in urban areas. Prospective analyses examined whether spanking by the child's mother, father, or mother's current partner when the child was 1-year-old was associated with household CPS involvement between age 1 and age 5. Results indicated that 30% of 1-year-olds were spanked at least once in the past month. Spanking at age 1 was associated with increased odds of subsequent CPS involvement (adjusted odds ratio=1.36, 95% CI [1.08, 1.71], pchildren, there was a 33% greater probability of subsequent CPS involvement for children who were spanked at age 1. Given the undesirable consequences of spanking children and a lack of empirical evidence to suggest positive effects of physical punishment, professionals who work with families should counsel parents not to spank infants and toddlers. For optimal benefits, efforts to educate parents regarding alternative forms of discipline should begin during the child's first year of life. PMID:24602690

  17. Development of 1-year-old computational phantom and calculation of organ doses during CT scans using Monte Carlo simulation

    With the rapidly growing number of CT examinations, the consequential radiation risk has aroused more and more attention. The average dose in each organ during CT scans can only be obtained by using Monte Carlo simulation with computational phantoms. Since children tend to have higher radiation sensitivity than adults, the radiation dose of pediatric CT examinations requires special attention and needs to be assessed accurately. So far, studies on organ doses from CT exposures for pediatric patients are still limited. In this work, a 1-year-old computational phantom was constructed. The body contour was obtained from the CT images of a 1-year-old physical phantom and the internal organs were deformed from an existing Chinese reference adult phantom. To ensure the organ locations in the 1-year-old computational phantom were consistent with those of the physical phantom, the organ locations in 1-year-old computational phantom were manually adjusted one by one, and the organ masses were adjusted to the corresponding Chinese reference values. Moreover, a CT scanner model was developed using the Monte Carlo technique and the 1-year-old computational phantom was applied to estimate organ doses derived from simulated CT exposures. As a result, a database including doses to 36 organs and tissues from 47 single axial scans was built. It has been verified by calculation that doses of axial scans are close to those of helical scans; therefore, this database could be applied to helical scans as well. Organ doses were calculated using the database and compared with those obtained from the measurements made in the physical phantom for helical scans. The differences between simulation and measurement were less than 25% for all organs. The result shows that the 1-year-old phantom developed in this work can be used to calculate organ doses in CT exposures, and the dose database provides a method for the estimation of 1-year-old patient doses in a variety of CT examinations. (paper)

  18. Successful Endosonography-Guided Drainage of an Intra-Abdominal Abscess in a 1-Year-Old Infant

    Ito, Yukiko; Isayama, Hiroyuki; Nakai, Yousuke; Umefune, Gyoutane; Sato, Tatsuya; Nakahara, Saori; Suwa, Junko; Kato, Keiichi; Nakata, Ryo

    2016-01-01

    Endoscopic ultrasound (EUS)-guided intervention has been established as a safe, effective and minimally invasive procedure for various diseases in adults, but there have been limited reports in pediatric patients. Herein, we report our experience with successful EUS-guided drainage of an intra-abdominal abscess in a 1-year-old infant concomitant with disseminated intravascular coagulation. The abscess was punctured via the stomach using a standard, convex-type echoendoscope, and the patient’s condition improved after naso-cystic catheter placement. Although the clinical course was complicated by delayed hemorrhage from the puncture site, the bleeding was successfully managed by endoscopic hemostasis using a standard forward-viewing endoscope. PMID:27114437

  19. Diet in 1-year-old farm and control children and allergy development: results from the FARMFLORA birth cohort

    Karin Jonsson

    2016-08-01

    Full Text Available Background: A farming environment confers strong protection against allergy development. We have previously shown that farming mothers consume more full-fat dairy than control mothers, who instead consume more low-fat dairy, margarine, and oils; margarine and oil intake was associated with increased risk of allergy development in their children. Objectives: The aims of this study were to investigate the differences in diet between children in farming and control families at 1 year of age, to investigate the relation between the diets of the mothers and their children, and to relate the children's diet to allergy development. Design: The diet of 1-year-old children from dairy farming families (n=28 and from control families in the same rural area (n=37 was assessed by 24-h dietary recalls, followed by 24-h food diaries. Allergy was diagnosed by pediatricians at 3 years of age using strict predefined criteria. Results: Farm children had a higher intake of farm milk, whole cream, cholesterol, saturated fat, and fat in total and tended to eat more butter, while controls consumed more carbohydrates and poultry and tended to eat more margarine. Farm children also had higher intakes of homemade porridge/gruel, oily fish, and iodine. The intake of butter and whole milk in children and mothers correlated significantly in farm families but not in controls. A weak negative association was found between seafood intake and allergy development, while allergy was positively associated with the intake of pork as well as zinc in the control group; these intakes also correlated with each other. Conclusions: Consistent with mothers in farming families, the children consumed more full-fat dairy and saturated fat than did controls, but this could not be linked to the low risk of allergy in the farming group. Seafood intake might protect against allergy development, in accordance with earlier findings.

  20. A congenital anterior urethral diverticulum associated with obstructive urinary symptoms in a 1-year-old male child: A case report and review of the literature

    Mehmet Hanifi Okur

    2015-05-01

    Full Text Available Congenital anterior urethral diverticula are rarely found in children. We present the case of a 1-year-old male child with a congenital anterior urethral diverticulum. This condition can lead to obstructive lower urinary tract symptoms and urosepsis. The clinical presentation, diagnosis, and management of this rare condition are discussed in this report. The diagnosis was made using retrograde urethrography. Patient was treated with open diverticulectomy and urethroplasty

  1. Accumulation pattern of endogenous cytokinins and phenolics in different organs of 1-year-old cytokinin pre-incubated plants: implications for conservation

    Aremu, A.O.; Plačková, L. (Lenka); Grúz, J. (Jiří); Bíba, O. (Ondřej); Šubrtová, M. (Michaela); Novák, O. (Ondřej); Doležal, K. (Karel); van Staden, J.

    2015-01-01

    A better understanding of phytohormone physiology can provide an essential basis to coherently achieve a conservation drive/strategy for valuable plant species. We evaluated the distribution pattern of cytokinins (CKs) and phenolic compounds in different organs of 1-year-old greenhouse-grown Tulbaghia simmleri pre-treated (during micropropagation) with three aromatic CKs (benzyladenine=BA, meta-topolin=mT, meta-topolin riboside=mTR). The test species is highly valuable due to its medicinal an...

  2. Profound Vitamin B12 Deficiency in a 1-Year-Old Child in Botswana: A Call to Initiate Early Empiric Therapy.

    Gajudhur, Juyotee; Slone, Jeremy S; Mehta, Parth S; Mahoney, Donald

    2016-08-01

    Vitamin B12 deficiency is a rare diagnosis in young children. We present the case of a 1-year-old Zimbabwean child with profound anemia. Further testing revealed undetectable levels of vitamin B12 and positive intrinsic factor antibodies that were drawn after the initiation of empiric treatment with parenteral vitamin B12. We report the evaluation and management of vitamin B12 deficiency in a resource-limited setting. Vitamin B12 deficiency should be considered in children presenting with unexplained cytopenias with consideration of empiric treatment with parenteral vitamin B12, as developmental and neurological complications of vitamin B12 deficiency can be devastating and permanent. PMID:27306229

  3. 0~1岁婴儿出生缺陷的流行病学调查%Epidemiological survey on 0-1 years old baby with birth defect

    倪少义; 何洁壁; 陈少娜; 吴翔; 蔡幸生; 黄伟鹏; 王榕生; 洪艳苹; 倪少英; 卢晓航

    2012-01-01

    Objective To understand the incidence of birth defect in 0-1 years old baby in some regions of Jieyang, then to determine the focus groups for prevention. So that it can provide a foundation for birth defect prevention, pre-pregnancy and pregnancy care. Methods Those babies, who were born in Jiedong County, Puning City and Rongcheng District from March 3, 2011 to May 2, 2012 were surveyed by general investigation. Birth defect based on clinical diagnosis, its entity and statistical standard referred to the regulations of International Centre on Birth Defects and Prematurity. Results 238 cases of birth defect babies were found out of 10 773 cases of monitored new babies. The top five diseases of baby birth defects were congenital heart disease, talipes equinovarus, polydactyly, cleft lip and palate and fetal-edematous-syndrome. Some babies had higher incidence of birth defects, such as baby boy, low birth weight baby, and those babies whose mother did not take folic acid, vitamin and trace elements during pregnancy and whose family members smoking and excessive drinking (P < 0.05). Conclusion The incidence rate of birth defects in 0-1 years old baby is 220.92 per ten thousand in some regions of Jieyang City. It is slightly higher than the national average, so it needs attention from each side. Strengthening propaganda and education, screening and preventing birth defects are matters of great urgency.%目的 了解揭阳部分地区0~1岁婴儿出生缺陷的发病情况,确定预防的重点人群,为出生缺陷的预防和孕前、孕期保健提供依据.方法 采用普查的方式,对揭东县、普宁市、榕城区三地2011年3月3日~2012年5月2日出生的婴儿进行调查.出生缺陷以临床诊断为依据,病种及统计标准参照国际出生缺陷监测情报交换所的规定.结果 共监测10 773名婴儿,发现出生缺陷238例;婴儿出生缺陷排名前5位的疾病分别是先天性心脏病、马蹄内翻足、多指(趾)、唇(腭)裂

  4. Saber morir. Antropología de la muerte y relatos de psicópatas en el cine.

    Sánchez-Biosca, Vicente

    1995-01-01

    El presente texto estudia la relación existente entre la antropología de la muerte y los relatos de psicópatas. Partiendo de una concepc8ión del relato que se inspira de Walter Benjamin y se materializa en las formas de continuidad, serialidad, ciclismo y final, pone en relación los rasgos formales de los nuevos relatos de psicópatas en el cine de los años 80 en adelante con el imaginario científico de la postmodernidad.

  5. Labor de la enfermera en la atención a gestantes cardiópatas

    Maritza Miclín Velázquez

    1999-04-01

    Full Text Available Se indica el desarrollo alcanzado en los últimos años en la atención a los pacientes cardiópatas. Se hizo un estudio descriptivo y retrospectivo de 51 gestantes cardiópatas atendidas en el Servicio de Perinatología del Hospital de Maternidad Norte "Tamara Bunke" de Santiago de Cuba, durante 1994, con el propósito de valorar la importancia de la labor de Enfermería durante el embarazo, parto y puerperio de estas pacientes, de donde se derivó que los cuidados especiales mantenidos garantizaron que la enfermedad cardíaca no repercutiera sobre la tasa de morbilidad y mortalidad maternoperinatales, que las complicaciones fueran mínimas en las madres y que no se produjeran defunciones.The development achieved during the last years in the attention of cardiacs is stressed. A descriptive and retrospective study of 51 pregnant women attended at the Perinatology Service of the "Tamara Bunke" North Maternal Hospital, in Santiago de Cuba, during 1994, was conducted aimed at assessing the importance of the nurse´s work during the pregnancy, delivery and puerperium of these patients. It was concluded that thanks to the special care given, the heart disease did not influence on the maternal and perinatal morbidity and mortality rate, mothers´ complications were minimal, and there were no deaths.

  6. Mutations in Genes patA and patL of Anabaena sp. Strain PCC 7120 Result in Similar Phenotypes, and the Proteins Encoded by Those Genes May Interact ▿

    Liu, Jinjie; Wolk, C. Peter

    2011-01-01

    PatA resembles a response regulator protein with a defective DNA-binding domain, and PatL (All3305) is a pentapeptide repeat protein. A yeast two-hybrid library identified PatL as a protein with which PatA may interact. Heterocysts of patA and patL Anabaena sp. form nearly exclusively terminally in long filaments, further linking the genes.

  7. Actitudes de los médicos alópatas frente a la acupuntura en una EPS en Colombia. 2011

    Bernal Doblado, Mauricio

    2011-01-01

    Esta investigación constituye una descripción concreta sobre actitudes, conocimientos y prácticas de médicos alópatas con respecto a la Acupuntura, proporcionando información relevante tanto para directivos que determinan las políticas, filosofías y servicios concretos en el sistema de salud, como para médicos alópatas cuyo criterio determina en gran medida la integración de la Acupuntura a tratamientos de casos específicos de usuarios del sistema de Salud. Objetivo: Describir las actitudes q...

  8. Superação da dormência em sementes de pata-de-vaca (Bauhinia angulata Vell. = Overcoming dormancy of pata-de-vaca (Bauhinia angulata Vell seeds.

    Oscar José Smiderle

    2010-12-01

    Full Text Available O trabalho foi realizado no Laboratório de Análise de Sementes da Embrapa Roraima, com o objetivo de estudar métodos pré-germinativos em laboratório para a superação da dormência de sementes de pata-de-vaca. O delineamento experimental foi o inteiramente ao acaso com sete tratamentos e 4 repetições de 50 sementes. Os tratamentos pré-germinativos foram: escarificação com imersão em ácido sulfúrico (PA por 5, 10 e 15 minutos; imersão em álcool etílico por 5, 10 e 15 minutos; e testemunha, sem tratamento prévio nas sementes. As sementes foram incubadas a 25oC no interior de caixas plásticas, tipo ‘gerbox’, contendo como substrato papel ‘germitest’ umedecido. Diariamente, até 89 dias após a semeadura, foi feita avaliação da embebição e da germinação; a partir dos dados de germinação foi estimada a velocidade de germinação. Os resultados demonstraram que os tratamentos pré-germinativos promoveram acréscimo de pelo menos 50% na germinaçãodas sementes de pata-de-vaca, sendo que a escarificação com ácido sulfúrico (15 minutos, revelou ser o método mais efetivo para a superação da dormência desta espécie. A utilização de álcool (10 minutos pode ser uma boa alternativa para promover a germinação de sementes de pata-de-vaca.= - This study was carried out at Seed laboratory of Embrapa Roraima, with the objective to study the overcoming dormancy of pata-de-vaca (Bauhinia angulata seeds. The experimental design was a completely randomized design with seven treatments and four replicates of 50 seeds each. The pre-germinations treatments were: sulfuric acid - PA (5, 10 and 15 minutes, ethylene alcohol (5, 10 and 15 minutes, and control. The seeds were disposed in plastic boxes over humidified paper and incubated at 25oC in a germinator. The parameters evaluated were germination, imbibition, speed of germination, normal seedlings at 89 days after sowing. The germinated seeds were counted daily during 89

  9. Superação da dormência em sementes de pata-de-vaca (Bauhinia angulata Vell). = Overcoming dormancy of pata-de-vaca (Bauhinia angulata Vell) seeds.

    Oscar José Smiderle; Francisco Joaci de Freitas Luz

    2010-01-01

    O trabalho foi realizado no Laboratório de Análise de Sementes da Embrapa Roraima, com o objetivo de estudar métodos pré-germinativos em laboratório para a superação da dormência de sementes de pata-de-vaca. O delineamento experimental foi o inteiramente ao acaso com sete tratamentos e 4 repetições de 50 sementes. Os tratamentos pré-germinativos foram: escarificação com imersão em ácido sulfúrico (PA) por 5, 10 e 15 minutos; imersão em álcool etílico por 5, 10 e 15 minutos; e testemunha, sem ...

  10. Avaliação da qualidade de amostras comerciais de boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. e ginco (Ginkgo biloba L. Control quality evaluation of commercial samples of boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. and ginkgo (Ginkgo biloba L.

    J. G. de Melo

    2004-01-01

    Full Text Available O presente trabalho procurou avaliar a qualidade de produtos comercializados à base de boldo, pata-de-vaca e ginco, através dos parâmetros contidos na Farmacopéia Brasileira e na literatura específica. Foram analisadas oito amostras de boldo, nove de pata-de-vaca e sete de ginco, adquiridas em farmácias na cidade do Recife. A metodologia consistiu em avaliar: os rótulos e bulas dos produtos verificando se estavam de acordo com a RDC n o 17 de 24/02/2000 e a portaria 110/97 da ANVISA; realizar análise sensorial; verificar a autenticidade das amostras e sua pureza. Todas as embalagens de boldo, pata-de-vaca e seis de ginco continham erros ou ausência de informações científicas, além da falta de bula. Na verificação de impurezas, todas as de boldo, cinco de pata-de-vaca, e uma amostra de ginco foram reprovadas. Todos os produtos analisados apresentaram alguma irregularidade segundo os códigos oficiais, sendo necessário uma maior intensificação na vigilância de produtos à base de plantas medicinais no Brasil.This study aimed to evaluate the quality of commercial products prepared with boldo (Peumus boldus Molina, pata-de-vaca (Bauhinia spp. and ginkgo (Ginkgo biloba L. by using parameters from the Brazilian Pharmacopoeia and specific literature. Eight samples of "boldo", nine of "pata-de-vaca", and seven of ginkgo were analyzed, all bought from pharmacies in Recife (Pernambuco, Brazil. The methodology consisted in evaluating the products’ labels and instructions to verify their accordance to RDC n o 17 of 02/24/2000 and ANVISA (National Sanitary Surveillance Agency decree 110/97, undertaking a sensorial analysis, and verifying the authenticity and purity of the samples. All of the packages of "boldo" and "pata-de-vaca" and six of the packages of ginkgo contained mistakes or lacked scientific information; instructions were also missing. After analyzing for impurities, all samples of "boldo", five of "pata-de-vaca", and one of

  11. The Stain That Gets Increasingly Visible. The Ethnic Segregation in the Pata Rât (Stain snout Ghetto, Cluj-Napoca

    Viorel Mionel

    2012-04-01

    Full Text Available This paper presents, in the first part, a brief theoretical analisys of the ethnic segregation and the causes entailing this kind of urban fragmentation. Undoubtedly, discrimination is one of the main reasons of segregation, closely followed by the countless social disadvantages. Besides all these, we may point out the poor quality of public policies which instead of improving the marginalized people’s situaion, pushes them deeper into poverty and stigma, as in the case study of Pata Rât, Cluj-Napoca. This paper aims at drawing attention to discrimination and segregation of the Gypsy people living in the outskirts of Cluj-Napoca city, usually called Pata Rât ghetto, and the urgent need for new inclusion policies.

  12. Overexpression of patA and patB, Which Encode ABC Transporters, Is Associated with Fluoroquinolone Resistance in Clinical Isolates of Streptococcus pneumoniae▿

    Garvey, Mark I.; Baylay, Alison J.; Wong, Ryan L.; Piddock, Laura J. V.

    2010-01-01

    Fifty-seven clinical isolates of Streptococcus pneumoniae were divided into four groups based on their susceptibilities to the fluoroquinolones ciprofloxacin and norfloxacin and the dyes ethidium bromide and acriflavine. Comparative reverse transcription-PCR was used to determine the level of expression of the genes patA and patB, which encode putative ABC transporters. Overexpression was observed in 14 of the 15 isolates that were resistant to both fluoroquinolones and dyes and in only 3 of ...

  13. Aprovechamiento de Patas de Pollos como Alternativa para disminuir Residuos Generados en los Mataderos Use of Chicken Feet as an Alternative to the reduce Wastes from Slaughterhouse

    Poliana F Almeida

    2012-01-01

    Full Text Available Se presenta un estudio sobre la producción de jaleas y gelatinas a partir de las patas de pollo, usualmente producidas como desechos de los mataderos de aves. La investigación se llevó a cabo en dos etapas. En la primera etapa, las jaleas se obtuvieron a partir de las patas del pollo y se evaluaron sus cualidades sensoriales para verificar su aceptabilidad. En la segunda etapa, se produjo gelatinas y se analizó también sus cualidades sensoriales para comprobar su aceptabilidad. Los resultados mostraron que la mayoría de los catadores aprobaron los productos con más de 7 puntos en la escala hedónica y más del 80% dijeron que consumirían los productos. Los niveles de proteínas en las jaleas y gelatinas de patas de pollo superaron en cuatro veces los niveles de los productos comerciales, lo que indica una superioridad con respecto a las calidades químicas y potencialmente medicinales.A study on the production of jelly and gelatin from chicken feet, produced as wasted from chicken slaughterhouse is presented. The study was conducted in two parts. In the first part, jellies were produced from chicken feet and sensory quality was done to verify their acceptability. In the second step, gelatins were elaborated from chicken feet and also subjected to sensory analysis. Results showed that most experts in the panel accepted the products with more than 7 points in the hedonic scale and 80% said that they would consume these chicken products. Gelatin and jelly protein contents were four times larger than commercial products, indicating superiority in their chemistry and potential medicinal qualities.

  14. pata Terminal Aerodrome Forecast

    National Oceanic and Atmospheric Administration, Department of Commerce — TAF (terminal aerodrome forecast or terminal area forecast) is a format for reporting weather forecast information, particularly as it relates to aviation. TAFs are...

  15. Synthesis of Biotin Linkers with the Activated Triple Bond Donor [p-(N-propynoylaminotoluic Acid] (PATA for Efficient Biotinylation of Peptides and Oligonucleotides

    Martina Jezowska

    2012-11-01

    Full Text Available Biotin is an important molecule for modern biological studies including, e.g., cellular transport. Its exclusive affinity to fluorescent streptavidin/avidin proteins allows ready and specific detection. As a consequence methods for the attachment of biotin to various biological targets are of high importance, especially when they are very selective and can also proceed in water. One useful method is Hüisgen dipolar [3+2]-cycloaddition, commonly referred to as “click chemistry”. As we reported recently, the activated triple bond donor p-(N-propynoylaminotoluic acid (PATA gives excellent results when used for conjugations at submicromolar concentrations. Thus, we have designed and synthesized two biotin linkers, with different lengths equipped with this activated triple bond donor and we proceeded with biotinylation of oligonucleotides and C-myc peptide both in solution and on solid support with excellent yields of conversion.

  16. Nutrition and Iron Status of 1-Year Olds following a Revision in Infant Dietary Recommendations

    Thorisdottir, Asa V.; Inga Thorsdottir; Gestur I. Palsson

    2011-01-01

    A previous study showed low iron status in 12-month-old Icelandic infants associated most strongly with cow's milk intake and growth. Infant dietary recommendations were revised in 2003. This study investigated nutrition and iron status in a new infant cohort. Subjects/Methods. Randomly selected infants were prospectively investigated for diet, anthropometry, and iron status (n = 110–141). Results. Breastfeeding initiation rate was 98%; 38% of 5-month olds were exclusively and 20% of 12-month...

  17. PREDICTORS OF EMOTIONAL AND BEHAVIORAL PROBLEMS IN 1-YEAR-OLD CHILDREN: A LONGITUDINAL PERSPECTIVE.

    Sirvinskiene, Giedre; Zemaitiene, Nida; Jusiene, Roma; Markuniene, Egle

    2016-07-01

    Emotional and behavioral problems at an early age can reasonably be considered a high-risk factor for later mental health disorders. The aim of the article is to reveal predictive factors of 1½-year-old children's emotional and behavioral problems. The study was a part of a prospective birth-cohort study. The study sample consisted of 172 full-term infants (born during Gestational Weeks 37-42) and their mothers. Emotional and behavioral problems at the age of 1½ years were measured using the Child Behavior Checklist for Ages 1½-5 (T. Achenbach & L. Rescorla, 2000), which was completed by mothers. Emotional and behavioral problems at age of 1½ years were more prevalent in infants born via cesarean section, as compared to infants born vaginally without administration of medication. Newborns' suboptimal functioning after birth, complicated emotional acceptance of pregnancy, a couple's nonsatisfactory relationship during pregnancy, maternal distress during pregnancy and in the first months after childbirth, and inflexible and parent-oriented attitudes toward infant-rearing also predicted children's emotional and behavioral problems independent of sociodemographic factors. Results suggest that biomedical and psychosocial factors which manifest themselves in the prenatal and perinatal periods can have associations with later infant and child mental health. PMID:27336695

  18. Psicopatología, crimen violento, cine y realidad: desmontando mitos sobre psicópatas y psicóticos

    José Manuel Pozueco Romero

    2015-08-01

    Full Text Available Psicosis, esquizofrenia, paranoia, personalidad múltiple y otro sinfín de términos son los que parecen coincidir con los conceptos coloquiales y peyorativos de locos, tarados, etc. Según numerosos autores, parece ser que la psicosis es la enfermedad mental más grave que existe, y, también, es evidente la cantidad de veces que ha sido (mal utilizada para recrear centenares de películas; el ejemplo más claro de esto mismo lo tenemos en el famoso film de Alfred Hitchcock, Psicosis, que analizamos aquí desde una perspectiva psicológico-forense y criminológica. Por otra parte, el tópico de la psicopatía también ha venido siendo amplia y erróneamente abordado por los medios de comunicación, y mal caracterizado en numerosas películas y series televisivas, todo esto a pesar de que hoy día se trata de un constructo clínico-forense válido y fiable. La relación de la psicopatía con la violencia y la criminalidad es bastante conocida, si bien este aspecto también requiere de una serie de rigurosos matices. En este artículo trataremos de desmontar el mito generalizado de que los enfermos mentales son muy peligrosos, y de que su criminalidad se ciñe exclusivamente a los homicidios, algo que también extienden muchos autores al caso de los psicópatas.

  19. Efeitos do alfa-tocoferol nas lesões de isquemia-reperfusão induzidas em pata direita de ratos

    Bitu-Moreno José

    2001-01-01

    Full Text Available Recentes estudos demonstraram que os radicais livres de oxigênio parecem desempenhar papel importante nas lesões de isquemia-reperfusão. O alfa-tocoferol(AT age in vivo como um anti-oxidante. Nosso objetivo foi o de verificar se o AT atenuava as lesões de isquemia-reperfusão em pata direita de ratos. Os animais, randomizados, foram divididos nos seguintes grupos(G: G1-controle sem isquemia; G2 e G3 - quatro horas isquemia e duas reperfusão. Os animais do G2 foram tratados com salina e os do G3 com AT, 50mg/kg. Como parâmetros examinamos as alterações de volume e circunferência do pé direito ao longo do experimento, assim como a captação de 99mTc-pirofosfato e a microscopia eletrônica de transmissão do músculo soleus direito. Os aumentos de volume e circunferência do pé dos animais do G2 foram estatisticamente maiores quando comparados com o G1. As medidas do G3 não diferiram do G1. A captação de 99mTc-pirofosfato foi bem aumentada nos G2 e G3, quando comparados ao G1, porém sem diferenças entre os grupos isquêmicos. As lesões ao MET foram menos intensas em três animais do G3, quando comparados ao G2. Conclusão: O tratamento com AT diminuiu a formação do edema mas só protegeu parcialmente as células musculares contra as lesões de isquemia-reperfusão.

  20. Serological Evidence of Infection with Endemic Human Pathogens Among Free-Ranging Old World Monkeys in Puerto Rico.

    Hemme, Ryan R; Lopez-Ortiz, Ricardo; Garcia, Brenda Rivera; Sharp, Tyler M; Galloway, Renee L; Elrod, Mindy G; Hunsperger, Elizabeth A

    2016-05-01

    Serum specimens from free-ranging but nonnative patas monkeys (Erythrocebus patas) and rhesus macaques (Macaca mulatta) in southwestern Puerto Rico (PR) were tested for antibodies to infection with dengue viruses (DENVs), West Nile virus (WNV), Leptospira species, and Burkholderia pseudomallei by microneutralization, plaque reduction neutralization, microscopic agglutination, and indirect hemagglutination, respectively. Of 23 animals (21 E. patas and two M. mulatta) tested, all had evidence of prior DENV infection, and of 17 animals tested for WNV, nine (53%) had evidence of prior infection. Of 24 (22 E. patas, two M. mulatta) tested for Leptospira spp., 10 (42%) had evidence of prior exposure, and one patas monkey had antibodies against B. pseudomallei The acquisition of pathogens endemic among humans in PR by resident nonhuman primates merits further study to define modes of acquisition. PMID:27001754

  1. Detection of cyclospora in captive chimpanzees and macaques by a quantitative PCR-based mutation scanning approach

    Marangi, M; A.V. Koehler; S.A. Zanzani; Manfredi, M.T.; E. Brianti; Giangaspero, A.; Gasser, R. B.

    2015-01-01

    Background Cyclospora is a protistan parasite that causes enteritis in several species of animals including humans. The aim of this study was to investigate the presence of Cyclospora in captive non-human primates. Methods A total of 119 faecal samples from Pan troglodytes, Macaca sylvanus, Cercopithecus cephus, Erythrocebus patas, Chlorocebus aethiops and Macaca fascicularis from a wildlife animal rescue center as well as from Macaca fascicularis from an experimental primate research center ...

  2. Individual variation in fathers' testosterone reactivity to infant distress predicts parenting behaviors with their 1-year-old infants.

    Kuo, Patty X; Saini, Ekjyot K; Thomason, Elizabeth; Schultheiss, Oliver C; Gonzalez, Richard; Volling, Brenda L

    2016-04-01

    Positive father involvement is associated with positive child outcomes. There is great variation in fathers' involvement and fathering behaviors, and men's testosterone (T) has been proposed as a potential biological contributor to paternal involvement. Previous studies investigating testosterone changes in response to father-infant interactions or exposure to infant cues were unclear as to whether individual variation in T is predictive of fathering behavior. We show that individual variation in fathers' T reactivity to their infants during a challenging laboratory paradigm (Strange Situation) uniquely predicted fathers' positive parenting behaviors during a subsequent father-infant interaction, in addition to other psychosocial determinants of paternal involvement, such as dispositional empathy and marital quality. The findings have implications for understanding fathering behaviors and how fathers can contribute to their children's socioemotional development. © 2015 Wiley Periodicals, Inc. Dev Psychobiol 58: 303-314, 2016. PMID:26497119

  3. Unexpected dominance of 1 year old parr among migrating salmon and sea trout individuals in the River Siesartis, Lithuania

    Kęstutis Skrupskelis

    2015-12-01

    However, 1 year age parr unexpectedly dominated among salmon juveniles descending towards the Sea in the restocked Siesartis River, which is situated 400 km to the Baltic Sea. The same phenomenon has been observed among migrating sea trout individuals, too. Mass migration of 1 year age salmon and sea trout parr with mean body length ranging from 69 to 150 mm can hardly be explained by density-dependant regulatory mechanisms alone. Possible impact of particularly long distance migration route is also discussed.

  4. Accumulation pattern of endogenous cytokinins and phenolics in different organs of 1-year-old cytokinin pre-incubated plants: implications for conservation

    Aremu, A.O.; Plačková, Lenka; Grúz, Jiří; Bíba, Ondřej; Šubrtová, Michaela; Novák, Ondřej; Doležal, Karel; van Staden, J.

    2015-01-01

    Roč. 17, č. 6 (2015), s. 1146-1155. ISSN 1435-8603 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : Acclimatisation * conservation * meta-topolins Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.633, year: 2014

  5. Psicópatas y asesinos en serie

    Antuña Bellerín, Mª de los Ángeles; Rodríguez Franco, Luís

    2007-01-01

    En este artículo, distinguimos la psicopatía de otros trastornos, como el explosivo intermitente, el disocial o el negativista desafiante, que conllevan comportamientos violentos y que se encuentran recogidos en los manuales diagnósticos al uso. Tras realizar un breve bosquejo de la evolución del término psicopatía, analizamos los problemas que se presentan entre el trastorno antisocial de la personalidad y la psicopatía para centrarnos a continuación en los llamados asesinos en serie. Si bie...

  6. Adaptação cultural de instrumento para avaliação da capacidade física em cardiopatas Adaptación cultural de instrumento para evaluación de la capacidad física en cardiópatas Cultural adaptation of an instrument to assess physical fitness in cardiac patients

    Gabriela de Barros Leite Domingues

    2011-04-01

    Full Text Available OBJETIVO: Validar o conteúdo e avaliar a confiabilidade do instrumento Veterans Specific Activity Questionnaire, adaptado culturalmente para uso na população brasileira de cardiopatas. MÉTODOS: O instrumento foi traduzido, retrotraduzido e analisado por comitê de juízes para avaliação das equivalências semântico-idiomática e cultural. As atividades físicas indicadas no instrumento incomuns ao cotidiano da população-alvo foram substituídas. Outro comitê de especialistas analisou a equivalência metabólica das atividades substituídas. A proporção de concordância de avaliação dos juízes foi quantificada pelo Índice de Validade de Conteúdo. O pré-teste foi realizado em duas etapas (n1 e n2 = 15. A confiabilidade foi avaliada por meio do teste re-teste (intervalo de 7-15 dias, n = 50. RESULTADOS: Na avaliação das equivalências semântico-idiomática e cultural, os itens com Índice de Validade de Conteúdo OBJETIVO: Validar el contenido y la confiabilidad del instrumento Veterans Specific Activity Questionnaire, adaptado culturalmente para uso en la población brasileña de cardiópatas. MÉTODOS: El instrumento fue traducido y retro traducido y analizado por comité de árbitros para evaluación de las equivalencias semántico-idiomática y cultural. Las actividades físicas indicadas en el instrumento, no comunes a lo cotidiano de la población de interés fueron sustituidas. Otro comité de especialistas analizó la equivalencia metabólica de las actividades sustituidas. La proporción de concordancia de evaluación de los árbitros fue cuantificada por el Índice de Validez de Contenido. La pre-test fue realizada en dos etapas (n1 y n2=15. La confiabilidad fue evaluada por medio de la prueba re-test (intervalo de 7-15 días, n=50. RESULTADOS: En la evaluación de las equivalencias semántico-idiomática y cultural, los itens con Índice de Validez de Contenido OBJECTIVE: To validate the content and to evaluate the

  7. Doença coronária obstrutiva em hepatopatas crônicos que aguardam transplante hepático Enfermedad coronaria obstructiva en hepatópatas crónicos que aguardan trasplante hepático Obstructive coronary disease in patients with chronic liver disease awaiting liver transplantation

    Moacir Fernandes de Godoy

    2011-01-01

    grado importante con consecuente aumento de riesgo o incluso contraindicación para trasplante hepático. OBJETIVOS: Analizar la contribución de los factores de riesgo clásicos para la enfermedad arterial coronaria (EAC en pacientes portadores de IHA con y sin coronariopatía obstructiva. MÉTODOS: Evaluación de los factores de riesgo para EAC en 119 pacientes, en un servicio de referencia para trasplante hepático, con las siguientes características: más de 40 años de edad, portadores de IHA y sometidos a cinecoronariografía. RESULTADOS: Coronariopatía obstructiva fue detectada en 21 (17,6% de los casos. Estos pacientes presentaban realmente niveles bajos de colesterol, siendo de 129,0±53,5mg/dL con mediana de 117,0mg/dL en los hepatópatas con coronarias normales y 135,4±51,7mg/dL con mediana de 122,0mg/dL en los hepatópatas con coronariopatía obstructiva (P=0,8215. En la regresión logística multivariada, la edad, el sexo, el índice de masa corporal, así como las presencias de diabetes, de tabaquismo y de etilismo no tuvieron significancia estadística aislada en la diferenciación entre los grupos. También no hubo asociación con la etiología de la IHA. A su vez, la hipertensión arterial se mostró relevante en la asociación con EAC (P=0,0474. CONCLUSIÓN: Sólo la hipertensión arterial fue factor de riesgo con significancia estadística para el desarrollo de EAC en pacientes con IHA aguardando trasplante hepático. Por ser un factor de riesgo cambiable, este hallazgo orienta hacia una práctica de actitudes terapéuticas en la tentativa de evitarse o retardar el desarrollo de la EAC en estos pacientes.BACKGROUND: Advanced liver failure (ALF usually presents hypocholesterolemia. Nevertheless, some patients with ALF develops major coronary obstructive diseases with consequent increased risk or contraindication to liver transplantation. OBJECTIVE: To analyze the contribution of classical risk factors for coronary artery disease (CAD in patients

  8. Allelopathic activity of fresh and dry extracts of Stryphnodendron adstringens (Mart. Coville and Bauhinia forficata link leaves on the germination and initial development of tomato seedlings / Atividade alelopática dos extratos fresco e seco de folhas de barbatimão (Stryphnodendron adstringens (Mart. Coville e pata-devaca (Bauhinia forficata link sobre a germinação e desenvolvimento inicial de plântulas de tomate

    Gisela Ferreira

    2009-07-01

    Full Text Available The objective of this study aimed at the verification of the allelopatic action of extracts of “pata-devaca” (Bauhinia forficata Link and “barbatimão” (Stryphnodendron adstringens (Mart. Coville on seeds of tomato (Lycopersicum esculentum Mill. Tomato seeds placed in translucent “gerbox” were treated with aqueous extracts prepared with fresh and dry leaves of the tested species at the following concentrations: 100%, 75%, 50%, 25%, and 0% (control. The experimental design was completely randomized with five treatments and five replications of 25 seeds per plot per species. The data were submitted to the analysis of variance and the means compared by Tukey test at 5% of probability. Germination percentage, mean time and germination rates (MGT and MGR, and mean of the primary root length were evaluated. No difference was found for germination percentage of tomato seeds for the different extracts. For MGR, all treatments with fresh leaf extract differed from the check. MGT and MGR showed differences among the following dry leaf extracts concentrations: 25%, 75% and 100%. All treatments presented inhibitory effect on the length of the primary root.O trabalho teve por objetivo verificar a ação alelopática de pata-de-vaca (Bauhinia forficata Link, e barbatimão (Stryphnodendron adstringens (Mart. Coville em sementes de tomate (Lycopersicum esculentum Mill. As sementes de tomate foram tratadas com extratos aquosos preparados a partir de folhas frescas e secas das espécies-teste nas concentrações de 100%, 75%, 50%, 25% e 0% (controle e acondicionadas em ‘gerbox’ transparente. O delineamento experimental foi inteiramente casualizado, com cinco tratamentos e cinco repetições de 25 sementes por parcela por espécie-teste. Foram avaliados porcentagem, tempo e velocidade médios de germinação e, comprimento médio de raiz primária. Os dados foram submetidos à análise de variância e as médias comparadas por Tukey a 5% de

  9. Hábitos alimentares de crianças menores de 1 ano amamentadas e não-amamentadas Feeding habits of breastfed and non-breastfed children up to 1 year old

    Graciete O. Vieira

    2004-01-01

    Full Text Available OBJETIVOS: Descrever os hábitos alimentares de crianças amamentadas e não-amamentadas através da análise dos alimentos consumidos pelas crianças menores de 1 ano de idade na cidade de Feira de Santana, BA, no ano de 2001. MÉTODOS: Foi realizado um estudo transversal, no qual foram aplicados questionários às mães das crianças menores de 1 ano no dia nacional de vacinação, presentes nas 44 (71% unidades de vacinação, selecionadas por estratificação simples. Foram avaliadas 2.319 crianças, representando 24,3% da população estimada. As medidas de associação calculadas foram: razão de prevalência, com intervalo de confiança a 95%, e de significância estatística, através do teste do qui-quadrado com respectivo valor p. RESULTADOS: Nas crianças com idade igual ou inferior a 4 meses e não-amamentadas, foi observada uma chance 8,2 e 6,7 vezes maior de a criança ser alimentada, respectivamente, com a refeição da família (IC 95% 3,23-20,66 e com papas de legumes (IC 95% 3,84-11,78. Na mesma faixa etária, as prevalências de crianças não-amamentadas que receberam água, chás, sucos e papa de frutas foram significativamente maiores (70,7% versus 19,7%, 63,3% versus 26,7%, 33,3% versus 4,9% e 14,4% versus 1,4%, respectivamente. CONCLUSÕES: As crianças amamentadas, quando comparadas com as não-amamentadas, apresentaram melhores hábitos no que se refere à época de introdução dos alimentos complementares.OBJECTIVE: To describe the eating habits of breastfed and non-breastfed children through the analysis of food intake by children younger than one year of age in Feira de Santana in 2001. METHODS: Cross-sectional study. The mothers of children younger than one year answered a questionnaire during the national vaccination day in 44 (71% vaccination units selected by simple stratification. 2,319 children were evaluated, representing 24.3% of the estimated population. Prevalence ratio and 95% confidence interval were calculated. Statistical significance was determined using the chi-square test. RESULTS: Non-breastfed children aged four months or younger were 8.2 and 6.7 times more likely to receive the family food (95% CI: 3.23-20.66 or vegetable soup (95% CI: 3.84-11.78, respectively. In the same age group, the prevalence of non-breastfed children receiving water, juice, and fruit was significantly higher in relation to breastfed children (70.7 vs 19.7%, 63.3 vs 26.7%, 33.3 vs 4.9% and 14.4 vs 1.4%, respectively. CONCLUSION: Breastfed children had healthier habits than non-breastfed children in terms of the introduction of complementary foods.

  10. Seroprevalence of Toxoplasma gondii infection in captive mammals in three zoos in Mexico City, Mexico.

    Alvarado-Esquivel, Cosme; Gayosso-Dominguez, Edgar Arturo; Villena, Isabelle; Dubey, J P

    2013-09-01

    Antibodies to Toxoplasma gondii were determined in 167 mammals in three zoos in Mexico City, Mexico, using the modified agglutination test (MAT). Overall, antibodies to T. gondii were found in 89 (53.3%) of the 167 animals tested. Antibodies were found in 35 of 43 wild Felidae: 2 of 2 bobcats (Lynx rufus); 4 of 4 cougars (Puma concolor); 10 of 13 jaguars (Panthera onca); 5 of 5 leopards (Panthera pardus); 7 of 7 lions (Panthera leo); 2 of 3 tigers (Panthera tigris); 2 of 3 ocelots (Leopardus pardalis); 2 of 2 Sumatran tigers (Panthera tigris sumatrae); lof 2 Jaguarundi (Herpailurus jagouaroundi); but not in 0 of 2 oncillas (Leopardus tigrinus). Such high seroprevalence in wild felids is of public health significance because of the potential of oocyst shedding. Four of 6 New World primates (2 of 2 Geoffroy's spider monkeys [Ateles geoffroyi], 1 of 3 Patas monkeys [Erythrocebus patas], and 1 of 1 white-headed capuchin [Cebus capucinus]) had high MAT titers of 3,200, suggesting recently acquired infection; these animals are highly susceptible to clinical toxoplasmosis. However, none of these animals were ill. Seropositivity to T. gondii was found for the first time in a number of species. PMID:24063119

  11. Trasplante Renal: una mejor alternativa para los nefrópatas crónicos

    Fernando Renjel Claros

    2010-06-01

    Full Text Available El trasplante renal desde 1954, cuando se realizó el primer trasplante renal exitoso en gemelos monocigóticos en el “PeterBent Brigham Hospital”, hasta ahora se considera como la mejor alternativa para los pacientes que tienen Enfermedad Renal Crónica Avanzada, ya que restablece no solamente la salud del paciente con enfermedad renal, sino que lo reintroduce a las actividades sociales, laborales y hasta físicas. El trasplante renal es un tratamiento eficaz, de alto costo en nuestro medio, pero accesible y más económico en relación al financiamiento que se requiere para mantener un paciente en hemodiálisis.Actualmente el trasplante renal es realizado en varios centros hospitalarios en todo el mundo con grandes resultados, por lo que el objetivo de la presente revisión es prestar información sobre la selección del donante y receptor, las contraindicaciones del trasplante, el manejo pre y post-trasplante y las complicaciones que se puedan presentar.

  12. Nutrición en el niño cardiópata

    Carlos Alberto Velasco

    2007-03-01

    Full Text Available La clasificación de las enfermedades cardíacas pediátrica, en congénitas y adquiridas, restrictivas y no restrictivas, en cianóticas y no cianóticas, quirúrgicas y no quirúrgicas y agudas y crónicas, ha sido útil para determinar el impacto en el estado nutricional de los niños. El manejo nutricional del niño con cardiopatía congénita es complejo, debido a la restricción hídrica, a los elevados requerimientos calóricos y a la prevalencia de intolerancia a los alimentos. A pesar de esto, un estrecho seguimiento y muchos métodos de alimentación son esenciales para obtener unos óptimos resultados médicos, nutricionales y psicosociales.

  13. Marchenko-Pastur Theorem and Bercovici-Pata bijections for heavy-tailed or localized vectors

    Benaych-Georges, Florent

    2012-01-01

    The celebrated Marchenko-Pastur theorem gives the asymptotic spectral distribution of sums of random, independent, rank-one projections. Its main hypothesis is that these projections are more or less uniformly distributed on the first grassmannian, which implies for example that the corresponding vectors are delocalized, i.e. are essentially supported by the whole canonical basis. In this paper, we propose a way to drop this delocalization assumption and we generalize this theorem to a quite general framework, including random projections whose corresponding vectors are localized, i.e. with some components much larger than the other ones. The first of our two main examples is given by heavy tailed random vectors (as in a model introduced by Ben Arous and Guionnet or as in a model introduced by Zakharevich where the moments grow very fast as the dimension grows). Our second main example is given by vectors which are distributed as the Brownian motion on the unit sphere, with localized initial law. Our framewor...

  14. EFFECTS OF P APPLICATION ON N AND P ABSORPTION AND SUGAR ACCUMULATION BY 1-YEAR-OLD ALOE VERA IRRIGATED WITH SEAWATER%施磷对海水灌溉下一年生芦荟氮磷吸收及糖分积累的影响

    邵晶; 刘玲; 刘兆普; 宁建凤; 郑青松

    2008-01-01

    在对大田海水灌溉试验的基础上,进行海水灌溉下的肥料试验。库拉索芦荟(Aloe vera)是一种CAM光合碳同化途径的多年生旱生经济植物,具有一定的耐盐性。在国外,芦荟研究的成果被广泛应用在医药、保健、食品等行业,已形成一大产业。最近的研究报告表明,与其他植物一样,盐分胁迫造成芦荟体内盐分积累、营养元素缺失,

  15. ¡Cuídese, no meta la pata!: sexualidad juvenil en escolares de Medellín (Colombia

    Doris Elena Ospina Muñoz

    2013-12-01

    Full Text Available Objetivo: Discutir con escolares, mediante taller educativo, resultados de investigaciones sobre sexualidad juvenil e identificar ejes para la educación sexual y la formación de docentes. Metodología: Estudio cualitativo sobre sexualidad con escolares de grado 10º en Medellín, Colombia (2008-2011. Previo consentimiento se realizaron actividades educativas sobre imagen corporal, disonancia cognitiva, maternidad y paternidad adolescente, derechos de la comunidad LGBTI y ética sexual. Se analizaron evidencias escritas bajo la modalidad de discusión de expertos. Hallazgos: Los jóvenes reconocieron la sexualidad como asunto central que requiere apropiación del cuerpo, reflexividad y comunicación efectiva con padres y maestros; sin embargo, prevalece en ellos la visión trágica de la vivencia sexual. Conclusión: Los adolescentes requieren educación para la libertad, donde participen de espacios propuestos para ellos o creados por ellos, según sus necesidades y contextos y puedan tomar decisiones autónomas y responsables.

  16. ¡Cuídese, no meta la pata!: sexualidad juvenil en escolares de Medellín (Colombia)

    Doris Elena Ospina Muñoz; Margarita María Gómez Gómez; Marcela Carrillo Pineda

    2013-01-01

    Objetivo: Discutir con escolares, mediante taller educativo, resultados de investigaciones sobre sexualidad juvenil e identificar ejes para la educación sexual y la formación de docentes. Metodología: Estudio cualitativo sobre sexualidad con escolares de grado 10º en Medellín, Colombia (2008-2011). Previo consentimiento se realizaron actividades educativas sobre imagen corporal, disonancia cognitiva, maternidad y paternidad adolescente, derechos de la comunidad LGBTI y ética sexual. Se analiz...

  17. The WHO Collaborating Centre for Research and Control of Schistosomiasis at Niamey, Niger

    Chippaux J-P

    1997-01-01

    Full Text Available The Centre de Recherche sur les Méningites et les Schistosomes (CERMES is a research institute depending on the Organisation de Coordination et de Coopération pour la lutte contre les Grandes Endémies - a West African Organization for Public Health - devoted to the studies on schistosomiasis and meningitis. The staff includes 32 persons with 11 scientists and one financial officer. The activities of the CERMES involving schistosomiasis concern three research units: (a ecology of human and animal schistosomiasis transmission; the CERMES defined the different patterns of schistosomiasis transmission in Niger (involving African dry savana; in this field, we have shown, (i the existence of important variability in conditions of transmission of S. haematobium and, (ii natural hybridization between parasitic species of the ruminants (S. bovis and S. curassoni and genetic interaction between human and animal parasites; (b definition of morbidity indicators usable for rapid assessment methods, for appraisal of the severity of the disease and for the evaluation of the efficiency of control methods; we have established the correlation between ultrasonographic data and some cheap and simple field indicators; (c immune response and protective immunity induced by recombinant glutathion S-transferase (Sm28, Sb28 and Sh28 in homologous and heterologous animal models including goats, sheep and non human primates (Erythrocebus patas. In Niger, we participate in all control programs against schistosomiasis to define control strategies, to supervise operations and to participate in their evaluation with external experts. International collaborations constitute a frame including four laboratories in Africa and six laboratories in developed countries (Europe and USA

  18. The interplay between speed, kinetics, and hand postures during primate terrestrial locomotion.

    Patel, Biren A

    2010-02-01

    Nonprimate terrestrial mammals may use digitigrade postures to help moderate distal limb joint moments and metapodial stresses that may arise during high-speed locomotion with high-ground reaction forces (GRF). This study evaluates the relationships between speed, GRFs, and distal forelimb kinematics in order to evaluate if primates also adopt digitigrade hand postures during terrestrial locomotion for these same reasons. Three cercopithecine monkey species (Papio anubis, Macaca mulatta, Erythrocebus patas) were videotaped moving unrestrained along a horizontal runway instrumented with a force platform. Three-dimensional forelimb kinematics and GRFs were measured when the vertical force component reached its peak. Hand posture was measured as the angle between the metacarpal segment and the ground (MGA). As predicted, digitigrade hand postures (larger MGA) are associated with shorter GRF moment arms and lower wrist joint moments. Contrary to expectations, individuals used more palmigrade-like (i.e. less digitigrade) hand postures (smaller MGA) when the forelimb was subjected to higher forces (at faster speeds) resulting in potentially larger wrist joint moments. Accordingly, these primates may not use their ability to alter their hand postures to reduce rising joint moments at faster speeds. Digitigrady at slow speeds may improve the mechanical advantage of antigravity muscles crossing the wrist joint. At faster speeds, greater palmigrady is likely caused by joint collapse, but this posture may be suited to distribute higher GRFs over a larger surface area to lower stresses throughout the hand. Thus, a digitigrade hand posture is not a cursorial (i.e. high speed) adaptation in primates and differs from that of other mammals. PMID:19639641

  19. Synthesis of Biotin Linkers with the Activated Triple Bond Donor [p-(N-propynoylamino)toluic Acid] (PATA) for Efficient Biotinylation of Peptides and Oligonucleotides

    Martina Jezowska; Joanna Romanowska; Burcu Bestas; Ulf Tedebark; Malgorzata Honcharenko

    2012-01-01

    Biotin is an important molecule for modern biological studies including, e.g., cellular transport. Its exclusive affinity to fluorescent streptavidin/avidin proteins allows ready and specific detection. As a consequence methods for the attachment of biotin to various biological targets are of high importance, especially when they are very selective and can also proceed in water. One useful method is Hüisgen dipolar [3+2]-cycloaddition, commonly referred to as “click chemist...

  20. Psicopatología, crimen violento, cine y realidad: desmontando mitos sobre psicópatas y psicóticos

    José Manuel Pozueco Romero; María Elena García Baamonde; Juan Manuel Moreno Manso; Macarena Blázquez Alonso

    2015-01-01

    Psicosis, esquizofrenia, paranoia, personalidad múltiple y otro sinfín de términos son los que parecen coincidir con los conceptos coloquiales y peyorativos de locos, tarados, etc. Según numerosos autores, parece ser que la psicosis es la enfermedad mental más grave que existe, y, también, es evidente la cantidad de veces que ha sido (mal) utilizada para recrear centenares de películas; el ejemplo más claro de esto mismo lo tenemos en el famoso film de Alfred Hitchcock, Psicosis, que analizam...

  1. Reflexiones sobre psicoprofilaxis quirúrgica en niños cardiópatas (II Cuestionamiento de la psicoprofilaxis como simple información.

    M Arrazola Aranzadi

    1989-01-01

    Full Text Available Describe las ansiedades de una niña de cinco años, a la hora de enfrentarse a la operación de corazón a la que iba a ser sometida y las dificultades para asumir la información acerca de lo que le iba a suceder. Se comentan los mecanismos de defensa que más utiliza, y su evolución psicológica hasta dos años después de la operación. Los autores son partidarios de una metodología individualizada, adaptada al funcionamiento mental del niño, en la práctica de la psicoprofilaxis quirúrgica.

  2. The Efflux Pump Inhibitor Reserpine Selects Multidrug-Resistant Streptococcus pneumoniae Strains That Overexpress the ABC Transporters PatA and PatB▿ †

    Garvey, Mark I.; Piddock, Laura J. V.

    2008-01-01

    One way to combat multidrug-resistant microorganisms is the use of efflux pump inhibitors (EPIs). Spontaneous mutants resistant to the EPI reserpine selected from Streptococcus pneumoniae NCTC 7465 and R6 at a frequency suggestive of a single mutational event were also multidrug resistant. No mutations in pmrA (which encodes the efflux protein PmrA) were detected, and the expression of pmrA was unaltered in all mutants. In the reserpine-resistant multidrug-resistant mutants, the overexpressio...

  3. Pata es la traviesa : La cortesana Estefanía, el engaño mutuo y la sífilis en El casamiento engañoso

    Sáez, Adrián J.

    2012-01-01

    This article analizes the figure of doña Estefanía de Caicedo, woman who Campuzano gets married, justifying her immoral behaviour for her attitude and tricks («tapada», cosmet-ics, etc.). Furthermore, it is also studied her relation with syphilis, illness she passes on to the second lieutenant inside the scheme of mutual deceive presented in this cervantine novel.

  4. Anti-inflammatory activity of Momordica charantia in edema paw and in cortisol seric modulation; Potencial antiinflamatorio da Momordica charantia no edema de pata e na modulacao do cortisol serico

    Magnata, Simey S.L.P. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear]. E-mail: sfmagnata@terra.com.br; Correia, Marilia B.L.; Brandao, Jose Odinilson C.; Souza, Grace M.L.; Catanho, Maria Teresa J.A. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Biofisica e Radiobiologia; Terra, Daniele A.; Amorim, Lucia F. [Rio Grande do Norte Univ., Natal, RN (Brazil). Dept. de Fisiologia

    2005-07-01

    The first sources that the humanity disposed to disease's treatment was plants and herbs. The Momordica charantia, Melao de Sao Caetano (bitter melon), occur in South and Central America and in East, it has been used as an anti-diabetic agent, anti-tumor, anti-helmintic and anti-ulcerogenic. The objective of this study is to research the Momordica charantia's activity on inflammatory process and the change on cortisol hormone seric concentration. To evaluate the anti-inflammatory activity were used mice (n=5) in test groups (30,60,100,250 mg/kg of extract) and control (negative and positive) groups (AAS 250 mg/kg and NaCl 0,9%); the inflammatory agent (carrageenan 1% p/v, 0,1 mL) was injected into right hind paw planter surface, 30 min after, the groups received each dose IP of extract, AAS and solution saline respectively; 4 hour after the mice was sacrificed and the difference between right and left hind foot mass was measured. There was a significant reduction (p<0,05)in carrageenan-induced edema paw at test from control group, the best result was obtained at 60 mg/kg dose which inhibits edema formation by 50%. To determinate the cortisol concentrations male Wistar rats, were divided in three groups: control, test A (2 hours of treatment) and test B (4 hours of treatment). The control group received 0,25 mL of saline solution (NaCl) 0,9% and the test groups 0,25 mL of Momordica charantia's aqueous extract, obtained by decoction of green leaves, (31,16 mg/kg animal); all by via IP. After the treatment, the animals were sacrificed and the serum obtained for realization of dosages. The cortisol was determined through radioimmunoassay. The results showed a reduction on a average by 83,9% from control group. The Momordica charantia's extract showed a high anti-inflammatory effect and was capable of reducing the seric cortisol on normal rats. (author)

  5. Phototherapy with low intensity laser in carrageenan-induced acute inflammatory process in mice paw - dosimetry studies; Fototerapia com laser em baixa intensidade em processo inflamatorio agudo induzido por carragenina em pata de camundongos - estudos de dosimetria

    Meneguzzo, Daiane Thais

    2010-07-01

    The importance of modulation of inflammation on the treatment of inflammatory diseases and the difficulty in determining the laser irradiation parameters has led us to study the effects of different protocols of phototherapy with low intensity laser (power, energy, time and place of irradiation) in the treatment and prevention of edema in acute inflammatory process using the experimental model of paw edema induced by carrageenan (CGN) in three strains of mice (Balb-c, Swiss and C57BL/6). The first stage of the study evaluated different combinations of energy (1J and 3J) with different powers (30, 60 and 100mW) in Balb-C mice paw irradiated 1 and 2h after injection of CGN. The second stage studied different combinations of location (foot, inguinal lymph nodes and both) and exposure time (2 and 1h before, 1h and immediately before the CGN, 1 and 2h and 3.5 and 4.5h after CGN) using fixed irradiation parameters (1J, 100mW, 35J/cm{sup 2}, spot area of 0.028 cm{sup 2}). The third stage compared different strains of mice Balb-c and C57BL/6) in the best local and time parameters found in step 2. At all stages, we evaluated the change in paw volume by plethysmography and inflammatory infiltrate by histomorphometry or analysis of myeloperoxidase (MPO). The results showed that laser phototherapy treated and prevented edema and modulated the inflammatory process with paw and inguinal lymph nodes irradiations accordingly with the parameters and mice strain used. (author)

  6. LEVEL OF CHOLESTEROL AND FATTY ACIDS IN THE EGGS OF DIFFERENT SPECIES OF POULTRY. TEORES DE COLESTEROL E ÁCIDOS GRAXOS EM OVOS DE DIFERENTES ESPÉCIES DE AVES

    T. T. OLIVEIRA

    2008-08-01

    Full Text Available This work had as objective to evaluate the cholesterol level fatty acids of triacylglicerol and phosphofolipids of eggs of the different poultry species. The following results were observed: cholesterol: goose duck> turkey > chicken > quail. Fatty acids of triacylglicerols: palmitic acid: turkey > quail goose > duck chicken. Estearic acid: quail chicken> goose duck perua. Oleic acid : goose > chicken> quail duck turkey. α-Linoleic acid: chicken> turkey quail > goose duck. Arachidonic acid: turkey > quail duck> chicken> goose. Docosahexanoic acid: turkey> duck goose chicken > quail. Phospholipids of fatty acids: palmí]itic acid: duck> goose quail > chicken turkey. Estearic acid: chicken turkey > quail> goose > duck. Oleic acid: duck goose > quail > turkey> chicken. α-Linoleic acid: turkey > chicken quail > duck goose. Arachidonic acid: duck > goose > quail chicken > turkey. Docosahexanoic acid: chicken> goose > turkey> quail duck. These results can be of importance for food tables and dietetic treatment of patients.

    Este trabalho teve como objetivo avaliar o teor de colesterol, ácidos graxos de triacilgliceróis e de fosfolipídeos de ovos de diferentes espécies de aves. Foram observados os seguintes resultados: As concentrações de colesterol foram maiores na: pata ≅ gansa > perua > galinha > codorna. As concentrações de ácidos graxos de triacilgliceróis: ácido palmítico: perua> gansa codorna > galinha >pata. Ácido esteárico: codorna galinha > gansa pata perua. Ácido oléico: gansa > galinha >codorna pata perua. Ácido -linoléico: galinha >codorna > perua > gansa pata. Ácido araquidônico: perua > codorna pata > galinha> gansa. Ácido docosaexanóico: perua > pata gansa galinha > codorna. Ácidos graxos de fosfolipídeos: ácido palmítico: pata > gansa codorna > galinha perua. Ácido esteárico: galinha

  7. Removal of suspended solids from the effluents of a shrimp farm by the Blood Ark Anadara tuberculosa (Sowerby, 1833) Remoción de sólidos suspendidos en los efluentes de una granja camaronera por la almeja pata de mula Anadara tuberculosa (Sowerby, 1833)

    Anselmo Miranda; Domeno Voltolina; Gildardo Izaguirre Fierro; Isidro Osuna López; Idalia Sandoval

    2009-01-01

    The potential of Anadara tuberculosa for bioremediation of shrimp farm effluents was evaluated in five field experiments performed in a semi-intensive shrimp farm in Sonora (NW Mexico), and yielded mean filtration, clearance and biodeposition rates of 33.10 mg/h/g, 0.41 L/h/g and 31.19 mg/h/g, respectively. This study demonstrates that A. tuberculosa adults can remove the particulate matter of a semi-intensive shrimp farms effluents.Se realizaron cinco experimentos en una granja de cultivo se...

  8. On the training of Brazilian homeopaths. Sobre la capacitación de los homeópatas brasileños. Sobre a formação dos homeopatas brasileiros.

    Renato Sampaio Azambuja

    2007-01-01

    Full Text Available Although the credibility of homeopathy is raising among the Brazilian general population and government and academic institutions, the training of homeopaths disagrees with the exigences presented by clinical practice. This article discusses a proposal to reformulate the pedagogical practice, centered on the student as the builder of knowledge. The training basic block would be the small group, composed by students and a tutor; all activities would be performed in the concrete practice situation. The full process would unfold in three stages: 1 deconstruction of previous knowledge and establishment of new notions; 2 deepening into the homeopathic specific features; 3 discussion of homeopathy philosophical and epistemological issues, as well as its conection to related areas.

  9. New species of Haematoloechus (Digenea: Plagiorchidae in the lung of the foothill yellow-legged frog Rana boylii (Anura, from Humboldt County, California, USA Especie nueva de Haematoloechus (Digenea: Plagiorchidae del pulmón de la rana de patas amarillas Rana boylii (Anura, de Humboldt County, California, Estados Unidos de América

    David Zamparo

    2011-06-01

    Full Text Available A new species of Haematoloechus is described from the lungs of Rana boylii from Humboldt County, California. The new species is similar to Haematoloechus buttensis, Haematoloechus kernensis, and Haematoloechus complexus in general course of the uterus and gonad shape. It is similar to H. buttensis by having a cirrus sac terminating midway between the posterior margin of the pharynx and the anterior margin of the ovary, and having a smaller oral/ventral sucker ratio; to H. complexus by having the genital pore ventral to the pharynx, and it is similar to H. kernensis by having a larger oral sucker to pharynx width ratio. The new species is unique by lacking an extra-cecal longitudinal uterine loop from the hind-body. Molecularly, the new species differs 1.04-1.15% in partial 28S sequence with respect to H. complexus, and a monophyletic grouping of these specimens in a phylogenetic analysis of all available sequence data consistent with the species-specific status proposed herein. Evidence is also presented to suggest that specimens identified as H. buttensis in Rana pretiosa from British Columbia, Canada represents a new, but still undescribed species. The importance of conducting biological inventories of helminths, along with continued monitoring of populations, and collections based taxonomy are related.Una especie nueva de Haematoloechus es descrita de los pulmones de Rana boylii de Humboldt County, California. La especie nueva guarda semejanza con Haematoloechus buttensis, Haematoloechus kernensis, y Haematoloechus complexus en la disposición general del útero y en la forma de las gónadas. Es similar a H. buttensis en que la bolsa del cirro finaliza entre el margen posterior de la faringe y el margen anterior del ovario, y en presentar una relación menor entre la ventosa oral y el acetábulo; a H. complexus por tener el poro genital ventral a la faringe, y a H. kernensis por tener una relación mayor del ancho de la ventosa oral contra la faringe. La especie nueva es única por carecer de asas uterinas extracecales longitudinales. Molecularmente, la especie nueva muestra 1.04-1.15% de diferencia en secuencias parciales de 28S con respecto H. complexus; esta información complementa las diferencias morfológicas. También se presenta evidencia para sugerir que ejemplares identificados como H. buttensis de Rana pretiosa en British Columbia, Canadá probablemente representan una especie nueva aún no descrita. Se aborda la importancia de la realización de inventarios biológicos de helmintos, el monitoreo continuo de las poblaciones y las colecciones basadas en la taxonomía.

  10. Inhibition of carrageenan-induced expression of tissue and plasma prekallikreins mRNA by low level laser therapy in a rat paw edema model Inibição da expressão de RNA mensageiro de pré-calicreínas tecidual e plasmática pela laserterapia em modelo de edema de pata induzido pela carragenina em ratos

    Moisés P. Silva; Flávia Bortone; Marcelo P. Silva; Thiago R. Araújo; Maricília S. Costa; José A. Silva Júnior

    2011-01-01

    BACKGROND: Low level laser therapy (LLLT) has been used clinically in order to treat inflammation, where tissue and plasma prekallikrein have crucial importance. Plasma prekallikrein (PPK) is synthesized by the hepatocytes and secreted into the bloodstream, where it participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. Tissue prekallikrein is associated with important disease states (including cancer, inflammation, and neurodeg...

  11. Inhibition of carrageenan-induced expression of tissue and plasma prekallikreins mRNA by low level laser therapy in a rat paw edema model Inibição da expressão de RNA mensageiro de pré-calicreínas tecidual e plasmática pela laserterapia em modelo de edema de pata induzido pela carragenina em ratos

    Moisés P. Silva

    2011-02-01

    Full Text Available BACKGROND: Low level laser therapy (LLLT has been used clinically in order to treat inflammation, where tissue and plasma prekallikrein have crucial importance. Plasma prekallikrein (PPK is synthesized by the hepatocytes and secreted into the bloodstream, where it participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. Tissue prekallikrein is associated with important disease states (including cancer, inflammation, and neurodegeneration and has been utilized or proposed as clinically important biomarker or therapeutic target of interest. OBJECTIVE: To evaluate if LLLT modulates tissue and plasma prekallikreins mRNA expression in the carrageenan-induced rat paw edema. METHODS: Experimental groups were assigned as followed: A1 (Control-saline, A2 (Carrageenan-only, A3 (laser 660nm only and A4 (Carrageenan + laser 660nm. Edema was measured by a plethysmometer. Subplantar tissue was collected for the quantification of prekallikreins mRNA by Real time-Polymerase Chain Reaction. RESULTS: A significantly decrease in the edema was observed after laser irradiation. Expression of prekallikreins increased after carrageenan injection. Tissue and plasma prekallikrein mRNA expression significantly decreased after LLLT's 660nm wavelength. CONCLUSION: These results suggest that expression of tissue and plasma prekallikreins is modulated by LLLT, which can be used in clinical practice due to its anti-inflammatory effects.CONTEXTUALIZAÇÃO: A laserterapia de baixa potência tem sido usada para o tratamento de processos inflamatórios diversos em que a calicreína tecidual e a plasmática possuem participação ativa. A pré-calicreína plasmática (PPK é sintetizada pelos hepatócitos e secretada na corrente sanguínea, onde participa da ativação da coagulação, fibrinólise, geração de cininas e inflamação. A pré-calicreína tecidual está associada com importantes doenças (incluindo câncer, inflamação e neurodegeneração e tem sido utilizada ou sugerida clinicamente como importante biomarcador ou alvo terapêutico. OBJETIVO: Avaliar se a laserterapia altera a expressão gênica da pré-calicreína tecidual e da plasmática no modelo de inflamação aguda induzida pela carragenina. MÉTODOS: Quarenta ratos foram separados em quatro grupos experimentais: A1 (controle, A2 (carragenina, apenas, A3 (laser 660nm, apenas e A4 (Carragenina + laser 660nm. O edema foi medido por um pletismômetro. Tecido subplantar foi coletado para a quantificação de RNA mensageiro (RNAm de pré-calicreínas tecidual e plasmática por PCR em tempo real. RESULTADOS: Observou-se uma diminuição significativa no volume de edema após irradiação com laser 660nm. A expressão de RNAm de pré-calicreínas tecidual e plasmática aumentou após a inoculação de carragenina, entretanto a expressão gênica das pré-calicreínas diminuiu significantemente após laserterapia de baixa potência de 660nm. CONCLUSÃO: Os resultados sugerem que a expressão de RNAm das pré-calicreínas tecidual e plasmática é modulada pela laserterapia de baixa potência, podendo ser alvo terapêutico para tratamento de processos inflamatórios.

  12. Removal of suspended solids from the effluents of a shrimp farm by the Blood Ark Anadara tuberculosa (Sowerby, 1833 Remoción de sólidos suspendidos en los efluentes de una granja camaronera por la almeja pata de mula Anadara tuberculosa (Sowerby, 1833

    Anselmo Miranda

    2009-08-01

    Full Text Available The potential of Anadara tuberculosa for bioremediation of shrimp farm effluents was evaluated in five field experiments performed in a semi-intensive shrimp farm in Sonora (NW Mexico, and yielded mean filtration, clearance and biodeposition rates of 33.10 mg/h/g, 0.41 L/h/g and 31.19 mg/h/g, respectively. This study demonstrates that A. tuberculosa adults can remove the particulate matter of a semi-intensive shrimp farms effluents.Se realizaron cinco experimentos en una granja de cultivo semi-intensivo de camarón ubicada en Sonora (Noroeste de México con el fin de verificar in situ el potencial de Anadara tuberculosa para la biorremediación de los efluentes de granjas camaroneras. Se obtuvieron tasas medias de filtración y de clarificación de 33.10 mg/h/g y 0.41 L/h/g y la de biodepositación fue 31.19 mg/h/g. Este estudio demuestra que individuos adultos de A. tuberculosa pueden remover la materia particulada de los efluentes de las granjas camaroneras semi-intensivas.

  13. Training of homeopathic physicians: current changes. Capacitación del médico homeópata: implementando cambios. A formação do médico homeopata: implementando mudanças.

    Sandra Abrahão Chaim Salles

    2003-01-01

    Full Text Available Em nosso país, sendo a homeopatia reconhecida especialidade médica pelo Conselho Federal de Medicina desde 1980, a clínica homeopática em humanos deve ser praticada por médicos com especialização em homeopatia. A Associação Médica Homeopática Brasileira (AMHB, em convênio com a Associação Médica Brasileira (AMB, confere o título de especialista em homeopatia àqueles que, após cursarem a especialização, prestarem a prova para sua obtenção. Na verdade, outros profissionais, como dentistas, médicos veterinários e farmacêuticos, também podem se tornar homeopatas, contando também com a regulamentação de suas atividades pelas associações de cada categoria.

  14. Training of homeopathic physicians: current changes. Capacitación del médico homeópata: implementando cambios. A formação do médico homeopata: implementando mudanças.

    Sandra Abrahão Chaim Salles

    2003-01-01

    Em nosso país, sendo a homeopatia reconhecida especialidade médica pelo Conselho Federal de Medicina desde 1980, a clínica homeopática em humanos deve ser praticada por médicos com especialização em homeopatia. A Associação Médica Homeopática Brasileira (AMHB), em convênio com a Associação Médica Brasileira (AMB), confere o título de especialista em homeopatia àqueles que, após cursarem a especialização, prestarem a prova para sua obtenção. Na verdade, outros profissionais, como dentistas, mé...

  15. On how a dentist can also be a homeopath. Sobre cómo un cirujano dentista tambiém puede ser homeópata. Das formas do cirurgião-dentista ser também homeopata.

    Ruth Barbosa

    2003-01-01

    No Brasil, a possibilidade de atuação conjunta entre Homeopatia e Odontologia iniciou-se no final do século passado, comprovando que trocar informações e conhecimento é prática indispensável entre profissionais responsáveis e visionários. A Homeopatia oferece ao cirurgião-dentista uma filosofia que expande e aprofunda a observação de seu paciente. Ao mesmo tempo, a Odontologia assessora a remoção de obstáculos mecânicos à cura, deixando ao observador homeopata apenas o que é característico e ...

  16. On how a dentist can also be a homeopath. Sobre cómo un cirujano dentista tambiém puede ser homeópata. Das formas do cirurgião-dentista ser também homeopata.

    Ruth Barbosa

    2003-01-01

    Full Text Available No Brasil, a possibilidade de atuação conjunta entre Homeopatia e Odontologia iniciou-se no final do século passado, comprovando que trocar informações e conhecimento é prática indispensável entre profissionais responsáveis e visionários. A Homeopatia oferece ao cirurgião-dentista uma filosofia que expande e aprofunda a observação de seu paciente. Ao mesmo tempo, a Odontologia assessora a remoção de obstáculos mecânicos à cura, deixando ao observador homeopata apenas o que é característico e peculiar ao paciente no ambiente estomatoglossognato-cranio-cervical.

  17. Coping religioso-espiritual e consumo de alcoólicos em hepatopatas do sexo masculino Coping religioso-espiritual y consumo alcohólico en hepatópatas de sexo masculino Religious-spiritual coping and the consumption of alcoholic beverages in male patients with liver disease

    Maria Evangelista Martins

    2012-12-01

    Full Text Available Estudo transversal realizado com o objetivo de avaliar uso do Coping Religioso-Espiritual (CRE e verificar suas possíveis modulações com o padrão de consumo de alcoólicos em pacientes atendidos em ambulatório de hepatologia entre abril e dezembro de 2009, utilizando o CAGE, o AUDIT e a escala CRE. Foram encontradas associações entre coping religioso-espiritual negativo (CREN e consumo de alcoólicos na vida no último ano e com a combinação resultante. Sujeitos identificados como CAGE negativos com uso de baixo risco no último ano tiveram frequência acima da esperada na categoria abaixo da mediana. Os identificados como CAGE positivo com uso de médio risco foram relativamente mais frequentes na categoria acima da mediana (p=0,017. Resultados reforçam a relevância do CREN na avaliação de eventos relacionados com a saúde.Estudio transversal realizado con el objetivo de evaluar el uso del Coping Religioso Espiritual (CRE y verificar sus posibles modulaciones con el estándar de consumo de alcohol en pacientes atendidos en ambulatorio de hepatología entre abril y diciembre de 2009, utilizando el CAGE, el AUDIT y la escala CRE. Se encontraron asociaciones entre coping religioso espiritual negativo (CREN y consumo de bebidas alcohólicas en la vida, en el último año y con la combinación resultante. Sujetos identificados como CAGE negativos con abuso de bajo riesgo en el último año tuvieron frecuencia por sobre la esperada en la categoría por debajo de la mediana. Los identificados como CAGE positivo con abuso de mediano riesgo fueron relativamente más frecuentes en la categoría por encima de la mediana (p=0,017. Los resultados refuerzan la importancia del CREN en la evaluación de eventos relacionados a la salud.This cross-sectional study was performed with the objective to evaluate the use of Religious Spiritual Coping (RSC and verify its relationship with the pattern of alcoholic beverage consumption in patients attending a liver disease outpatient clinic between April and December of 2009, using the CAGE, AUDIT and RSC Scale. Associations were observed between negative religious-spiritual coping (NRSC and the consumption of alcoholic beverages over the last year and with the resulting combination. Subjects identified as negative CAGE with low-risk consumption over the last year had a frequency above the expected in the category below the median. Those identified as positive CAGE with moderate-risk consumption were relatively more frequent in the category above the median (p=0.017. Results reinforce the relevance of the NRSC in the evaluation of health-related events.

  18. Protein (Cyanobacteria): 227779 [PGDBj - Ortholog DB

    Full Text Available ZP_18822821.1 1117:4316 1118:2919 1125:192 1126:696 1160286:25 Putative peptidase PatA homolog (fragm...LSSFLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKVFRFTIDVSDLIPVTLGEVRSWSSPN ...

  19. Protein (Cyanobacteria): 227776 [PGDBj - Ortholog DB

    Full Text Available ZP_18845350.1 1117:4316 1118:2919 1125:192 1126:696 1160285:784 Putative peptidase PatA homolog (fragm...FLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKVFRFTIDVSDLIPVTLGEVRSWSSPY ...

  20. Protein (Cyanobacteria): 227763 [PGDBj - Ortholog DB

    Full Text Available ZP_10229400.1 1117:4316 1118:2919 1125:192 1160279:2410 Putative peptidase PatA homolog (fragm...ent) Microcystis sp. T1-4 MRRTLSSFLNRIYYDLRNLGQTSQDRALNFAATNAFQAAQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKIFRFTIDVSDLIPVTLGEVRSWSSPY ...

  1. Advanced photoacoustic and thermoacoustic sensing and imaging beyond pulsed absorption contrast

    Gao, Fei; Feng, Xiaohua; Zheng, Yuanjin

    2016-07-01

    In this paper, we review the recent progress in the photoacoustic (PA) and thermoacoustic (TA) imaging domain. Going beyond the conventional investigation of optical/microwave absorption contrast, this review will focus more on the new developments of PA and TA imaging towards multi-contrast mechanisms, such as multimodal PA/TA imaging, viscosity imaging, temperature monitoring, Doppler detection of flow speed, etc. In addition, several interesting techniques utilizing PA/TA will be reviewed, including photoacoustic-guided optical focusing, electrical circuit modeling of PA/TA effect, TA imaging with coherent continuous-wave (CW) magnetic and radio-frequency (RF) excitations, as well as its nonlinear effect. Finally, some prospects about the further improvement of PA/TA imaging techniques are suggested, followed by the conclusion.

  2. Methow River Steelhead - Methow River Steelhead hatchery reform research

    National Oceanic and Atmospheric Administration, Department of Commerce — Steelhead in Pacific Northwest hatcheries are typically reared for release as 1-year-old smolts, rather than the 2and 3-year-old smolt life history patterns found...

  3. Estudio de las funciones verbales y aptitudes lingüísticas en la psicopatía

    Almeida Brites, José Manuel de

    2012-01-01

    [ES] Cleckley (1976) señaló la presencia de un lenguaje hueco en el psicópata como forma de manipular. Aunque puede repetir las palabras y decir que las comprende, aparentemente no existe ninguna forma de que pueda darse cuenta de que, en realidad, no las comprende. Su empleo del lenguaje indica dificultades para exponer los argumentos sin desvíos o incoherencias sustanciales. El objetivo de este trabajo consiste en evaluar las funciones verbales y aptitudes lingüísticas en varones psicópatas...

  4. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte II) Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part II)

    J.M. Pozueco Romero; S.L. Romero Guillena; N. Casas Barquero

    2011-01-01

    La Jurisprudencia española se encuentra frecuentemente ante dictámenes periciales en los que aparecen términos como psicópata, trastorno antisocial de la personalidad, personalidad psicopática, psicópata desalmado, psicopatía epileptoide, sociopatía, etc. De esta forma, no es infrecuente que los juristas (magistrados, jueces, fiscales, abogados) se hallen desorientados ante tanta terminología que, pese a todo, en absoluto se constituyen en sinónimos. La Doctrina, por su parte, disiente de la ...

  5. Delincuente sexual en serie y alteraciones psicopáticas: una relación ocasional Repeat sex offender and psychopathic changes: An incidental relationship

    M. Ventura Alvarez; J.A. Presentación Blasco

    2003-01-01

    Los delincuentes sexuales en serie son tomados frecuentemente como psicópatas, en parte como consecuencia de la creciente popularidad del término. Un delincuente sexual en serie es aquel que ha actuado sobre dos o más víctimas en diferentes fechas; un psicópata es un tipo de trastorno de la personalidad que exhibe un patrón duradero de conductas socialmente irresponsables que desprecian los derechos de los demás. El presente trabajo presenta un caso de violador en serie interrumpido precozmen...

  6. CMS Young Researchers Award 2013 and Fundamental Physics Scholars Award from the CMS Experiment

    Lapka, Marzena

    2014-01-01

    Photo 2: CMS Fundamental Physics Scholars (FPSs) 1st prize: Joosep Pata, from Estonian National Institue of Chemical Physics and Biophysics / Photo 1 and 3: CMS Young Researchers Award. From left to right: Guido Tonelli, Colin Bernet, Andre David, Oliver Gutsche, Dmytro Kovalskyi, Andrea Petrucci, Joe Incandela and Jim Virdee

  7. Susceptibility of laboratory primates to infection with Mansonella ozzardi from man.

    Orihel, T C; Lowrie, R C; Eberhard, M L; Raccurt, C; Kozek, W J; Tidwell, M A; Tidwell, M

    1981-07-01

    The study was undertaken to determine primates were susceptible to infection with Caribbean and/or Amazon strains of Mansonella ozzardi of man. Twenty-three animals including three chimpanzees, four squirrel monkeys, one capuchin, five rhesus and 10 patas monkeys each received, by subcutaneous or intraperitoneal injection, 25-170 infective larvae of M. ozzardi harvested either from infected Culicoides furens collected in Haiti or Simulium sp. (sanguineum complex) collected in the Colombian Amazon and transported to our laboratories in Louisiana. Patent infections were obtained in seven of 10 patas monkeys but not in any other species of primates. The prepatent period ranged in duration from 149-186 days with a mean of 168 days. All of the patas monkeys developed modest microfilaremias that persisted for as long as 1 year, the duration of our observations. Adult worms were obtained at necropsy from three of four patas monkeys. The worms were recovered from soakings of the carcass and skin rather than from the abdominal cavity and mesenteries. However, their precise habitat was not determined. PMID:7020456

  8. Lévy laws in free probability

    Barndorff-Nielsen, Ole E.; Thorbjørnsen, Steen

    2002-01-01

    This article and its sequel outline recent developments in the theory of infinite divisibility and Lévy processes in free probability, a subject area belonging to noncommutative (or quantum) probability. The present paper discusses the classes of infinitely divisible probability measures in classical and free probability, respectively, via a study of the Bercovici–Pata bijection between these classes.

  9. Singid letti! / Mari Kodres

    Kodres, Mari

    2012-01-01

    Hispaania armastatuimast ja hinnatuimast toiduainest jamón ibérico'st ehk Ibeeria singist, mida tuntakse ka nime all pata negra (eesti k 'must sõrg'). Tammetõrudega toidetud Ibeeria sea lihast valmistatud parimad singid valmivad Loode-Andaluusias Sierra de Aracenas

  10. Relation between phylogeny of African green monkey CD4 genes and their respective simian immunodeficiency virus genes

    Fomsgaard, Anders; Müller-Trutwin, Michaela C.; Diop, Ousmane; Hansen, Jan; Mathiot, Christian; Corbet, Sylvie; Barré-Sinoussi, Francoise; Allan, Jonathan S.

    1997-01-01

    mangabeys, rhesus and pig-tail macaques, chimpanzees, and humans. Chimpanzees and humans consistently clustered together. Monkeys within the Cercopithecus genus formed a separate cluster which included pata monkeys, supporting its grouping as a member of Cercopithecus. Surprisingly, sooty mangabeys were...

  11. Late Quaternary Activity of the Sudetic Marginal Fault in the Czech Republic: A signal of Ice Loading?

    Štěpančíková, Petra; Rockwell, T.; Hartvich, Filip; Tábořík, Petr; Stemberk, Jakub; Ortuno, M.; Wechsler, N.

    Aachen : Grützner & Reicherter Geosolutions UG, 2013 - (Grützner, C.; Rudersdorf, A.; Pérez-López, R.; Reicherter, K.), s. 259-262 ISBN 978-3-00-042796-1. [International INQUA Meeting on Paleoseismology, Active Tectonics and Archeoseismology - PATA /4./. Aachen (DE), 09.10.2013-15.10.2013] R&D Projects: GA ČR GAP210/12/0573; GA MŠk LH12078 Institutional support: RVO:67985891 Keywords : paleoseismology * active tectonics * trenching * Sudetic Marginal Fault Subject RIV: DB - Geology ; Mineralogy https://www. dropbox .com/s/wv4q79mu4sjitfh/PATA%20Days%202013%20conference%20volume.pdf

  12. SALINE WATER RESOURCES IN CLUJ-NAPOCA SURROUNDINGS

    B. CZELLECZ

    2016-03-01

    Full Text Available Saline waters are usually researched in those places where it is used for balneotherapy or other industrial purposes. The aim of this study is to describe the saline water sources from less known areas, as they are an important natural mineral water resource. Twenty nine water samples were analyzed from Cojocna-Pata-Sopor region, thirteen of them can be considered saline waters. The visited locations are 21, 15 and 3 km far from Cluj-Napoca. Highly concentrated springs are to be found in the old mine area from Pata village and in the slough from Cojocna. Beside the well known saline lakes from Cojocna, five other saline lakes were identified; most of them are having artificial origin.

  13. Experimental and theoretical studies on electrochemical synthesis of poly(3-amino-1,2,4-triazole)

    Highlights: ► The poly(3-amino-1,2,4-triazole) was electrochemically synthesized. ► The homogeneous, colorful polymer has higher thermal and electrochemical stability. ► The correlation was observed between experimental and theoretical data. - Abstract: The electrochemical synthesis of poly(3-amino-1,2,4-triazole) (PATA) on the platinum (Pt) electrode was achieved in ammonium oxalate solution by cyclic voltammetry technique. The conductivity of film was measured with four probe technique, the surface morphology was monitored with atomic force microscopy (AFM) and characterization was achieved by Fourier transform infrared spectroscopy (FT-IR) and UV–vis spectroscopy techniques. The thermal stability of polymer has also been investigated by the means of thermogravimetric analysis (TGA). The electrochemical stability of Pt/PATA was investigated in different buffer solutions. The quantum theoretical calculations employed and some parameters (dipole moment, EHOMO, ELUMO) were determined.

  14. Fluorescence of experimental atheromatous plaques with hematoporphyrin derivative.

    Spears, J R; Serur, J; Shropshire, D; Paulin, S

    1983-01-01

    Fluorescence of hematoporphyrin derivative (HPD) has been used clinically to localize malignant neoplasms because of its selective accumulation in these tissues. We tested the hypothesis that HPD may also be selectively concentrated within atheromatous plaques. 48 h after HPD injection in a variety of species, selective fluorescence of atheromatous plaques of the aorta was seen in each animal (rabbits and Patas monkey) exhibiting such lesions. No fluorescence could be demonstrated in aortic s...

  15. The Kathmandu valley : A study in regional geography

    Haffner, Willibald

    1981-01-01

    Anyone studying the map of the Kathmandu valley is struck by the almost plastic contrast between the valley bottom and its mountainous, wooded frame dissected by U-shaped valleys. A naturally favourable situation, together with a position that controls the pass of one of the most important trade and pilgrimage routes in the central Himalayas provided decisive impulses for the development of the three largest towns of Nepal: Kathmandu, Pata and Bhaktapur. More than half of the 600.000 inhabita...

  16. Mycorrhizal bioestimulation with essential oil on Enterolobium contorsiliquum and Bauhinia forficata seedlings in soil contaminated with copper

    Rodrigo Ferreira da Silva; Clovis Da Ros; Alex Dellai; Douglas Leandro Scheid; André Luis Grolli; Hazael Soranzo de Almeida

    2015-01-01

    The use of native tree species inoculated with ectomycorrhizal fungus can be an alternative for revegetation of soil contaminated with copper. The objective was to evaluate the interference of eucalyptus essential oil copper and ectomycorrhiza on growth and quality of seedlings timbaúva-preta (Enterolobium contorsiliquum) and pata-de-vaca (Bauhinia forficata). The study was conducted in greenhouse for 120 days using as substrate the layer of 0-20 cm of a Red Oxisol with very clayey texture. T...

  17. GenBank blastx search result: AK243453 [KOME

    Full Text Available (patA), PatB (patB), PatC (patC), adenylation/heterocyclization protein (patD), patellamide precursor protei...n (patE), PatF (patF), thiazoline oxidase/subtilisin-like protease (patG), and deoxyribopyrimidine photolyase genes, complete cds. BCT 2e-17 1 ... ...AK243453 J100070G09 AY986476.1 AY986476 Prochloron didemni subtilisin-like protein

  18. Clinically relevant fluoroquinolone resistance due to constitutive overexpression of the PatAB ABC transporter in Streptococcus pneumoniae is conferred by disruption of a transcriptional attenuator

    Baylay, Alison J.; Piddock, Laura J. V.

    2014-01-01

    Objectives Constitutive overexpression of patAB has been observed in several unrelated fluoroquinolone-resistant laboratory mutants and clinical isolates; therefore, we sought to identify the cause of this overexpression. Methods Constitutive patAB overexpression in two clinical isolates and a laboratory-selected mutant was investigated using a whole-genome transformation approach. To determine the effect of the detected terminator mutations, the WT and mutated patA leader sequences were clon...

  19. Mycorrhizal bioestimulation with essential oil on Enterolobium contorsiliquum and Bauhinia forficata seedlings in soil contaminated with copper

    Rodrigo Ferreira da Silva

    2015-06-01

    Full Text Available The use of native tree species inoculated with ectomycorrhizal fungus can be an alternative for revegetation of soil contaminated with copper. The objective was to evaluate the interference of eucalyptus essential oil copper and ectomycorrhiza on growth and quality of seedlings timbaúva-preta (Enterolobium contorsiliquum and pata-de-vaca (Bauhinia forficata. The study was conducted in greenhouse for 120 days using as substrate the layer of 0-20 cm of a Red Oxisol with very clayey texture. The experimental design was completely randomized factorial (2 x 2 x 2, and “ with and without “ inoculant ectomycorrhizal essential oil and addition of 150 mg kg-1 of copper in the soil . Was evaluated the plant height, stem diameter, dry mass of shoots, roots and total length and specific surface area and root seedling quality of relations between: shoot height and stem diameter, shoot height and dry mass of shoots and the quality index of Dickson. The formation of ectomycorrhiza was identified by visualization of fungal structures and surface morphology internal and external morphology of the root system. Addition of copper reduced de stems diameter and dry mass of de aerial part of the pata-de-vaca seedlings regardless of the addition of inoculant and oil. There was no formation of ectomycorrhiza, even when applied in the essential oil of seedlings timbaúva-preta and pata-de-vaca. Growth of timbaúva-preta seedlings is stimulated by the addition of 150 mg kg – 1 of copper and has a higher rate of seedling quality in relation to pata-de-vaca.

  20. Herodot zur skythischen Sprache

    Hinge, George

    2005-01-01

    Herodots skythiske etymologier for fokenavnene Arimaspoi og Oiorpata må opgives ("enøjet" = arima "en" + spu "øje" og "manddræbende" = oior "mand" + pata "dræbe"). Artiklens forfatter foreslår i stedet nye skythiske forklaringer (*arjataspāh "hesterig" og *aiwawarakāta "enbrystet"). Herodots falske...

  1. Adsorption kinetic, equilibrium and thermodynamic investigations of Zn(II and Ni(II ions removal by poly(azomethinethioamide resin with pendent chlorobenzylidine ring

    Kumar P. Senthil

    2015-09-01

    Full Text Available This paper reports the application of poly(azomethinethioamide (PATA resin having the pendent chlorobenzylidine ring for the removal of heavy metal ions such as Zn(II and Ni(II ions from the aqueous solutions by adsorption technology. Kinetic, equilibrium and thermodynamic models for Zn(II and Ni(II ions adsorption were applied by considering the effect of contact time, initial metal ion concentration and temperature data, respectively. The adsorption influencing parameters for the maximum removal of metal ions were optimized. Adsorption kinetic results followed the pseudo-second order kinetic model based on the correlation coefficient (R2 values and closed approach of experimental and calculated equilibrium adsorption capacity values. The removal mechanism of metal ions by PATA was explained with the Boyd kinetic model, Weber and Morris intraparticle diffusion model and Shrinking Core Model (SCM. Adsorption equilibrium results followed the Freundlich model based on the R2 values and error functions. The maximum monolayer adsorption capacity of PATA for Zn(II and Ni(II ions removal were found to be 105.4 mg/g and 97.3 mg/g, respectively. Thermodynamic study showed the adsorption process was feasible, spontaneous, and exothermic in nature.

  2. Simulación de un Robot Hexápodo Bioinspirado en el Tenebrio

    Juan Pablo Rodríguez-Calderón

    2015-06-01

    Full Text Available Los insectos son base fundamental en el estudio de la robótica reactiva ya que estos poseen características biológicas y motrices que son de interés para ser implementadas en robots bioinspirados, teniendo en cuenta el desempeño de éstos en diferentes áreas. Por otra parte los animales hexápodos poseen omnidireccionalidad y estabilidad, debido a la formación del trípode de apoyo, el cual se crea en sus patas al dar un paso, lo cual les permite sobrepasar diferentes obstáculos con facilidad y velocidad constante. En este proyecto se implementa el sistema locomotor del insecto Tenebrio debido a la facilidad con que se pueden apreciar sus movimientos. Se analiza el desplazamiento de las patas del insecto en diferentes trayectorias, vistas y terreno plano, posteriormente se encontraron los parámetros, ecuaciones y restricciones que limitan los diferentes eslabones de cada una de las patas del Tenebrio, esto se realizó por medio de un análisis de imágenes. Finalmente la información recogida se implementa en la plataforma MATLAB para determinar las características de movimiento, estabilidad y desplazamiento.

  3. ‘BURLEY PINAR 2010’: PRIMER CULTIVAR CUBANO DE TABACO BURLEY RESISTENTE AL MARCHITAMIENTO POR FUSARIUM (Fusarium oxysporumY A OTRAS ENFERMEDADES DE IMPORTANCIA EN EL CULTIVO

    Vivaldo García

    2015-01-01

    Full Text Available Con el objetivo de obtener un cultivar de tabaco burley resistente al marchitamiento por fusarium, al moho azul (Peronospora hyocyami de Bary y a la pata prieta (Phytophthora parasitica Dast. var. Nicotianae Breda de Haan se hizo un cruzamiento en la Estación Experimental del Tabaco de San Juan y Martínez, Pinar del Río, durante la campaña tabacalera 2004-2005 entre los cultivares `NC 1151 ́ y `Ky 910 ́. La primera resistente al moho azul y al marchitamiento por fusarium, la segunda resistente a la pata prieta. Después de cinco generaciones de autofecundación y selección por el método genealógico se obtuvo la `Burley Pinar 2010 ́ que mostró resistencia al fusarium, al moho azul y a la pata prieta. En suelo infectado por fusarium la `Burley Pinar 2010 ́ superó a `Burley Habana 13 ́ en rendimiento

  4. Cow's milk and children

    Milk and children; Cow’s milk allergy - children; Lactose intolerance - children ... You may have heard that cow's milk should not be given to babies younger than 1 year old. This is because cow's milk doesn't provide enough of certain ...

  5. Isolation of new species “Peptoniphilus phoceensis” from human gut

    Mourembou, G.; Traore, S.I.; J. Rathored; Khelaifia, S.; Lagier, J.C.; Michelle, C.; Raoult, D.; Million, M.

    2016-01-01

    Taxonogenomics coupled with culturomics leads to descriptions of new bacteria. Thanks to this strategy, we report the main characteristics of “Peptoniphilus phoceensis” strain SIT15, a new bacterium isolated from a stool sample of a 1-year-old healthy Senegalese boy.

  6. Orbital lymphomatoid granulomatosis - a rare cause of proptosis

    Du Toit, Jacqueline; Kilborn, Tracy [Department of Radiology, Red Cross Children' s Hospital, Rondebosch (South Africa); Eyssen, Ann van [Department of Oncology, Red Cross Children' s Hospital, Rondebosch (South Africa); Pillay, Komala [Department of Pathology, Red Cross Children' s Hospital, Rondebosch (South Africa)

    2015-07-15

    A 1-year-old girl with unilateral proptosis was found to have primary orbital lymphomatoid granulomatosis - a condition rarely occurring in children. This multisystem angiocentric, angiodestructive, lymphoproliferative disease typically involves the lungs, with ocular involvement being extremely uncommon. Our case serves to illustrate the imaging findings of this unusual condition and highlight a rare cause of proptosis. (orig.)

  7. One-Year-Olds Think Creatively, Just Like Their Parents

    Hoicka, Elena; Mowat, Rachael; Kirkwood, Joanne; Kerr, Tiffany; Carberry, Megan; Bijvoet-van den Berg, Simone

    2016-01-01

    Creativity is an essential human ability, allowing adaptation and survival. Twenty-nine 1-year-olds and their parents were tested on divergent thinking (DT), a measure of creative potential counting how many ideas one can generate. Toddlers' and parents' DT was moderately to highly correlated. Toddlers showed a wide range of DT scores, which were…

  8. CARDIAC AND BEHAVIORAL-RESPONSES OF LONG-TERM OBESE AND LEAN ZUCKER RATS TO EMOTIONAL-STRESS

    NYAKAS, C; BALKAN, B; STEFFENS, AB; BOHUS, B

    1995-01-01

    Obesity is known as a risk factor in stress-related cardiovascular pathology in man. The length of obesity can be an important interacting variable. Therefore, cardiac and behavioral responses to emotional stress were studied in 1-year-old, genetically obese (fa/fa) and lean (Fa/-) male Zucker rats,

  9. Prevalence of Corneal Astigmatism in Tohono O'odham Native American Children 6 Months to 8 Years of Age

    Harvey, Erin M.; Dobson, Velma; Miller, Joseph M.; Schwiegerling, Jim; Clifford-Donaldson, Candice E.; Green, Tina K.; Messer, Dawn H.

    2011-01-01

    The prevalence of corneal astigmatism in infants and young children who are members of a Native American tribe indicates that the mean amount of corneal astigmatism is higher than reported for non–Native American populations and increases from 1.43 D in 1-year-olds to nearly 2.00 D by school age.

  10. Autonomy and Children's Reactions to Being Controlled: Evidence that Both Compliance and Defiance May Be Positive Markers in Early Development

    Dix, Theodore; Stewart, Amanda D.; Gershoff, Elizabeth T.; Day, William H.

    2007-01-01

    This study examined reactions of 1-year-olds and young 2-year-olds to being controlled by mothers. Mothers' supportive behavior predicted children's willing compliance. However, contrary to research with older children, defiance was also associated with variables linked to maternal competence, specifically, mothers' supportive behavior,…

  11. The Affective Structure of Supportive Parenting: Depressive Symptoms, Immediate Emotions, and Child-Oriented Motivation

    Dix, Theodore; Gershoff, Elizabeth T.; Meunier, Leah N.; Miller, Pamela C.

    2004-01-01

    This study investigated the maternal concerns and emotions that may regulate one form of sensitive parenting, support for children's immediate desires or intentions. While reviewing a videotape of interactions with their 1-year-olds, mothers who varied on depressive symptoms reported concerns and emotions they had during the interaction. Emotions…

  12. Creating an Amazing Montessori Toddler Home Environment

    Woo, Stephanie

    2014-01-01

    The author states that raising her twins the Montessori way has made her life easy. Imagine two 1-year-olds eating entire meals on their own, setting their own tables by 20 months, and becoming potty-trained before 2. These are not statistics found in just one household. Children raised the Montessori way can take care of themselves and their…

  13. Psychosocial Aspects of Cleft Lip and Palate: Implications for Parental Education. Research Report 138.

    Kalland, Mirjam

    This study focused on the psychosocial aspects of cleft lip and/or palate on maternal emotional reactions and the family, with emphasis on the effect on the maternal-infant bond. Interviews were conducted with 40 mothers of 1-year-old infants with non-syndromic cleft lip and/or palate. The interviews were analyzed using the phenomenological…

  14. Multiple liver abscesses in a dog secondary to the liver fluke Metorchis conjunctus treated by percutaneous transhepatic drainage and alcoholization.

    Lemetayer, Julie D; Snead, Elizabeth C; Starrak, Greg S; Wagner, Brent A

    2016-06-01

    A 1-year-old German shepherd × husky cross dog was diagnosed with multiple liver abscesses and severe cholangitis secondary to the liver fluke Metorchis conjunctus. The dog was successfully treated with 2 percutaneous transhepatic drainage and alcoholization procedures, and a prolonged course of antibiotics and praziquantel. PMID:27247459

  15. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    Balsby, T.J.S.; Hansen, P.

    2010-01-01

    Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in fiv...

  16. Doing Friendship during the Second Year of Life in a Swedish Preschool

    Engdahl, Ingrid

    2012-01-01

    A number of studies within early childhood education and care indicate the importance of social competence. This article focuses on how friendship is created among very young children in Swedish preschools. The study was carried out within a toddler unit with 15 children. Six 1-year-old children, three girls and three boys, were observed during…

  17. Toxoplasma gondii infection in lambs: high prevalence of live parasites, and genetic characterisation of T. gondii isolates revealed new genotypes

    Little information is available on the presence of viable Toxoplasma gondii in tissues of lambs worldwide. The prevalence of T. gondii was determined in 383 lambs (< 1 year old) from Maryland, Virginia, and West Virginia. Hearts of 383 lambs were obtained from a slaughter house on the day of killing...

  18. 17-Beta estradiol and 4-nonylphenol delay smolt development and downstream migration in Atlantic salmon, Salmo salar

    Madsen, Steffen S; Skovbølling, Søren; Nielsen, Christian;

    2004-01-01

    The effect of 17-beta estradiol (E2) and 4-nonylphenol (4-NP) on smoltification and downstream migration of Atlantic salmon was studied in an integrated laboratory and field study. In a stock of hatchery-raised 1-year-old salmon, smoltification progressed from February until late May as judged by...

  19. Investigation of the pathogenesis of transplacental transmission of Aleutian mink disease parvovirus in experimentally infected mink

    Broll, S.; Alexandersen, Søren

    1996-01-01

    The transplacental transmission of Aleutian mink disease parvovirus (ADV) was studied in experimental infection of 1-year-old female non-Aleutian mink. The ADV-seronegative female mink were inoculated,vith ADV prior to mating or after the expected implantation of the embryos during pregnancy. A...

  20. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte I Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part I

    J.M. Pozueco Romero

    2011-09-01

    Full Text Available Tras más de 200 años de historia, el concepto de "psicopatía" ha venido experimentando una auténtica y variopinta metamorfosis terminológica. Exceptuando aquellos períodos del Medievo en los que se creía que la psicopatía y cualquier otra conducta y personalidad "anormales" eran bien de origen demoníaco, bien de corte estrictamente hereditarista-biologicista-fisionomista-antropométrico, el resto de enfoques teórico-investigadores han arrojado sobrada luz que, a día de hoy, y tras más de 200 años de historia amarga y controvertida sobre el término, nos permiten haber llegado a un consenso generalizado entre los estudiosos de la psicopatía desde el punto de vista clínico-forense y criminológico. Este primer trabajo o Parte I es una revisión en la que se pretende ahondar en los polémicos y muchas veces incomprobables orígenes del término "psicopatía". Por otro lado, y tras intensas investigaciones empíricas realizadas desde los años 70 y centradas fundamentalmente en la población penitenciaria, modernamente se ha comenzado a hablar, de manera distintiva, tanto de los psicópatas criminales como de los psicópatas integrados, habiéndose hallado que la diferencia principal entre ambos tipos de psicópatas estriba, sencillamente, en la concreta comisión de delitos, puesto que la estructura básica de personalidad es prácticamente la misma en ambos tipos de psicópatas. Finalmente, se hace muy necesario subrayar que el carácter antisocial de la personalidad y conducta se observa, por definición, en cualquier tipo de delincuentes, sean éstos o no psicópatas, un carácter antisocial que, por otro lado, no siempre ni necesariamente se observa entre los denominados psicópatas integrados.After more than 200 years of history, the concept of "psychopathy" has been undergoing an authentic and varied terminological metamorphosis. Except for those periods in the Medieval Age in which it was believed that psychopathy and other

  1. Evaluation of averted doses to infants by tap water restrictions after the Fukushima Daiichi nuclear power plant accident

    There has been some concern in reviewing the effectiveness of making decisions on the implementation of protective measures in emergency exposure situations. After the Fukushima Daiichi nuclear power plant accident, temporal changes in the concentration of iodine 131 in tap water were studied using published data from several authorities in Fukushima, Ibaraki, and Tokyo. Averted doses to infants (1-year-old children) due to the intake of iodine 131 through tap water restrictions were also evaluated. Consequently, it was found that the apparent half-life of iodine 131 in tap water was 2.8 days. The averted equivalent doses to the thyroids of 1-year-old children were found to have a maximum value of 8.3 mSv in a local area of Fukushima. Hence, the tap water restrictions implemented by the authorities were considered to be effective in the early phase of the emergency exposure situation. (author)

  2. Efeito do meloxicam sobre a lesão de isquemia e reperfusão em músculo esquelético de ratos Effect of meloxicam on ischemia-reperfusion injury in skeletal muscle of rats

    Vitor A. Uhle

    2000-01-01

    Full Text Available Os antiinflamatórios não esteroidais, derivados do piroxicam, agem como varredores de radicais livres de oxigênio em experimentos in vitro. O objetivo deste trabalho foi analisar o efeito do meloxicam em músculos esqueléticos de ratos submetidos à isquemia e reperfusão com base na análise de liberação de malondialdeído da membrana celular ( indicador de peroxidação lipídica provocada pelos radicais livres. Dezoito ratos Wistar foram divididos em 2 grupos de 9. O grupo I (grupo sham foi tratado previamente com 3g/kg de peso de solução fisiológica e o grupo II com 3g/kg de peso de meloxicam por via peritoneal. Após 5 min os ratos foram submetidos a 3h de isquemia total ( torniquete e 45 min de reperfusão das patas posteriores esquerdas. Colheram-se biópsias dos músculos isquêmicos e reperfundidos e das patas controles (contralaterais para a dosagem de malondialdeído. A análise das diferenças de concentração do malondiadeído nas patas controles e reperfundidas no grupo I (43,7± 60,7; n=9 em relação ao grupo II (21,7± 49,5; n=9 não mostrou alteração significante (p=0,3. Os dados obtidos, neste trabalho, mostram que o meloxicam não protege a musculatura esquelética dos danos causados pela isquemia e reperfusão, com base na análise do malondialdeído tissular após 3h de isquemia e 45 min de reperfusão.

  3. Lymphedema secondary to filariasis

    A 1-year-old immunodeficient boy developed brawny edema of the left foot. Lymphoscintigraphy revealed no evidence of left inguinal activity following pedal injection of Tc-99m-Sn phosphate. Over the next two months, the patient developed lymphedema on the right and repeat scintigraphy demonstrated no movement of isotope from the dorsum of either foot. Subsequent studies identified microfilaria in a nocturnal blood smear, which were thought to represent Brugia beaveri acquired by mosquito transmission in Oklahoma

  4. Age and Diet Affect Gene Expression Profile in Canine Skeletal Muscle

    Middelbos, Ingmar S.; Brittany M Vester; Lisa K Karr-Lilienthal; Schook, Lawrence B; Swanson, Kelly S.

    2009-01-01

    We evaluated gene transcription in canine skeletal muscle (biceps femoris) using microarray analysis to identify effects of age and diet on gene expression. Twelve female beagles were used (six 1-year olds and six 12-year olds) and they were fed one of two experimental diets for 12 months. One diet contained primarily plant-based protein sources (PPB), whereas the second diet contained primarily animal-based protein sources (APB). Affymetrix GeneChip Canine Genome Arrays were used to hybridiz...

  5. Changes in Phytochemical Synthesis, Chalcone Synthase Activity and Pharmaceutical Qualities of Sabah Snake Grass (Clinacanthus nutans L.) in Relation to Plant Age

    Ali Ghasemzadeh; Alireza Nasiri; Jaafar, Hawa Z. E.; Ali Baghdadi; Izham Ahmad

    2014-01-01

    In the current study, changes in secondary metabolite synthesis and the pharmaceutical quality of sabah snake grass leaves and buds were considered in relation to plant age (1 month, 6 months, and 1 year old). The activity of the enzyme chalcone synthase (CHS, EC 2.3.1.74) was measured, as it is a key enzyme for flavonoid production. Significant differences in total flavonoid (TF) production were observed between the three plant growth periods and the different plant parts. The highest conten...

  6. Lymphedema secondary to filariasis

    Leonard, J.C.; Humphrey, G.B.; Basmadjian, G.

    1985-03-01

    A 1-year-old immunodeficient boy developed brawny edema of the left foot. Lymphoscintigraphy revealed no evidence of left inguinal activity following pedal injection of Tc-99m-Sn phosphate. Over the next two months, the patient developed lymphedema on the right and repeat scintigraphy demonstrated no movement of isotope from the dorsum of either foot. Subsequent studies identified microfilaria in a nocturnal blood smear, which were thought to represent Brugia beaveri acquired by mosquito transmission in Oklahoma.

  7. Magnetic resonance in diagnosis of ureterocele

    Nascimento, Humberto do; Hachul, Mauricio; Macedo Junior, Antonio [Universidade Federal de Sao Paulo (UNIFESP/EPM), SP (Brazil). Div. de Urologia]. E-mail: humbertojr1@aol.com

    2003-05-15

    Ultrasonography is the main non-invasive technique for screening of ureterocele, but presents some difficulties for its diagnosis. Other supplementary diagnostic methods have the disadvantage of being invasive or using ionizing radiation. Magnetic resonance (MR) has a high sensitivity for diagnosing urinary tract malformations in adults and children. We report one case of ureterocele in a 1-year old child with the purpose of presenting its diagnosis through MR. (author)

  8. Magnetic resonance in diagnosis of ureterocele

    Ultrasonography is the main non-invasive technique for screening of ureterocele, but presents some difficulties for its diagnosis. Other supplementary diagnostic methods have the disadvantage of being invasive or using ionizing radiation. Magnetic resonance (MR) has a high sensitivity for diagnosing urinary tract malformations in adults and children. We report one case of ureterocele in a 1-year old child with the purpose of presenting its diagnosis through MR. (author)

  9. Characterization of Cr. gigas oysters mortalities according to the French Ifremer/REMORA monitoring network ; with complements from phytoplankton and meteorogolical data

    Fleury, Pierre-gildas; Mazurie, Joseph; Ropert, Michel; Soletchnik, Patrick; Le Coz, Florence

    2008-01-01

    The wide range of data from the French Ifremer/REMORA network, collected since 1993 allow a global characterization of mortalities of 1-year old and 2-years old cupped oysters Crassostrea gigas, that are cultivated in the main French oyster areas (Fleury et al, 2003), and thus a better understanding of the causes of these mortalities (Ifremer /MOREST project). The average annual mortalities on intertidal sites range from 10 to 20%. Most of the mortalities take place in Spring and Summer. ...

  10. Lesch-Nyhan Syndrome: a rare disorder of self-mutilating behavior

    Mrinal Gupta

    2014-01-01

    Full Text Available This paper describes Lesch-Nyhan syndrome in a 1-year-old boy. This X-linked recessive error of purine metabolism presents in infancy with a constellation of mental and developmental retardation, self-mutilating behavior, neurological features and abnormal urine uric acid: creatinine ratio. The basic defect is deficiency in phosphoribosyl transferase production but exact pathomechanism for clinical symptomatology remains un-elucidated. No specific medical treatment is available.

  11. Report on 1Y and 6M child models

    Meyer, F.; Deck, C.; Rodarius, C.; Meijer, R.; Yang, J.

    2011-01-01

    This document is the deliverable D.2.3.2 of the CASPER project. It has been done in the framework of WP2 “Child human body modeling” task 2.3 “Develop specific human segments and whole body models per age”. This task aims to provide the meshing of the whole body models of the 1 year old child (1 Y.O

  12. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    Balsby, Thorsten Johannes Skovbjerg; Hansen, Poul

    2009-01-01

    Abstract Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in five individual male Whitethroats Sylvia communis sampled as 1- and 2-year olds. These males increased the size of their element repertoire between their first and second year, but so...

  13. Effects of IBA and Putrescine on Root Formation of Olive Cuttings

    Elham Aslmoshtaghi; Ali Reza Shahsavar; Mohammad Reza Taslimpour

    2014-01-01

    Semi-hardwood cuttings of olive cv. ‘Tokhmkabki’ (low rooting ability) and cv. ‘Roghani’ (high rooting ability) were obtained from 1-year-old shoots. Cuttings were dipped in 2000, 4000, and 6000 mg L-1 IBA, 150 or 300 mg L-1 putrescine and their combination before rooting in greenhouse equipped with an automatic mist system. Rooting ability was evaluated four months after planting for each treatment. Satisfactory rooting occurred when IBA was applied with putrescine,...

  14. Intussusception in infancy and childhood: evaluation of a prognostic scoring pattern.

    Rege V; Deshmukh S; Borwankar S; Kulkarni B

    1991-01-01

    This is a retrospective analysis of 82 patients of intussusception in infancy and childhood. Males were more than females in the ratio 2.4 : 1, the ages varied from 2 months to 12 years. Majority (73%) were less than 1 year old. Commonest presentations were pain, vomiting, distension, palpable lump and blood and mucus in stools. The management of these patients varied from barium enema reduction (3 cases), reduction by surgery and manipulation (59 cases) and resection with primary anas...

  15. The Infestation of Ectoparasites (Hirstiella spp.) Treatment with Ivermectin Solition In a Green Iguana: Case Report

    YİPEL, Fulya ALTINOK

    2014-01-01

    The Infestation of Ectoparasites (Hirstiella spp.) Treatment with Ivermectin Solition In a Green Iguana: Case Report In this study; 1 year old green iguana (Iguana iguana) which brought to a private veterinary clinic for medical examination and treatment has been subject. Results of clinical, parasitological findings of iguana which has lethargy, anorexia, itching and skin discoloration in medical history. Hirstiella spp. was diagnosed by microscopic examination of collected superficial skin ...

  16. Lag screw stabilization of a cervical vertebral fracture by use of computed tomography in a horse

    A traumatic fracture of C2 was diagnosed radiographically in a 1-year-old German Warm-blood stallion. Fracture configuration was difficult to see on survey radiographs. Computed tomography yielded a more accurate assessment of the fracture and facilitated fracture repair with cortical lag screws. Precise screw placement, to avoid spinal cord damage, was obtained by use of computed tomography. Follow-up radiography revealed normal bone healing, and the horse was in dressage schooling 24 months after surgery

  17. Marginalia no. 21

    Library, Merrill-Cazier

    2006-01-01

    Issue Number 21: Autumn 2006 “AS THE LIBRARY SHAPES STUDENTS, STUDENTS SHAPE THE LIBRARY”-A message from Director, Linda Wolcott LET US EAT CAKE! MERRILL-CAZIER LIBRARY IS 1-YEAR OLD!-The Library holds a birthday party. IDEAS IN FLIGHT-Patrick Williams on a popular birdhouse exhibit by Darrin Brooks Interior Design students. BOOKS STUDIO EXHIBIT: BASIC BINDING & BEYOND-Dennise Gackstetter describes unique book as art exhibit MORE GALLERY SPACE: FOR STUDENT EXHIBITS- A LOT MORE ...

  18. Macronuclear chromatin structure dynamics in Colpoda inflata (Protista, Ciliophora) resting encystment.

    Tiano, L; Chessa, M G; Carrara, S; Tagliafierro, G; Delmonte Corrado, M U

    1999-01-01

    The chromatin structure dynamics of the Colpoda inflata macronucleus have been investigated in relation to its functional condition, concerning chromatin body extrusion regulating activity. Samples of 2- and 25-day-old resting cysts derived from a standard culture, and of 1-year-old resting cysts derived from a senescent culture, were examined by means of histogram analysis performed on acquired optical microscopy images. Three groups of histograms were detected in each sample. Histogram classification, clustering and matching were assessed in order to obtain the mean histogram of each group. Comparative analysis of the mean histogram showed a similarity in the grey level range of 25-day- and 1-year-old cysts, unlike the wider grey level range found in 2-day-old cysts. Moreover, the respective mean histograms of the three cyst samples appeared rather similar in shape. All this implies that macronuclear chromatin structural features of 1-year-old cysts are common to both cyst standard cultures. The evaluation of the acquired images and their respective histograms evidenced a dynamic state of the macronuclear chromatin, appearing differently condensed in relation to the chromatin body extrusion regulating activity of the macronucleus. The coexistence of a chromatin-decondensed macronucleus with a pycnotic extrusion body suggests that chromatin unable to decondense, thus inactive, is extruded. This finding, along with the presence of chromatin structural features common to standard and senescent cyst populations, supports the occurrence of 'rejuvenated' cell lines from 1-year-old encysted senescent cells, a phenomenon which could be a result of accomplished macronuclear renewal. PMID:10439214

  19. Infant Cardiac CT Angiography with 64-Slice and 256-Slice CT: Comparison of Radiation Dose and Image Quality Using a Pediatric Phantom

    Lee, Yi-Wei; Yang, Ching-Ching; Mok, Greta S. P.; Wu, Tung-Hsin

    2012-01-01

    Background The aims of this study were to investigate the image quality and radiation exposure of pediatric protocols for cardiac CT angiography (CTA) in infants under one year of age. Methodology/Principal Findings Cardiac CTA examinations were performed using an anthropomorphic phantom representing a 1-year-old child scanned with non-electrocardiogram-gated (NG), retrospectively electrocardiogram-gated helical (RGH) and prospectively electrocardiogram-gated axial (PGA) techniques in 64-slic...

  20. Chronic granulomatous disease presenting as retinal mass

    Ahmad M. Mansour; Al Dairy, Mays; Hamam, Rola; Hidayat, Ahmed A

    2008-01-01

    1-year-old girl was admitted for fever of unknown origin. Funduscopy revealed juxtapapillary retinal inflammatory mass in one eye with a differential diagnosis of sarcoidosis, tuberculosis, retinoblastoma or metastatic disease. Retinal biopsy showed necrotizing granulomatous retinitis. Extensive workup and therapeutic trials failed to confirm the diagnosis of tuberculosis or sarcoidosis. Her 7-month brother and 4-year-old male cousin presented with nystagmus, poor vision, paravascular pigment...

  1. Femoral kontroll blant idrettsaktive kvinner : testutvikling og sammenheng med skadehistorikk

    Østvold, Mattis

    2011-01-01

    Purpose: Non-contact knee injuries are often the topic of discussion in relation to injury prevention. The purpose of this study was to develop a standardized test and a standardized analysis method for quantifying changes in the femoral control in a simple but reliable way. We also wanted to quantify the relationship between femoral control and injury history in the sample. Method: Female athletes (n = 95, age = 18 ± 1 years old) who were active in various sports, conducted two weak links...

  2. Cardiopulmonary exercise testing – effective method for evaluation and recommendation of individualized exercise training in patients with metabolic syndrome

    Claudiu Avram; Mihaela Oraviţan; Lucian D. Hoble; Bogdan Almăjan-Guţă

    2011-01-01

    The present study aims to emphasize the role of cardiopulmonary exercise training (CPET) in evaluation and recommendation of individualized exercise training in patients with a metabolic syndrome. Methods: We performed a prospective longitudinal study of 9 months. The study group consisted of 28 young patients (21.3±3.1 years old) without contraindications to exercise, previously diagnosed with metabolic syndrome according to NCEP-ATPIII criteria. All patients were evaluating at baseline and ...

  3. Potencial antioxidante in vitro das folhas da Bauhinia ungulata L.

    Cristiane da Silva Paula; Vanessa Cristina Dias Canteli; Beatriz Cristina Konopatzki Hirota; Ranieri Campos; Vinícius Bednarczuk de Oliveira; Milena Kalegari; Cristiane Bezerra da Silva; Geciani Miriam Silva; Obdúlio Gomes Miguel; Marilis Dallarmi Migue

    2014-01-01

    A Bauhinia ungulata L. (Pata de Vaca) é uma planta nativa do Brasil, encontrada principalmente na região Amazônica, Cerrado e Mata Atlântica, utilizada popularmente no tratamento do diabetes. Este trabalho descreve uma análise in vitro do potencial antioxidante do extrato bruto etanólico e frações (hexano, clorofórmio, acetato de etila e hidroalcoólica residual) obtidos de folhas desta espécie, através de três metodologias distintas: 1) captura de radical orgânico 2...

  4. Diseño y control reactivo de robots caminantes sobre terreno natural

    Nabulsi Abussaid, Samir

    2008-01-01

    En las últimas décadas se ha constatado el creciente interés que presentan los robots caminantes, tanto desde el punto de vista de la investigación básica como de sus potenciales aplicaciones. Una de las principales características de los robots equipados con patas es su capacidad para poder desplazarse sobre una amplia variedad de terrenos no estructurados. Esta particularidad los hace muy atractivos e interesantes para su aplicación práctica como robots de servicios en los que se requiere l...

  5. Esquemas cognitivos en personas con conducta de juego patológico y su relación con experiencias de crianza

    Ana Estévez; Esther Calvete

    2007-01-01

    Este estudio evaluó si las personas con juego patológico presentaban esquemas negativos disfuncionales y recordaban estilos de crianza negativos en sus padres y madres durante su infancia. Participó una muestra de 167 ludópatas (77,2% hombres y 22,8% mujeres) y un grupo de contraste de 167 personas sin ludopatía (71,1% hombres y 28,9% mujeres). Se obtuvieron medidas de esquemas cognitivos negativos y de estilos parentales. Los resultados mostraron que las personas con juego patológico puntuab...

  6. Efecto de melatonina exógena en procesos inflamatorios agudos y crónicos en ratas

    Rocha, Nadir de la; Rotelli, Alejandra Ester; Pelzer, Lilian

    2002-01-01

    Se investigó la influencia de melatonina (4 mg/kg) en la inflamación aguda usando el modelo de edema de pata en rata y en la inflamación crónica mediante la prueba del granuloma y artritis inducida por adyuvante. Melatonina inhibió el edema producido por carragenina en el modelo agudo, pero no presentó acción inhibitoria en la fase proliferativa de la prueba del granuloma y en la fase aguda y crónica de la artritis inducida por adyuvante. Estos resultados sugieren que melatonina, a la m...

  7. Grupos de Discusión y HJ-Biplot: Una Nueva Forma de Análisis Textual

    Daniel Caballero Julia; Purificación Vicente Galindo; Mª Purificación Galindo Villardón

    2014-01-01

    Este trabajo da un paso más allá en la integración de métodos cualitativos de investigación y técnicas cuantitativas analizando Grupos de Discusión desde una perspectiva multivariante con el apoyo del HJ-Biplot. Una propuesta metodológica que combina la codificación cualitativa con un nuevo valor matemático de caracterización. La propuesta se aplica al estudio de las representaciones en el discurso sobre Calidad de Vida de los ludópatas.

  8. A síndrome anserina Anserine syndrome

    Milton Helfenstein Jr; Jorge Kuromoto

    2010-01-01

    Dor no joelho é uma condição comum na clínica diária e a patologia anserina, também conhecida como pata de ganso, tem sido considerada uma das principais causas. O diagnóstico tem sido realizado de maneira eminentemente clínica, o que tem gerado equívocos. Os pacientes queixam-se tipicamente de dor na parte medial do joelho, com sensibilidade na porção ínferomedial. Estudos de imagem têm sido realizados para esclarecer se tais pacientes possuem bursite, tendinite ou ambos os distúrbios na reg...

  9. Post Mortem y Tony Manero

    Urrutia, Carolina

    2015-01-01

    Post Mortem, el tercer largometraje de Pablo Larraín, podría ser el preludio de su cinta anterior Tony Manero ; el momento en que el protagonista (en ambas instancias interpretado por Alfredo Castro), cae irreversiblemente en la locura y se vuelve psicópata. La apuesta en ambos filmes es extrema porque asume la representación y la relectura de una época extrema, donde la demencia que se activa con el régimen militar ya parece estar instalada en la sociedad que lo origina y que ahora simplemen...

  10. SALINE WATER RESOURCES IN CLUJ-NAPOCA SURROUNDINGS

    B. CZELLECZ; I. GÁBOR; L. RAVASZ; G. ȘCHIOPU; N. SZOPOS

    2016-01-01

    Saline waters are usually researched in those places where it is used for balneotherapy or other industrial purposes. The aim of this study is to describe the saline water sources from less known areas, as they are an important natural mineral water resource. Twenty nine water samples were analyzed from Cojocna-Pata-Sopor region, thirteen of them can be considered saline waters. The visited locations are 21, 15 and 3 km far from Cluj-Napoca. Highly concentrated springs are to be found in the ...

  11. Japan, quality tourist destiny: a learner option for Colima

    Irma Magaña Carrillo

    2007-01-01

    In this research feature presentation some results are presented as "A Propose Plan to implement a Culture with Quality Control in Tourism Business making Mexico an Attractive site in the Asia-Pacific market and Active within the PATA organism in the XXI Millennium". Which was performed in Japan from 2001 to 2004. This thesis acquires the category of qualitative and emergent and it arouse as a first attempt in reaching the point of a systematic application of the theory of the Model for Total...

  12. Productividad secundaria en los esteros de la barra de arena El Mogote en la Ensenada de La Paz, Baja California Sur, México Secondary productivity in the estuaries of El Mogote sand bar in Ensenada de La Paz, Baja California Sur, Mexico

    Jorge A. López-Rocha; Esteban F. Félix-Pico; Martín E. Hernández-Rivas

    2012-01-01

    Los ecosistemas de manglar son un hábitat crítico para numerosas especies y su productividad es importante por su contribución de detritos orgánicos y su producción secundaria. El objetivo del trabajo fue definir indicadores de productividad secundaria para establecer una línea base que permita medir alteraciones en el sistema de manglar por posibles perturbaciones naturales o antropogénicas. Como indicadores se escogieron los moluscos bivalvos pata de mula, Anadara tuberculosa y el ostión de...

  13. Potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da nimesulida por vitaminas do complexo B

    L. A. Rodrigues; J. F. Fracasso; C. E. Siqueira

    2009-01-01

    Investigou-se os efeitos de algumas vitaminas B associadas ao diclofenaco ou nimesulida, na contorção abdominal em camundongos e edema de pata em ratos apenas com a nimesulida ou sua associação com algumas vitaminas B. Verificou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B

  14. Efeito do tratamento com algumas vitaminas B na potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da talidomida

    L. A. Rodrigues; P. H.B. Godói; C. E. Siqueira; M. C. Longo; J. F. Fracasso; N. M.K. NAKAEMA

    2009-01-01

    Mostrou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], isoladas ou administradas conjuntamente, não inibiu o edema de pata produzido pela carragenina em ratos, nem as contorções abdominais produzidas pelo ácido acético em camundongos. Por outro lado, o ...

  15. Actividad antinociceptiva, anti-inflamatoria y relajante muscular de (+)-curcufenol aislado de la esponja marina didiscus oxeata

    Salama, Ahmed; Toscano, Mariela; Del Valle, Martha; Vargas, Erika

    2008-01-01

    Mediante el método de edema plantar inducido por carragenina en la pata de la rata, (+)-curcufenol aislado de la esponja marina Didiscus oxeata mostró una actividad antiinflamatoria moderada, en las dosis de 100, 150 y 200 mg/kg administradas por vía oral, mientras que la actividad antinociceptiva fue confirmada por el método de contorsiones inducidas por ácido acético en ratones mostrando un efecto analgésico muy alto, en las dosis de 50, 100, 150 y 200 mg/kg administradas por vía oral, en c...

  16. Resultados de la cirugía del LCA : platias mixtas biológicas-sintéticas

    Manzano Serrano, Emilio

    1995-01-01

    Se estudian 58 casos de lesiones de ligamento cruzado anterior (LCA), aisladas o combinadas que dan lugar a inestabilidad anterior de la rodilla. Se realizan reconstrucciones intraarticulares con plastia mixta de tendones de la pata de ganso con aumento de fibra sintética de polipropileno trenzado (Kennedy-Lad) o de poliester de polietilenotereftalato (Leeds-Keio), durante el periodo comprendido entre 1988-1992, con un seguimiento mínimo de dos años. Las dos técnicas difieren en el paso artic...

  17. El anciano con cardiopatía terminal

    Martínez Sellés Oliveria Soares, Manuel

    2009-01-01

    El objetivo de este documento es aportar un punto de vista experto que permita un mejor conocimiento de la situación y una mejora en el manejo y la toma de decisiones en los últimos días de vida del paciente de edad avanzada que sufre una cardiopatía. Los cardiópatas ancianos constituyen un grupo heterogéneo y es necesaria una valoración exhaustiva, especialmente de los factores que condicionan el pronóstico (cardiopatía, comorbilidad, situación funcional y datos de fragilidad) antes de tomar...

  18. Antocianinas em extratos vegetais: aplicação em titulação ácido-base e identificação via cromatografia líquida/espectrometria de massas

    Wesson Guimarães

    2012-01-01

    Full Text Available Anthocyanins extracted from picao, quaresmeira, petunia, flamboyant, purple ipe, lobeira, pata de vaca, jaboticaba, purple cabbage and jambul were evaluated as natural acid-base indicators. Anthocyanins in extracts were identified using HPLC/MS. Clear, rapid change in color at final-point titration was observed for extracts but only picao showed strong change in pH. Indirect determination of carbonate in limestone using a natural indicator was performed and results compared with phenolphthalein indicator and potentiometer titration. Optimal results were obtained with picao but other extracts showed good accuracy and precision.

  19. La globalización y su impacto en la economía de la educación en el sistema educativo público de Puerto Rico

    Pizarro Figueroa, J.

    2010-01-01

    En este mundo globalizado la educación se constituye en un factor indispensable pata el crecimiento del ser humano y su sociedad. La educación es determinante para el crecimiento económico, social y ecológico de un país. En este ensayo presentamos un análisis sobre la economía de la educación. A tales fines, comenzaremos discutiendo el concepto de la globalización y sus características, tanto sus ventajas como desventajas. Posteriormente, analizaremos la economía de la educación en el Sistema...

  20. Propuesta de una guía de práctica clínica integral entre homeopatía y alopatía de la patología más prevalente en el servicio de hospitalización pediátrica

    León Álvarez, Gissela

    2011-01-01

    Se realizó el ejercicio de adaptación de una guía de práctica clínica de Bronquiolitis utilizando una herramienta epidemiológica nueva denominada procedimiento ADAPTE, con este ejercicio se pretende crear un modelo de atención que integre los conocimientos en medicina alopática convencional y los de Homeopatía, que permita a los médicos pediatras y homeópatas en ejercicio cumplir con el requerimiento legal para la habilitación de sus consultorios. Durante el proceso se realizó la determina...

  1. El concepto de "Constitución" en el Río de La Plata (1750-1850)

    Noemí Goldman

    2007-01-01

    Este artículo estudia los cambios y permanencias en el significado del concepto de constitución en el Río de la Plata en un arco temporal de importantes cambios políticos. En sus particulares modulaciones semánticas, el concepto da cuenta del conflictivo proceso de revolución, guerras de independencia y disputas en torno al ejercicio y a la definición de la soberanía entre los pueblos que emergieron de la crisis de la Monarquía española de 1808. En efecto, el Río de la Pata ...

  2. Estado da arte de Bauhinia forficata Link (Fabaceae) como alternativa terapêutica para o tratamento do Diabetes mellitus

    Graziella Silvestre Marques; Larissa Araújo Rolim; Lariza Darlene Santos Alves; Caio César de Andrade Rodrigues Silva; Luiz Alberto Lira Soares; Pedro José Rolim-Neto

    2013-01-01

    O Diabetes mellitus, por tratar-se de uma doença crônica e por apresentar um crescimento acentuado na sociedade brasileira, tornou-se alvo da comunidade científica na busca de novas alternativas terapêuticas. Diversos estudos estão sendo desenvolvidos com o objetivo de comprovar as aparentes propriedades farmacológicas de espécies vegetais empregadas no tratamento desta enfermidade. Sendo assim, a Bauhinia forficata Link, comumente conhecida como pata-de-vaca, figur...

  3. Dicty_cDB: Contig-U01479-1 [Dicty_cDB

    Full Text Available EMATOLOGICAL MALIGNANCY. 36 0.11 2 ( DI141804 ) Prognostic for hematological malignancy. 36 0.11 2 ( CS247571 ) Sequence 23 from Pat...A: 40 X1: 6 (11.9 bits) X2: 15 (29.7 bits) S1: 12 (24.3 bits) S2: 15 (30.2 bits) dna update 2009. 4.28 Homolog...( FD457023 ) EGGBB39TR Haematobia irritans eggs Haematobia irr... 46 5e-05 2 ( FD451921 ) EGGAE38TR Haematobia irritans eggs Haemato...bia irr... 46 5e-05 2 ( FD451498 ) EGGAB75TR Haematobia irritans eggs Haematobia irr...tt ttattniasspngiptttttttgitstnhndattstiptnddgtsnatrw*wcd--

  4. En búsqueda de un desarrollo regional sustentable: propuesta de una comunidad turística rural, Moctezuma, Sonora

    Grajeda Bustamante, Gabriela; García Porchas, Mercedes; Santiago Hernández, Víctor Guadalupe; Córdova Yánez, Alejandro

    2010-01-01

    Moctezuma, municipio ubicado en la zona serrana del estado de Sonora a 175 kilómetros de la capital; es reconocido aparte de su trabajo artesanal de talabartería por ser el lugar en el que confluyen aproximadamente 16 municipios de la zona serrana; es desde este ayuntamiento que se enmarca la diferencia entre poblaciones o municipios de la sierra baja y sierra alta; con una población de 4322 habitantes para el 2005 según datos del INEGI, fundado en 1644 con descendencia ópata, Moctezuma cobra...

  5. Free Completely Random Measures

    Collet, Francesca

    2011-01-01

    Free probability is a noncommutative probability theory introduced by Voiculescu where the concept of independence of classical probability is replaced by the concept of freeness. An important connection between free and classical infinitely divisibility was established by Bercovici and Pata (1999) in form of a bijection, mapping the class of classical infinitely divisible laws into the class of free infinitely divisible laws. A particular class of infinitely divisible laws are the completely random measures introduced by Kingman (1967). In this paper, a free analogous of completely random measures is introduced and, a free Poisson process characterization is provided as well as a representation through a free cumulant transform. Furthermore, some examples are displayed.

  6. Caracterización comparativa a la faena de cinco híbridos experimentales de pollo campero con diferente genotipo materno

    Dottavio, Ana María; Advínculo, S. A.; Librera, J. E.; Romera, Bernardo Martín; Canet, Zulma E.; Di Masso, Ricardo

    2014-01-01

    Se evaluaron la proporción de pechuga, pata muslo y grasa abdominal y el rendimiento a la faena de machos pertenecientes a cinco grupos genéticos experimentales de pollos camperos. Los grupos provenían del cruzamiento entre gallos de la población sintética paterna AH’, mejorada por tasa de crecimiento y eficiencia alimenticia y gallinas de cinco poblaciones sintéticas maternas. Como grupo testigo se utilizaron machos contemporáneos de la versión tradicional de Campero INTA. Las aves producto ...

  7. ‘COROJO 2006’: NUEVA VARIEDAD CUBANA DE TABACO NEGRO (Nicotiana tabacum L.)

    Vivaldo García Morejón; Nancy Santana Ferrer; Humberto García Cruz; Emis Mena Padrón

    2013-01-01

    En la Estación Experimental del Tabaco, de San Juan y Martínez, Pinar del Río durante la campaña tabacalera 2001-2002, se realizó un cruzamiento sexual con el objetivo de obtener una variedad de tabaco negro con mayor rendimiento que la comercial ‘Criollo 98’, resistente al moho azul ( Peronospora hyocyami de Bary), a la pata prieta ( Phytophthora parasitica Dast. var . Nicotianae Breda de Haan), al virus del mosaico del tabaco (VMT) y a la necrosis ambiental. Después de cinco generaciones de...

  8. La "Dea Artio" celta y la "Artemis" griega: Un aspecto religioso de la afinidad celto-iliria

    Ruipérez, Martín S.

    2009-01-01

    En una partida de estatuillas romanas de bronce encontradas en 1832 en Muri, en las inmediaciones de Berna (Suiza), se hallaban una figura de osa, una diosa sentada teniendo una patera con frutas, una cesta, un árbol tortuoso y un pedestal con la inscripción Deae Artioni/ Licinia Sabinilla. En seguida se vio que la diosa, el cesto y el árbol tenían su sitio señalado en el pedestal, pero hasta 1899 no se reconstruyó el grupo en su integridad al probar Vionnet que las patas de la osa habían dej...

  9. Informe de nuevas variedades IT-2004: NUEVA VARIEDAD DE TABACO NEGRO CUBANO (Nicotiana tabacum L.

    E. Espino

    2005-01-01

    Full Text Available La nueva variedad de tabaco negro cubana 'IT-2004' posee un potencial de rendimiento de 2370 kg.ha-1 (700 qq/cab., con 20-22 hojas aprovechables por planta, es altamente resistente al moho azul, la pata prieta y necrosis ambiental y resistente a la sequía. Su calidad organoléptica responde al patrón del tabaco negro cubano, aunque con una fortaleza media, de ligera a medianamente fuerte, lo que permite su utilización como productora de materia prima para la industria cigarrera nacional.

  10. COMPOSICIÓN QUIMICA DE LA LECHE, DIGESTIBILIDAD in vitro DE LA MATERIA SECA Y PRODUCCIÓN EN VACAS ALIMENTADAS CON GRAMÍNEAS SOLAS O ASOCIADAS CON Lotus uliginosus

    A. Morales

    2013-01-01

    Full Text Available La presente investigación tuvo como objetivo evaluar el uso de la leguminosa Lotus uliginosus como alternativa de inclusión dentro de las praderas en dos ecorregiones estratégicas de la sabana de Bogotá. en cada finca se evaluaron cuatro tratamientos: 1 kikuyo solo (P. clandestinum, 2 kikuyo asociado con trébol pata de pájaro ( P.clandes-tinum + L. uliginosus, 3 festuca alta sola (F. arundinacea y 4 Festuca alta asociada con trébol pata de pájaro (F. arundinacea + L. uliginosus. el número de bovinos varió de acuerdo a la capacidad de carga de cada finca. se utilizaron animales que se encontraban en el segundo tercio de lactancia durante un período experimental de siete días. en cada tratamiento se determinó la producción (L/día y calidad de leche (% de grasa, proteína y sólidos totales; en la pastura se evaluó la composición química (Ms, Fdn, Fda y la digestibilidad in vitro de la materia seca (divMs. se midió el consumo voluntario. en la finca Megaleche la producción de biomasa presentó diferencias significativas (P<0,05 entre los tratamientos destacándose el tratamiento del kikuyo solo; la calidad nutricional de las pasturas también presentó diferencias (P<0,04 destacándose el tratamiento de kikuyo + trébol pata de pájaro, asociación que también se destacó en consumo voluntario (P< 0.05 y producción de leche (P<0,05. en la finca Colega el contenido de proteína del forraje presentó diferencias cuando las gramíneas se asociaron con el trébol pata de pájaro (P<0,001. se concluyó que la introducción del Lotus en las praderas mejoró la producción de leche y consumo de materia seca en los animales.

  11. Glucose metabolism in rats submitted to skeletal muscle denervation

    Wilton Marlindo Santana Nunes

    2005-07-01

    Full Text Available This study analyzed the local and systemic effects of immobilization by denervation of the skeletal muscle on glucose metabolism. The rats were submitted to section of the right paw sciatic nerve. A reduction was observed in glucose uptake by the isolated soleus muscle of the denervated paw after 3 and 7 days, but not after 28 days in relation to the control animals. There was no difference after 3 and 7 days in glucose uptake by the soleus muscle of the opposite intact paw in relation to the control. There was increased glucose uptake in the same paw 28 days after denervation. The rate of glucose removal in response to exogenous insulin after 28 days of denervation was significantly higher than in control animals and those observed after 3 and 7 days of denervation. These results suggest that immobilization by denervation interfered not only in glucose metabolism in the skeletal muscle involved but also in other tissues.O estudo analisou os efeitos locais e sistêmicos da imobilização por desnervação do músculo esquelético sobre o metabolismo glicidico. Ratos foram submetidos à secção do nervo ciático da pata direita. Observou-se redução da captação de glicose pelo músculo sóleo isolado da pata desnervada após 3 e 7 mas não após 28 dias em relação a animais controle. Não houve diferença após 3 e 7 dias na captação de glicose pelo músculo sóleo da pata contralateral intacta em relação ao controle. Houve aumento da captação de glicose nesta mesma pata 28 dias após a desnervação. A taxa de remoção da glicose em resposta à insulina exógena após 28 dias de desnervação foi significantemente superior à do controle e àquelas observadas após 3 e 7 dias da desnervação. Esses resultados sugerem que a imobilização por desnervação interfere não só no metabolismo da glicose no músculo esquelético envolvido como também em outros tecidos.

  12. 14C-AMS as a tool for the investigation of mercury deposition at a remote Amazon location

    We present results of the atmospheric mercury deposition rate in the Amazon region during the last 43 000 years. Lake sediment samples were collected from the Lagoa da Pata, a small and remote lake in northern Brazilian Amazon. The samples were divided in sub-samples, for C, Hg, N and 14C-AMS analyses. Three main paleoclimatic events could be identified. The mercury accumulation rates were found to be larger during the periods of the Holocene and Pleistocene associated with high temperatures and frequency of forest fires

  13. Sex and age differences in meat composition of Yeso sika deer (Cervus nippon yesoensis) reared for a short period after capture in the wild.

    Hayashida, Maki; Souma, Kousaku; Sugo, Kazuki; Araki, Shin-Ichi; Ishizaka, Fumiaki; Ueda, Masami; Kasai, Takamasa; Masuko, Takayoshi

    2015-02-01

    Yeso sika deer captured in winter around Lake Akan in Hokkaido were reared for 8-10 months at Tokyo University of Agriculture in Abashiri. Six 1-year-old females and males and six 2-year-old or older (adult) females and males were slaughtered and their carcasses were processed. The chemical composition, mineral contents and fatty acid composition of the loin were measured. No marked influence of gender or age was noted in the chemical composition of loin. In the mineral contents, significant differences were noted. The potassium and sulfur contents were lower and the sodium content was higher in adult deer meat (P < 0.05, respectively) and the potassium content was higher in male deer meat (P < 0.05). Arsenic, cadmium or lead were not detected. In the unsaturated fatty acid, a significant interaction was detected (P < 0.05), and it was high in 1-year-old female deer meat and low in 1-year-old male deer meat. Significant gender or age differences were noted only in the mineral contents in the loin of deer reared for a short period after capture. PMID:25186458

  14. Denitrification capacity of bioreactors filled with refuse at different landfill ages

    The denitrification capacity of refuse at different landfill ages in bioreactor landfill system was studied. Three reactors filled with 1-year-old refuse (R1), 6-year-old refuse (R6) and 11-year-old refuse (R11), respectively, were operated in the experiment. Nitrate solution (1000 mg NO3--N L-1) was added into each reactor. The results showed that the reactors were all able to consume nitrate. However, 1-year-old refuse in R1 had both a higher nitrate reduction rate and concentration of N2. In addition, vertical differences in nitrate removal along the depth of R1 were observed. The bottom-layer refuse and the middle-layer refuse both showed higher efficiency in nitrate depletion than the top layer. Furthermore, N2O accumulation was found in R11 with the concentration up to 19.3% of the released gas. These results suggested that 1-year-old refuse, which was partly degraded, was more suitable to use as denitrification medium.

  15. Asymmetric processing of durational differences - electrophysiological investigations in Bengali.

    Roberts, Adam C; Kotzor, Sandra; Wetterlin, Allison; Lahiri, Aditi

    2014-05-01

    Duration is used contrastively in many languages to distinguish word meaning (e.g. in Bengali, [pata] 'leaf' vs. [pat:a] 'whereabouts'). While there is a large body of research on other contrasts in speech perception (e.g. vowel contrasts and consonantal place features), little work has been done on how durational information is used in speech processing. In non-linguistic studies of low-level processing, such as visual and non-linguistic acoustic pop-out tasks, an asymmetry is found where additional information is more readily detected than missing information. In this study, event-related potentials were recorded during two cross-modal auditory-visual semantic priming studies, where nonword mispronunciations of spoken prime words were created by changing the duration of a medial consonant (real word [dana] 'seed'>nonword [dan:a]). N400 amplitudes showed an opposite asymmetric pattern of results, where increases in consonantal duration were tolerated and led to priming of the visual target, but decreases in consonantal duration were not accepted. This asymmetrical pattern of acceptability is attributed to the fact that a longer consonant includes all essential information for the recognition of the original word with a short medial consonant (a possible default category) and any additional information can be ignored. However, when a consonant is shortened, it lacks the required durational information to activate the word with the original long consonant. PMID:24726333

  16. Environmental Equity through Negotiation: A Case Study on Urban Landfills and the Roma Community

    Petrescu-Mag, Ruxandra Mălina; Petrescu, Dacinia Crina; Oroian, Ioan Gheorghe; Safirescu, Ovidiu Călin; Bican-Brișan, Nicoleta

    2016-01-01

    The paper discusses the necessity to bring environmental equity within the Pata Rât Roma community in Northwest Romania, relying on the answers to three questions: “Does environmental equity exist in Pata Rât?”, “How can it be attained?”, and “To what extent can it be brought to the targeted people?” It was shown how a trio of factors tailors the destiny of Roma inhabitants: being a minority, their ethnicity, and the fact they are living on and off what society rejects and dumps—a landfill. The framing of the environmental equity concerns within a vision considering negotiation as the most adequate means to attain it is a novel approach. Further on, the results of the study can fuel win-win solutions in environmental equity. The information abstracted from a set of indicators, assessed through an evaluation matrix, represents a beneficial platform for future bottom-up decisions concerning landfill residents. Three action options were analyzed: on-site living opportunities—that resulted to be preferred, off-site living opportunities, and “Do nothing”. The analysis provides qualitative evidence that the evaluation of environmental equity is largely subjective, because of its complexity and specificity related to geographical, historical, cultural characteristics, and political interests. PMID:27314371

  17. Estudio del comportamiento térmico y la composición de aceites para el curtido de cueros

    Grompone, M. A.

    2000-06-01

    Full Text Available The leather industry uses fatty materials to give leather certain characteristics. Neatsfoot oil, a material with variable cost and disponibility, has been used traditionally. Samples of neatsfoot, chicken, fish and rice bran oils are studied in this work. They are evaluated as potential raw materials for leather tanning derivatives, according to their thermal behaviour (Cold Test and DSC and main fatty acids composition (GC. Some seem adequate for that purpose, while others could be modified through thermal fractionation.La industria del cuero utiliza materiales grasos que otorgan determinadas características al cuero. Tradicionalmente se ha usado, entre otros, el aceite de patas de vacuno, producto cuya disponibilidad y costo son muy variables. En este trabajo se estudiaron muestras de distintos aceites de patas de vacuno, de pollo, de pescado y de salvado de arroz. Fueron evaluadas como potenciales materias primas para la obtención de derivados para el curtido de cueros, en función de su comportamiento térmico (“Cold Test” y DSC, y su composición en ácidos grasos principales (GC. Algunos de los aceites estudiados aparecen como adecuados para dicho uso, mientras que otros podrían ser mejorados por fraccionamiento térmico.

  18. Psicopatía, violencia y criminalidad: un análisis psicológico-forense, psiquiátrico-legal y criminológico (Parte II Psychopathy, violence and crime: a psychological-forensic, psychiatric-legal and criminological analysis (Part II

    J.M. Pozueco Romero

    2011-12-01

    Full Text Available La Jurisprudencia española se encuentra frecuentemente ante dictámenes periciales en los que aparecen términos como psicópata, trastorno antisocial de la personalidad, personalidad psicopática, psicópata desalmado, psicopatía epileptoide, sociopatía, etc. De esta forma, no es infrecuente que los juristas (magistrados, jueces, fiscales, abogados se hallen desorientados ante tanta terminología que, pese a todo, en absoluto se constituyen en sinónimos. La Doctrina, por su parte, disiente de la visión tradicionalmente ya asentada en la Jurisprudencia de que los psicópatas sean sujetos inimputables. Muchos penalistas conocen bien los textos y estudios psicológicos y psiquiátricos que al respecto existen, y en ellos suelen basarse para establecer ciertas diferencias que aparentemente son sutiles. Una de las controversias más prolongadas es si los términos trastorno antisocial de la personalidad y psicopatía son la misma entidad. En la revisión de esta Parte II también se pretende ahondar en y remarcar esas sutiles diferencias, ya que se ha demostrado reiteradamente que ambas entidades diagnósticas, si bien comparten algunos rasgos en común, no son el mismo concepto ni comportan las mismas consecuencias. Asimismo, se analiza la enconada polémica que existe en torno a la frecuente asociación entre psicopatía y consumo de drogas, una polémica que parece sentar sus orígenes en esa misma confusión terminológica entre psicopatía y trastorno antisocial de la personalidad. Finalmente, se revisa la bibliografía relativa a la criminalidad de los psicópatas, haciendo especial referencia tanto al caso de los delincuentes comunes como al caso de los asesinos en serie y otros delincuentes violentos, sin perder de vista la posición que actualmente tienen los psicópatas a nivel penológico, doctrinal y jurisprudencial.Spanish jurisprudence is frequently faced with the fact that in some expert reports appear terms like psychopath

  19. Efeito analgésico de antagonistas do receptor da histamina H1 em modelo de dor provocada por formalina em ratos Efecto analgésico de antagonistas del receptor de la histamina H1 en un modelo de dolor provocado por formalina en ratones Analgesic effects of H1 receptor antagonists in the rat model of formalin-induced pain

    Hazem Adel Ashmawi

    2009-08-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Os receptores de histamina mediam vias nociceptivas principalmente no sistema nervoso central. Alguns estudos mostraram efeito analgésico de antagonistas de receptor de histamina no sistema nervoso periférico. Não está claro se o efeito analgésico local é classe específico ou droga específico. MÉTODO: Para responder a essa questão, utilizamos três diferentes antagonistas do receptor H1 (pirilamina, prometazina e cetirizina administrados diretamente na pata do rato, pela via intraperitoneal ou por bloqueio de nervo periférico em modelo de dor induzida por formalina. Observamos o efeito das drogas no comportamento do número de elevações da pata. RESULTADOS: Na fase I, a pirilamina local diminuiu o número de elevações da pata de forma dose-dependente. Na dose mais alta, a diminuição foi de 97,8%. Para a prometazina, a diminuição foi de 92% e para cetizirina, 23,9%. Na fase II, a pirilamina diminuiu o número de elevações da pata em 93,5%, a prometazina em 78,2% e a cetirizina em 80,1%. A administração dos fármacos por via intraperitoneal não alterou o comportamento doloroso. Quando utilizadas para bloqueio de nervo periférico, na fase I, a pirilamina diminuiu o número de elevações da pata em 96,7%, a prometazina em 73,3% e a cetirizina em 23,9%. Na fase II, a pirilamina levou à diminuição de 86,6%, a prometazina de 64,4% e a cetirizina de 19,9%. CONCLUSÕES: Os resultados mostraram que os antagonistas de receptor da histamina H1 apresentam efeitos analgésicos locais, diferentes do efeito sistêmico, sendo um deles anti-inflamatório e classe específico e o outro específico para prometazina e pirilamina, semelhante a efeito clínico anestésico local.JUSTIFICATIVA Y OBJETIVOS: Los receptores de histamina intermedian las vías nociceptivas, principalmente en el sistema nervioso central. Algunos estudios arrojaron un efecto analgésico de antagonistas de receptor de histamina en el

  20. Survey of food consumption by infants in Aomori prefecture

    We are collecting sociological data in relation to the estimation of radiation dose by radionuclides released from the nuclear fuel cycle facilities in Rokkasho-mura, Aomori Prefecture. This survey on the daily food intake by infants in Aomori Prefecture over a two-year period (1995-1996) is a continuation of a previous survey on individuals (≥ 5 years old). We investigated 179 infants in the age group around 4 years old and 181 infants in the age group around 1 year old. They were living in families belonging to three different groups of primary occupations: fishery workers, farmers and other occupations. The average total daily food consumption of the age group around 4 years old was about 958 grams/day/person (g/d/p), which was weighted according to the number of families in each of the three types of occupations in Aomori Prefecture. There was no significant difference shown for occupation and area. The consumption rates of marine, agricultural and livestock products and other products were around 45, 388, 256 and 268 g/d/p, respectively. Families of fishery workers showed a higher consumption of marine products, and families of farmers showed a higher consumption of agricultural products. The average total daily food consumption of the age group around 1 year old was about 627 g/d/p. The consumption rates of marine, agricultural and livestock products and other products were around 26, 251, 201 and 150 g/d/p, respectively. Compared with individuals over 5 years old, food consumption of the age group around 4 years old was about one-half, and the age group around 1 year old was about one-third. Consumption rates of marine products and agricultural products were low, and livestock products and other products were high in infants. As the age group became lower, the ratio of the quantity of dairy products became higher. (author)

  1. Unravelling the importance of forest age stand and forest structure driving microbiological soil properties, enzymatic activities and soil nutrients content in Mediterranean Spanish black pine(Pinus nigra Ar. ssp. salzmannii) Forest.

    Lucas-Borja, M E; Hedo, J; Cerdá, A; Candel-Pérez, D; Viñegla, B

    2016-08-15

    This study aimed to investigate the effects that stand age and forest structure have on microbiological soil properties, enzymatic activities and nutrient content. Thirty forest compartments were randomly selected at the Palancares y Agregados managed forest area (Spain), supporting forest stands of five ages; from 100 to 80years old to compartments with trees that were 19-1years old. Forest area ranging from 80 to 120years old and without forest intervention was selected as the control. We measured different soil enzymatic activities, soil respiration and nutrient content (P, K, Na, Mg, Cr, Mn, Fe, Co, Ni, Cu, Zn, Pb and Ca) in the top cm of 10 mineral soils in each compartment. Results showed that the lowest forest stand age and the forest structure created by management presented lower values of organic matter, soil moisture, water holding capacity and litterfall and higher values of C/N ratio in comparison with the highest forest stand age and the related forest structure, which generated differences in soil respiration and soil enzyme activities. The forest structure created by no forest management (control plot) presented the highest enzymatic activities, soil respiration, NH4(+) and NO3(-). Results did not show a clear trend in nutrient content comparing all the experimental areas. Finally, the multivariate PCA analysis clearly clustered three differentiated groups: Control plot; from 100 to 40years old and from 39 to 1year old. Our results suggest that the control plot has better soil quality and that extreme forest stand ages (100-80 and 19-1years old) and the associated forest structure generates differences in soil parameters but not in soil nutrient content. PMID:27099995

  2. Potencialização do efeito antiinflamatório e antinociceptivo do diclofenaco e da nimesulida por vitaminas do complexo B

    L. A. Rodrigues

    2009-01-01

    Full Text Available

    Investigou-se os efeitos de algumas vitaminas B associadas ao diclofenaco ou nimesulida, na contorção abdominal em camundongos e edema de pata em ratos apenas com a nimesulida ou sua associação com algumas vitaminas B. Verificou-se que o pré-tratamento com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], isoladas ou administradas conjuntamente, não inibiu o edema de pata produzido pela carragenina em ratos, nem as contorções abdominais produzidas pelo ácido acético em camundongos. Por outro lado, a nimesulida [5mg/kg] reduziu o edema de pata em ratos, e a associação das três vitaminas à este fármaco, mas não as vitaminas administradas isoladamente, potencializou seus efeitos nos tempos de duas, três e quatro horas após a carragenina. As contorções abdominais em camundongos foram inibidas pelas doses de 25 ou 50mg/kg de diclofenaco. A associação das três vitaminas ou apenas da cianocobalamina, potencializou as duas doses do diclofenaco utilizadas. As contorções abdominais foram reduzidas também pelo nimesulida [5mg/kg] e a associação das três vitaminas, ou cada uma das vitaminas administradas isoladamente, foram capazes de potencializar os efeitos do nimesulida. É provável que a diferença no mecanismo de ação destes fármacos seja responsável pela diferença dos efeitos das vitaminas. O presente trabalho aponta para a realização de novos estudos com o uso destes antiinflamatórios, combinados com as vitaminas tiamina[B1], piridoxina[B6] e cianocobalamina [B12], em doenças inflamatórias crônicas, na tentativa de reduzir a dose destes fármacos e conseqüentemente diminuindo seus efeitos colaterais. Palavras-chave: diclofenaco; nimesulida; contorção abdominal; edema, cianocobalamina; tiamina.

  3. Effect of the activity of the Brazilian polyherbal formulation: Eucalyptus globulus Labill, Peltodon radicans Pohl and Schinus terebinthifolius Radd in inflammatory models

    Karina C.P. Medeiros

    2007-03-01

    Full Text Available The Brazilian polyherbal formulation (BPF is composed by dyes of Eucalyptus globulus Labill, Peltodon radicans Pohl and Schinus terebinthifolius Raddi in alcohol at 13.3° GL. The formulation is popularly used in Paraíba state, Brazil since 1889 and it is used as an antiseptic and anti-inflammatory medicine. The aim of this study was to evaluate the anti-inflammatory property of the polyherbal formulation. For this purpose it was used the12-O-tetradecanoylphorbol 13-acetate (TPA and capsaicin-induced mouse ear edema and the carrageenan-induced rat paw edema. The BPF at dose of 26 mL/Kg inhibited both 12-O-tetradecanoylphorbol 13-acetate (TPA and capsaicin-induced ear edema by 49% (p O medicamento fitoterápico brasileiro - BPF é composto de corantes das plantas Eucalyptus globulus Labill, Peltodon radicans Pohl e Schinus terebinthifolius Raddi em alcool a 13,3° GL. Este medicamento é popularmente usado no estado da Paraíba, Brasil desde 1889 como anti-séptico e antiinflamatório. O objetivo deste estudo foi avaliar a propriedade antiinflamatória deste medicamento fitoterápico. Para tal, foram utilizadas as técnicas de edema de orelha em camundongos induzido por 12-O-tetradecanoilforbol 13-acetato (TPA ou capsaicina e o edema de pata de rato induzido por carragenina. O BPF na dose de 26 mL/kg inibiu tanto edema de orelha induzido por TPA como por capsaicina a 49% (p < 0.05 e 24% (p < 0.01 respectivamente. Estudos preliminares utilizando a técnica de edema de pata induzido por carragenina demonstraram que a administração oral também inibiu o edema de pata em aproximadamente 29%. Os resultados demonstraram que o medicamento fitoterápico brasileiro (BPF apresentou propriedades antiinflamatórias e a melhor dose foi aquela que é usada pela população.

  4. Perfil dos pacientes atendidos na Clínica de Odontopediatria do Curso de Odontologia da ULBRA Canoas/RS

    Suzana Sommer; Ana Graciela Zuchetto de Barros; Gabriela Couto de Lima; Elizabete da Silva Viana; Paulo Floriani Kramer

    2008-01-01

    The objective of this present study was to characterize the patients profi le carried out in the clinical of Pediatric Dentistry from ULBRA Dental School. The manuals of 454 patients aged 3-12 years old attended during the fi rst semester of 2006, were analyzed. Demographical variations, social-economical, clinics and therapeutic data were collected and organized in a database for a describing statistical analysis. According to the data the mean of sample was age 8.1 years old. Haul of that, ...

  5. Brain CT scanning of children with purulent meningitis

    Nine of 21 children with purulent meningitis showed abnormal findings in brain CT when admitted. All of abnormal group were less than 12 months of age, but 75 % of normal group were after 1 year old. The period of positive CRP was longer and the level of sugar in CSF was lower in abnormal group when compared with normal group. Because convulsion and EEG abnormalities were observed similary in both groups, it may be hard to suggest the organic changes of brain by clinically. It will be better to perform brain CT scanning as soon as possible on the beginning of purulent meningitis. (author)

  6. Failure of peritoneal and gallbladder shunts in a child with craniopharyngioma

    Julie Woodfield

    2013-01-01

    Full Text Available A 1-year-old girl with craniopharyngioma required external drainage of 40-50 mL/h of cerebrospinal fluid (CSF after biopsy and cyst fenestration. She developed CSF ascites following insertion of a ventriculoperitoneal (VP shunt and a distended painful gallbladder following ventriculogallbladder shunt insertion. Revision to a ventriculoatrial shunt was required. This is the first time a craniopharyngioma has been reported to cause increased CSF production. The potential mechanisms of CSF overproduction and the difficulties managing the large volume of CSF in a young child are discussed.

  7. Brain stem hypoplasia associated with Cri-du-Chat syndrome

    Hong, Jin Ho; Lee, Ha Young; Lim, Myung Kwan; Kim, Mi Young; Kang, Young Hye; Lee, Kyung Hee; Cho, Soon Gu [Dept. of Radiology, Inha University Hospital, Inha University School of Medicine, Incheon (Korea, Republic of)

    2013-12-15

    Cri-du-Chat syndrome, also called the 5p-syndrome, is a rare genetic abnormality, and only few cases have been reported on its brain MRI findings. We describe the magnetic resonance imaging findings of a 1-year-old girl with Cri-du-Chat syndrome who showed brain stem hypoplasia, particularly in the pons, with normal cerebellum and diffuse hypoplasia of the cerebral hemispheres. We suggest that Cri-du-Chat syndrome chould be suspected in children with brain stem hypoplasia, particularly for those with high-pitched cries.

  8. Brain stem hypoplasia associated with Cri-du-Chat syndrome

    Cri-du-Chat syndrome, also called the 5p-syndrome, is a rare genetic abnormality, and only few cases have been reported on its brain MRI findings. We describe the magnetic resonance imaging findings of a 1-year-old girl with Cri-du-Chat syndrome who showed brain stem hypoplasia, particularly in the pons, with normal cerebellum and diffuse hypoplasia of the cerebral hemispheres. We suggest that Cri-du-Chat syndrome chould be suspected in children with brain stem hypoplasia, particularly for those with high-pitched cries.

  9. Composition and stability of coyote families and territories in North Dakota

    Allen, S.H.; Hastings, J.O.; Kohn, S.C.

    1987-01-01

    Coyote (Canis latrans) families studied in North Dakota during 1976 to 1978 contained three or more adults during the spring-summer season, and they occupied large contiguous, non-overlapping territories. Coyote territories averaged 61 km2 during the spring-summer season and 30 km2 during fall-winter season. Three of four families occupied territories that were similar in size for two consecutive years; however, boundaries changed within individual families when one or both alpha adults were killed. All coyotes replacing dead alpha adults were 1 year old.

  10. Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival

    Cheng Tan; Tatsuya Takayama; Naohisa Takaoka; Hiromi Fujita; Miki Miyazaki; Takayuki Sugiyama; Seiichiro Ozono

    2014-01-01

    OBJECTIVE To investigate the relationship between gender differences in fatty acid-binding protein7 (FABP7) and BRN2 (POU class 3 homeobox 2) expression in renal cell carcinoma (RCC) and the prognosis of patients with RCC. MATERIALS AND METHODS immunohistochemical (IHC) staining as well as reverse transcription-polymerase chain reaction (RT-PCR) was performed in renal tissues from 103 patients (83 men, mean age = 63.6 years old; 20 women, mean age = 63.1 years old) underwent radical nephrecto...

  11. Comparative studies on the growth of pinus brutia in pure and mixed plantations

    Hasan, S.M.; Al-Saraf, M.J.; Khalil, M.T.

    1980-01-01

    In trials in a semi-arid poor soil in Hammam Al-Alil, Mosul, Iraq, 2-year-old P. brutia transplants were planted in two blocks at 1x1 spacing. One block was interplanted with 1-year-old Acacia farnesiana. There was n.s.d. in growth of P. brutia between the 2 blocks at the end of the first or second year, but height growth in the mixed stand was significantly greater than in the pure stand after 3 growing seasons. (Refs. 10).

  12. Ecological aspects of cattle tick control in central Zambia.

    Pegram, R G; Lemche, J; Chizyuka, H G; Sutherst, R W; Floyd, R B; Kerr, J D; McCosker, P J

    1989-07-01

    In ecological studies in central Zambia, both climate and ecotype affected population dynamics of tick species. Below average rainfall for several years caused a suppression in numbers of Rhipicephalus appendiculatus Neumann adults. Reduction in rainfall leading to changes in grazing patterns is thought to have been responsible for an increase in numbers of Amblyomma variegatum Fabricius adults in a grassland habitat. There were reasonable correlations between numbers of each tick species on individual hosts over 1 year old. However, there were no relationships between numbers of ticks and bovine lymphocyte antigens (BoLA). PMID:2519677

  13. Two renal tumors in cottontail rabbits (Sylvilagus floridanus).

    Carlton, W W; Dietz, J M

    1977-01-01

    Renal tumors were found in two cottontail rabbits (Sylvilagus floridanus) about 1 year old. One tumor was intimately associated with the kidney and consisted of isolated ductular and tubular structures within an abundant connective tissue stroma and was diagnosed as a hamartoma of urogenital origin. The second was composed of epithelial cells arrange as alveolar structures with papillary projections, epithelium that was less differentiated into tubules and ducts, and neoplastic epithelial cells in solid sheets. The diagnosis of renal adenocarcinoma was based on the histologic features as metastasis had not occurred. PMID:850992

  14. Changes in astigmatism between the ages of 1 and 4 years: a longitudinal study.

    Abrahamsson, M; Fabian, G.; Sjöstrand, J

    1988-01-01

    Changes in astigmatism during development were studied in 299 infants with astigmatism as they grew from 1 to 4 years of age. All consecutive cases of 1-year-old infants with an astigmatism of 1.0 D or more in at least one eye found at an ophthalmic screening survey were selected for follow-up. The cycloplegic refraction was longitudinally followed at yearly intervals. During development there was no decrease in the degree of hypermetropia, but there was a significant decrease in the incidenc...

  15. Seasonal changes in the amount of carbohydrates and photosynthetic activity of Pinus pumila Regal on alpine in central Japan

    Kibe,Takeshi; Masuzawa, Takehiro

    1992-01-01

    Branches and needles of Pmus pumila REGEL were collected from a site in the Yatsugatake mountain range in central Japan They were divided into current, 1-year-old, 2-year-old and 3-year-old parts Then, soluble carbohydrate (total sugars and starch) included in each of them was analyzed by SOMOGYI-NELSON method Photosynthetic rate of needles was measured by an infrared CO_2 gas analyzer Total sugar contents of branches and needles showed high levels in the winter season, but starch content lev...

  16. A case of congenital hypothyroidism presented with dysmyelinization findings

    Sevil Ar Yuca; Cahide Ylmaz; Avni Kaya; Lokmanstyol; Ertan Sal; Yasar Cesur; Hseyin Caksen

    2014-01-01

    The central nervous system is one of the most crucial targeted systems of hyphotiroidism where tissues undergo various broad developmental processes such as neuronal and glial cellular differentiation, migration and myelinization.However brain images are mainly normal.In this article we present findings related to a1-year-old girl who has been referred to our outpatient clinic with complaints of slowing of movement and lack of interest.She was diagnosed with hypothyroidism.Her brain magnetic resonance image obtained during diagnosis displayed dysmyelinization.It showed improvement afterNa-L thyroxin therapy during follow up.

  17. Transgenic overexpression of ADAM12 suppresses muscle regeneration and aggravates dystrophy in aged mdx mice

    Jørgensen, Louise Helskov; Jensen, Charlotte Harken; Wewer, Ulla M;

    2007-01-01

    ADAM12 could be a candidate for nonreplacement gene therapy of Duchenne muscular dystrophy. We therefore evaluated the long-term effect of ADAM12 overexpression in muscle. Surprisingly, we observed loss of skeletal muscle and accelerated fibrosis and adipogenesis in 1-year-old mdx mice transgenically......Muscular dystrophies are characterized by insufficient restoration and gradual replacement of the skeletal muscle by fat and connective tissue. ADAM12 has previously been shown to alleviate the pathology of young dystrophin-deficient mdx mice, a model for Duchenne muscular dystrophy. The observed...... regeneration as a possible factor in development of muscular dystrophy....

  18. Evaluation of Mird and Marinelli formalisms in the radiation dosimetry for thyroid of adults and children using 131I (radioiodine)

    Using MIRD formalism and Cristy-Eckerman representation for the thyroid adults, children of 15, 10, 5, 1 year old and newborn it is shown that the total dose absorbed by the gland due to 131I(iodine) is its self-dose. Their results are not significantly different from those reported by the formalism MARINELLI (self-dose), which uses a sphere as glandular representation. Consequently, the kinetic model to the gland is a single compartment and the thyroid can be represented as a sphere

  19. Excretion of diazepam and its metabolites in human milk during withdrawal from combination high dose diazepam and oxazepam.

    Dusci, L J; Good, S M; Hall, R W; Ilett, K F

    1990-01-01

    The excretion of diazepam, N-desmethyldiazepam, temazepam and oxazepam in breast milk was studied during withdrawal of a 22-year-old patient from combined high dose diazepam and oxazepam therapy. Concentrations of these benzodiazepines in plasma from both the woman and her nursing infant (1 year old) were also documented. Diazepam, N-desmethyldiazepam, temazepam and oxazepam were found in the maternal plasma and milk with mean milk: plasma ratios of 0.2, 0.13, 0.14 and 0.10 respectively. It w...

  20. Some features of one-year-old tart Cherry shoots of cv. Sehattenmorelle

    Dariusz Świetlik; Kazimierz Słowik; Sebastian Rejman

    2013-01-01

    The purpose of this study was to obtain data on the relationship between the length of 1-year-old shoots and their fruiting, and both their terminal and lateral growtn produced in the current year. The measurements were taken in 1977 and 1979 from the tart cherry trees of cv. Schattenmorelle grafted of Prunus mahaleb L. or Prunus avium L. grown in loose sandy soil. In 1977 there were more shoots of over 30 cm than in 1979. The longer the shoots, the more lateral shoots were there. Only the sh...

  1. Some features of one-year-old tart Cherry shoots of cv. Sehattenmorelle

    Dariusz Świetlik

    2013-12-01

    Full Text Available The purpose of this study was to obtain data on the relationship between the length of 1-year-old shoots and their fruiting, and both their terminal and lateral growtn produced in the current year. The measurements were taken in 1977 and 1979 from the tart cherry trees of cv. Schattenmorelle grafted of Prunus mahaleb L. or Prunus avium L. grown in loose sandy soil. In 1977 there were more shoots of over 30 cm than in 1979. The longer the shoots, the more lateral shoots were there. Only the shortest shoots (1-10 cm bore more fruit per unit length as compared to the longer shoots.

  2. Disease: H00771 [KEGG MEDICUS

    Full Text Available gene) Catterall WA, Dib-Hajj S, Meisler MH, Pietrobon D Inherited neuronal ion channelopathies: new windows ...lalgia (IEM) is characterized by intense episodic burning pain associated with redness and warmth of the affected extremities and in... many instances occurs as an autosomal dominant trait. Symptoms of IEM can start as ...early as 1 year old (early-onset), or in adults (adult-onset), and both types have been described in... families and in sporadic cases. Pharmacotherapy has been largely ineffective, and partia

  3. Perineal Accessory Scrotum with Congenital Lipoma: A Rare Case Report

    Souvik Chatterjee

    2012-01-01

    Full Text Available A case of accessory scrotum in a 1-year-old boy is reported because of its rarity. A boy presented with a tumor mass attached with scrotum-like skin on its tip in the right side of perineum between the scrotum and anus. Both testes had descended into the scrotum. There was no other urological anomaly. Histological findings of the tumor indicated perineal lipoma, and the scrotum-like portion accessory scrotum. An overview of sequences during the normal development of male external genitalia has been provided and the deranged mechanism resulting in this anomaly has been reviewed with hypothesis regarding etiology of accessory scrotum.

  4. Plant species richness and floristic composition change along a rice-pasture sequence in subsistence farms of Brazilian Amazon, influence on the fallows biodiversity (Benfica, State of Para)

    Mitja, Danielle; Miranda, L. D. S.; Velasquez, Elena; Lavelle, Patrick

    2008-01-01

    Along the Amazonian pioneer front in the Brazilian state of Pari, smallholder farmers manually clear primary rain forest every year to grow rice prior to sowing pastures that they will use for 5-20 years. Species richness and floristic composition of the weedy species were studied in 20 plots along a farming succession, from rice fields, to 1-year-old, 4-8-year-old and over 10-year-old pastures planted to Brachiaria brizantha. In the early phases of the farming cycle reduction in the average ...

  5. Evaluation of Mird and Marinelli formalisms in the radiation dosimetry for thyroid of adults and children using {sup 131I} (radioiodine); Evaluacion de las dosimetrias Mird y de Marinelli en el estimado de dosis de radiacion para tiroides de adultos y ninos cuando se usa {sup 131}I (yoduro)

    Vasquez, A.M.; Rocha, J.J.; Castillo, D.C.; Gomez, M.A.; Mendoza, A.A.; Rabanal, M.J.; Cruz, S.J. [Universidad Nacional de Trujillo (UNT-UCV), Trujillo (Peru). Grupo de Fisica Medica

    2013-11-01

    Using MIRD formalism and Cristy-Eckerman representation for the thyroid adults, children of 15, 10, 5, 1 year old and newborn it is shown that the total dose absorbed by the gland due to {sup 131}I(iodine) is its self-dose. Their results are not significantly different from those reported by the formalism MARINELLI (self-dose), which uses a sphere as glandular representation. Consequently, the kinetic model to the gland is a single compartment and the thyroid can be represented as a sphere.

  6. Phenobarbitone induced drug reaction with eosinophilia and systemic symptoms (DRESS: a case report

    Navreet K. Natt

    2013-06-01

    Full Text Available Drug reaction with eosinophilia and systemic symptoms (DRESS is a life threatening cutaneous drug reaction with visceral involvement and hematological abnormalities. Being a rare side effect, it is often under-reported and misdiagnosed. The fatal adverse drug reaction is associated most commonly with aromatic anti-epileptics phenytoin, carbamazepine and less frequently with phenobarbitone. Here, we report a case of phenobarbitone induced DRESS in a 1 year old male child. He succumbed to fulminant hepatic failure inspite of being put on steroids, hepatoprotectives, antibiotics and ventilatory support. [Int J Basic Clin Pharmacol 2013; 2(3.000: 333-335

  7. Familial dysautonomy (Riley-Day syndrome

    Edward R. Tonholo Silva

    1994-03-01

    Full Text Available Familial dysautonomia, also known as Riley-Day syndrome, is a disorder of autonomic nervous system with an autosomal recessive mode of inheritance. Reduction and/or loss of unmyelinated and small myelinated fibers is found, as reduction of dopamine beta-hydroxylase in blood. The diagnosis is based on clinical features: diminished lacrimation, insensitivity to pain, poor temperature control, abolished deep tendon reflexes, postural hypotension, vomiting attacks, poor motor coordenation, and mental retardation. The treatment is symptomatic and many children die during the first years of life, usually as a result of repeated aspiration pneumonia. We report the case of a 1 year-old child with familial dysautonomia.

  8. 99mTc DTPA renogram indentifies Bochdalek hernia with an intra thoracic kidney as its content

    Padma, Subramanyam; Pande, Shantanu R.; Sundaram, Palaniswamy Shanmuga

    2014-01-01

    Congenital diaphragmatic hernia (CDH) is a rare anomaly with reported incidence of 1 in 16,000 and is associated with herniation of stomach, intestinal loops, spleen, and kidney through a chest wall defect. We report a case of 1-year-old male child with history of recurrent fever and non-visualization of left kidney on ultrasonogram. Patient was referred to us to look for ectopic left kidney.99mTc-diethylenetriaminepentaacetic acid renogram was performed. An ectopically placed intrathoracic l...

  9. First Case Report of Canthariasis in an Infant Caused by the Larvae of Lasioderma serricorne (Coleoptera: Anobiidae)

    Mokhtar, Aida Syafinaz; Sridhar, Ganiga Srinivasaiah; Mahmud, Rohela; Jeffery, John; Lau, Yee Ling; Wilson, John-James; Abdul-Aziz, Noraishah Mydin

    2016-01-01

    We report an unusual cause of gastrointestinal infection occurring in a 1-year-old infant patient who was brought to a public hospital in Kuala Lumpur, Malaysia. Larvae passed out in the patient’s feces were confirmed by DNA barcoding as belonging to the species, Lasioderma serricorne (F.), known as the cigarette beetle. We postulate that the larvae were acquired from contaminated food and were responsible for gastrointestinal symptoms in the patient. To our knowledge, this the first report of human canthariasis caused by larvae of L. serricorne. PMID:27208008

  10. Neurological morbidity in vaccine-associated paralytic poliomyelitis in Brazil from 1989 up to 1995 Morbidade neurológica em poliomielite paralítica pós vacinal no Brasil de 1989 a 1995

    Elza Dias-Tosta; Carlos Santos Kückelhaus

    2004-01-01

    We collected 30 cases of vaccine associated paralytic poliomyelitis (VAPP) from 4081 cases of acute flaccid palsies cases notified from 1989 to 1995 to the Brazilian Ministry of Health. There were 30 VAPP cases with 56% of children younger than 1 year old, 56.7% of female. 46% of cases were reported in the Northeast. Ten P2 vaccine virus, 8 P3 and 2 P1 and associations amongst them were isolated. The clinical pattern in 60 days was: monoplegia (16), paraplegia (6), tetraplegia (5), hemiplegia...

  11. Development of Duchenne-type cardiomyopathy. Morphologic studies in a canine model.

    Valentine, B A; Cummings, J. F.; Cooper, B. J.

    1989-01-01

    The development of cardiac lesions was studied in xmd dogs aged from 1 day to 6 years. Cardiac lesions were not present in dystrophic dogs up to 3 months of age. Foci of mineralization were first seen at 6.5 months. A 1-year-old dog had foci of myocyte hypercontraction. Linear and anastomosing fibrosis was present in all dogs 1 year of age or older, most prominently and most consistently within the subepicardial region of the left ventricular (LV) free wall, the LV papillary muscles, and the ...

  12. The arbuscular mycorrhizal status of poplar clones selected for phytoremediation of soils contaminated with heavy metals

    Takacs, T.; Radimszky, L.; Nemeth, T. [Research Inst. for Soil Science and Agricultural Chemistry of the Hungarian Academy of Sciences, Budapest (Hungary)

    2005-04-01

    The aim of this work was to study the colonization of indigenous arbuscular mycorrhizal fungi (AMF) species in fine-roots of poplar clones. Roots of 7 poplar clones were sampled from a 1-year-old trial established at an industrial site strongly polluted with heavy metals at Balatonfuezfoe, Hungary. The poplar clones have shown variable degrees of colonization by AMF, suggesting differential host susceptibility or mycorrhizal dependency. After outplanting the percentage of poplar survival was strongly correlated with the frequency of AMF infection. Two clones that survived at the lowest ratio after outplanting had not been colonized by AMF in contrast to those which survived to a much higher extent. (orig.)

  13. Pelizaeus Merzbacher Disease: the First Genetically Approved Case Report from Iran

    Mahmoud-Reza Ashrafi

    2011-09-01

    Full Text Available Background:Classic Pelizaeus-Merzbacher disease is a rare x-linked disorder of proteolipid protein expression first described clinically in 1885. This disease is characterized by abnormal eye movements, very slow motor development and involuntary movements. The causative gene is PLP1. Case Presentation:A 1-year-old boy was referred to our clinic due to abnormal eye movements. He had horizontal and flickering eye oscillation, psychomotor retardation, hypotonia and head nodding. We found hypomyelination in brain MRI.Conclusion:The possibility of Pelizaeus-Merzbacher disease should be considered in boys with abnormal eye movements, psychomotor retardation and hypotonia.

  14. Pelizaeus–Merzbacher Disease: The First Genetically Approved Case Report from Iran

    Hooman Alizadeh

    2011-09-01

    Full Text Available Background:Classic Pelizaeus-Merzbacher disease is a rare x-linked disorder of proteolipid protein expression first described clinically in 1885. This disease is characterized by abnormal eye movements, very slow motor development and involuntary movements. The causative gene is PLP1. Case Presentation:A 1-year-old boy was referred to our clinic due to abnormal eye movements. He had horizontal and flickering eye oscillation, psychomotor retardation, hypotonia and head nodding. We found hypomyelination in brain MRI. Conclusion:The possibility of Pelizaeus-Merzbacher disease should be considered in boys with abnormal eye movements, psychomotor retardation and hypotonia.

  15. Aneurysm of the superficial femoral artery in an infant

    An isolated arterial aneurysm in childhood is extremely rare. We report a 1-year-old girl with an aneurysm of the right superficial femoral artery, presenting as an asymptomatic mass of the thigh. The aneurysm involved the whole superficial femoral artery (9 cm in length), and surgical treatment would have required replacement of the affected artery. Conservative treatment was chosen, influenced by the patient's rapid growth at that time. Non-invasive, 3-D contrast-enhanced magnetic resonance angiography (MRA) was useful as an alternative to conventional angiography for detailed evaluation of the femoral arteries, including the aneurysm. (orig.)

  16. Vitamin D Status: A Different Story in the Very Young versus the Very Old Romanian Patients

    Chirita-Emandi, Adela; Socolov, Demetra; Haivas, Carmen; Calapiș, Anca; Gheorghiu, Cristina; PUIU, Maria

    2015-01-01

    Background In Romania (latitude 48°15’N to 43°40’N), vitamin D supplementation is common practice mostly in infants 0-1 year old. No published information is available regarding epidemiological data on vitamin D status in the Romanian population for a wide age range and geographical territory. In this context, we aimed to evaluate the seasonal and age variation of vitamin D status in a large Romanian population. Methods 6631 individuals from across Romania had performed 7544 vitamin D assessm...

  17. Productividad secundaria en los esteros de la barra de arena El Mogote en la Ensenada de La Paz, Baja California Sur, México Secondary productivity in the estuaries of El Mogote sand bar in Ensenada de La Paz, Baja California Sur, Mexico

    Jorge A. López-Rocha

    2012-04-01

    Full Text Available Los ecosistemas de manglar son un hábitat crítico para numerosas especies y su productividad es importante por su contribución de detritos orgánicos y su producción secundaria. El objetivo del trabajo fue definir indicadores de productividad secundaria para establecer una línea base que permita medir alteraciones en el sistema de manglar por posibles perturbaciones naturales o antropogénicas. Como indicadores se escogieron los moluscos bivalvos pata de mula, Anadara tuberculosa y el ostión de mangle, Crassostrea palmula. Se realizaron muestreos en tres esteros de agosto de 2007 a julio de 2009. Se estimó la abundancia y la producción secundaria con base en el incremento de biomasa. Para la estimación del incremento en peso se usaron las tasas de crecimiento individual obtenidas mediante un análisis de distribuciones de frecuencia de tallas. La abundancia promedio fue de 1.27 y 510 ind · m-2 de la pata de mula y ostión de mangle respectivamente. Se estimó una tasa de crecimiento de 4.91 mm · mes-1 (3.67 g · mes-1 para la pata de mula y de 3.80 mm · mes-1 (0.18 g · mes-1 para el ostión de mangle. La producción secundaria promedio de pata de mula fue de 4.51 g · m-2 · mes-1 y fue mayor durante la primavera, mientras que para el ostión de mangle fue de 97.9 g · m-2 · mes-1, registrándose la máxima producción durante el verano. Los resultados obtenidos demuestran que estos indicadores de calidad del bentos son adecuados para medir alteraciones al sistema de manglar de la Ensenada de La Paz, B. C. S., México.Mangrove ecosystems are critical habitats for many species, and their productivity is important because of their contribution of organic detritus and secondary production. The objective of this study was to identify suitable indicators of secondary productivity of mangrove systems, in order to establish a baseline for measuring changes in the mangrove system due to natural or anthropogenic potential disturbances. The

  18. : ESSAI D'INTERPRETATION

    Chamoux, Marie Noëlle

    2006-01-01

    Este capítulo presenta, a partir del léxico y de textos en náhuatl del siglo XVI, las formas que usaban los aztecas pata expresar los conocimientos técnicos, la pericia, la enseñanza y el aprendizaje. Subrayaban la habilidad para planificar y anticipar la acción técnica. Daban criterios de lo "bello" y de lo "bien hecho". En sus discursos, daban relieve a los aspectos cognitivos y psicológicos, más que a lo manual, y insistían en las cualidades éticas. Ce chapitre présente, à partir du lex...

  19. Efeito analgésico de longa duração da dipirona sobre a hiperalgesia persistente induzida pela constrição do nervo ciático em ratos: participação do óxido nítrico Long term analgesic effect of dipyrone on the persistent hyperalgesia induced by chronic constriction injury of sciatic nerve in rats: involviment of nitric oxide

    Fábio José Reis; Noeli Pereira Rocha

    2006-01-01

    O efeito analgésico de longa duração da dipirona foi avaliado em um modelo de dor neuropática assim como a participação da via óxido nítrico-GMPc neste mecanismo analgésico. Uma única administração intraplantar de dipirona (80 µg), no 14º dia após a instalação da hiperalgesia neuropática induzida pela constrição do nervo ciático exerceu um efeito analgésico, significativo e de longa duração. A inibição da óxido nítrico sintetase com L-NAME (50 ou 100 µg/pata), ou do óxido nítrico (NO) endógen...

  20. Baja Andesia: sed y poéticas tramontinas. Un desvío etnográfico a mano alzada

    Pedro Araya

    2007-07-01

    Full Text Available Si yo fuese dromedario no tendría sed. ¿Qué hora es ?Vicente Huidobro1.El antropólogo-poeta-ponencista despierta luego de un sueño intranquilo. Tiene sed. Algo recuerda. Un escozor, dice, un poco antes, en la misma, como de ron, como de vino y el fumadero de las caras ; como si, apenas, algo de lo exagerado de una opinión, entre una cosa y la otra, hubiera olvidado. Sabe que debe hablar aquella misma mañana. Sabe. La pata de los caballos, piensa. La tribu estará reunida. No la suya. No se sus...

  1. Assessing locomotion deficiency in broiler chicken Medida de deficiência locomotora em frango de corte

    Irenilza de Alencar Nääs

    2010-04-01

    Full Text Available Locomotion deficiencies in broiler production cause poor welfare and lead to change in drinking and feeding behavior with consequent loss in weight gain. This research aimed to assess locomotion deficiencies in broiler chicken by analyzing the vertical peak force on both feet during walk. A chamber was built with an inlet ramp, a horizontal walkway in the middle and an outlet ramp. In the walkway a thin mat with piezoelectric crystal sensors was placed to record the step vertical peak force of the feet while walking on the force platform. The measurement system consisted of a mat with electronic sensors and software that allowed real time recording of the forces and the processing and analysis of data. Footage was taken from two digital video cameras and used for gait scoring. Forty male broilers were chosen at random, grown under similar rearing conditions and farms, with age varying from 49 to 28 days (ten birds of same age to be used in the trial. Measurement consisted of inducing the bird to walk on the force platform which automatically registered the peak vertical force of the steps. Results showed that the gait score increased with the weight and age of the birds. Peak force asymmetry was found for each foot, independent of age or gait score. Although not identified visually in the broilers, the peak vertical force values differed in both right and left feet leading to slow and uneven walking. Walking deficiency was more severe in older birds.Deficiência em locomoção é hoje um dos problemas mais importantes na produção de frangos de corte. É causa de baixo bem-estar e leva a alteração no comportamento de bebida e alimentação, com conseqüente perda de ganho de peso. Mediram-se deficiências locomotoras em frango de corte por meio da análise do pico de força plantar vertical em ambas as patas, durante a caminhada. Foi construída uma câmara com uma rampa de entrada, uma área horizontal de passagem e uma rampa de saída. Na

  2. Crítica de Libros.

    Fernando Colina Pérez

    1981-01-01

    Full Text Available

    PRESENTACION y ENSEÑANZAS DE SCHREBER, Daniel Paul Schreber -«Memorias de un Neurópata» -Ediciones Petrel. Buenos Aires -1978

    LA TEORIA COMO FICCION, Maud Mannoni -Editorial Crítica -1980

    MAS ALLA DE LA SOCIOLOGIA: EL GRUPO DE DISCUSION: TEORIA y CRITICA, Jesús Ibáñez -Ed. Siglo XXI -Madrid, 1979.

    LA SEXUALIDAD -Jean Laplanche

    EL ORDEN PSIQUIATRICO -Robert Castel -Ediciones La Piqueta. Madrid, 1980 -Colección «La Genealogía del Poder», dirigida por Julia Varela y Fernando Alvarez Uría

  3. El Sulfato de Magnesio prepinzamiento aórtico como preservador energético en cirugía cardíaca

    Santos Gracia, José Juan

    2003-01-01

    Hay evidencia de un déficit crónico de magnesio en la población mundial atribuido a ingestión deficitaria. En los cardiópatas, la utilización de drogas depletoras agrava este déficit y contribuye a la aparición de arritmias malignas. El magnesio ha sido recomendado en el tratamiento del Infarto Agudo del Miocardio por preservar la energía de la célula cardíaca isquémica o reperfundida desde la era “pretrombolítica” y en todas las variantes de arritmias. Sin embargo, su utilización en cardioci...

  4. Relation between phylogeny of African green monkey CD4 genes and their respective simian immunodeficiency virus genes

    Fomsgaard, Anders; Müller-Trutwin, Michaela C.; Diop, Ousmane;

    1997-01-01

    An apparent species-specific relatedness of SIVagm suggests a coevolution with their natural hosts. However, the exact species or subspecies classification of African green monkeys, AGM, is uncertain because current classification schemes rely on phenotype markers, while more definitive genetic...... data are lacking. In this study, the CD4 protein involved in tissue type recognition was gentically cloned and sequence from PBMC RNA from all AGM species, including Barbados green monkeys (BGM). Phylogenetic trees were constructed that also included genomic CD4 nucleotide sequences from patas, sooty......, tantalus, vervets, grivets, and sabaeus formed separate subgroups with BGM grouping closely with vervets. The branching order of the AGM species was related to that of their respective SIVagm env sequences. The study suggests a strong correlation between CD4 phylogeny and the susceptibility of the host...

  5. Propriedades farmacológicas do extrato etanólico de Eremanthus erythropappus (DC. McLeisch (Asteraceae Pharmacological properties of the ethanol extract from Eremanthus erythropappus (DC. McLeisch (Asteraceae

    Marcelo S. Silvério

    2008-09-01

    Full Text Available O presente trabalho investigou as propriedades antinociceptiva, antiinflamatória e antiulcerogênica do extrato etanólico dos galhos de E. erythropappus. Foram realizados os testes de contorções abdominais induzidas por ácido acético; tempo da lambida da pata induzida por formalina; placa quente; edema de pata induzido por carragenina; lesões ulcerativas induzidas por indometacina e etanol. As doses de 50, 100 e 200 mg/kg inibiram as contorções em 43,07%, 69,34% e 70,07%, respectivamente. O tempo da lambida da pata foi reduzido em ambas as fases nas doses testadas, enquanto o tempo de latência da placa quente teve efeito significativo na dose de 200 mg/kg. O edema de pata foi reduzido em 23,81% (100 mg/kg e 47,62% (200 mg/kg. O índice ulcerativo das lesões induzidas por indometacina foi reduzido na dose de 100 mg/kg e 200 mg/kg, enquanto a dose de 200 mg/kg teve efeito significativo sobre o volume e o pH do suco gástrico. O índice ulcerativo e o volume do suco gástrico, induzidos por etanol, foram reduzidos na dose de 200 mg/kg, enquanto o pH do suco gástrico aumentou nas doses de 100 e 200 mg/kg. Os resultados indicam que o extrato etanólico de E. erythropappus avaliado pode constituir alvo potencial para uso em terapias da dor, da inflamação e de úlcera.The present work investigated the antinociceptive, anti-inflammatory and antiulcerogenic activities of Eremanthus erythropappus ethanol extract. The tests were carried out by acetic acid writhing, paw licking induced by formalin, hot plate, indomethacin- and ethanol-induced ulcer. The doses of 50, 100 and 200 mg/kg inhibited the contortions in 43.07, 69.34 and 70.07%, respectively. Both phases of paw lick were reduced at the tested doses, while reaction time at hot plate had significant effect at 200 mg/kg. The paw edema was decreased in 23.81% (100 mg/kg and 47.62% (200 mg/kg. The index of ulceration induced by indomethacin was reduced at the doses of 100 and 200 mg

  6. Órdenes de no reanimar y cuidados paliativos en pacientes fallecidos en un servicio de cardiología : ¿Qué podemos mejorar?

    Martínez Sellés Oliveria Soares, Manuel

    2010-01-01

    Con el objetivo de evaluar el uso de órdenes de no reanimar y de cuidados paliativos en cardiópatas, registramos 198 muertes consecutivas en nuestro servicio. En 113 (57%) se decidió no reanimar, se reflejó en la historia clínica en 102 (90,3%) y en 74 (65,5%) en las hojas de enfermería. Se informó a 5 pacientes (4,4%) y a 95 familias (84,1%). El uso de medidas paliativas fue escaso en pacientes no reanimables, 56 (49,6%) recibieron cloruro mórfico y 5 (4,4%), asistencia espiritual. Sin embar...

  7. Beklemishevia hispaniola n. sp., nuevo representante de la Cohorte Palaeosomata (Acari, Oribatei en España

    Pérez-Iñigo, C.

    1996-12-01

    Full Text Available A new species of oribatid mite (Acari, Oribatei belonging to the family Ctenacaridae (Cohors Palaeosomata is described; this species was recorded several times in Spain as Beklemishevia galeodula Zachvatkin, 1945. The new species is easily distinguishable from the mentioned one because of the presence of three claws in every leg, a noticeable pigidial neotrichy and the absence of short, almost spiniform, setae on the pygidium.Se describe una nueva especie de oribátido (Acari, Oribatei perteneciente a la familia Ctenacaridae (Cohorte Palaeosomata que habia sido citada varias veces en España como Beklemishevia galeodula Zachvatkin, 1945, y de la que se diferencia por presentar tres uñas en todas las patas, una acentuada neotriquia pigidial y carecer de setas cortas espiniformes en el pigidio.

  8. La globalización y su impacto en la economía de la educación en el sistema educativo público de Puerto Rico

    Pizarro Figueroa, J.

    2010-01-01

    Full Text Available En este mundo globalizado la educación se constituye en un factor indispensable pata el crecimiento del ser humano y su sociedad. La educación es determinante para el crecimiento económico, social y ecológico de un país. En este ensayo presentamos un análisis sobre la economía de la educación. A tales fines, comenzaremos discutiendo el concepto de la globalización y sus características, tanto sus ventajas como desventajas. Posteriormente, analizaremos la economía de la educación en el Sistema Educativo Público del Estado Libre Asociado de Puerto Rico (territorio no incorporado de los Estados Unidos de América. Cómo la economía incide en la educación y viceversa. Finalmente, presentaremos las conclusiones producto de este ensayo.

  9. Estudo histológico e histoquímico da pele de jurará Kinosternon scorpioides scorpioides (Testudines: Kinosternidae)

    Ana L Abreu-Silva; José A. Silva; Katiene R.S. Souza; Débora M.S. Santos; José G. Pereira; Rafael C. Carvalho; Ambrosio, Carlos E; Miglino, Maria A

    2014-01-01

    O objetivo do presente trabalho foi analisar histológica e histo- químicamente a pele do jurará (Kinosternon scorpioides scorpioides). Foram utilizados seis animais (três machos e três fêmeas). Os animais foram eutanasiados com dose letal de tiopental sódico a 2,5%, para colheita de fragmentos de pele mole das patas e pescoço do animal, que após a fixação em líquido de Bouin, foram incluídos em parafina e corados pelas técnicas de hematoxilina-eosina, Giemsa, Sirius red, Reticulina de Gomori ...

  10. A relevância dos conteúdos petcare para os utilizadores nas plataformas digitais

    Carvalho, Marta Sofia Saldanha de

    2016-01-01

    A maioria dos lares portugueses já conta com a presença de animais de estimação, assistindo-se assim a uma maior consciencialização para cuidar e garantir qualidade de vida aos seus companheiros, na sua maioria de quatro patas. A consciencialização dos direitos dos animais, os novos hábitos e estilo de vida contribuíram para o aumento da adoção de animais domésticos, que hoje em dia já são considerados por muitos como membros da família. Esta dissertação de mestrado centra-se n...

  11. Cardiopatías y embarazo

    Francisco de Jesús Valladares Carvajal

    2011-01-01

    Full Text Available La cardiopatía es la causa más frecuente de muerte materna indirecta en el mundo. Es decir, la presencia de enfermedad cardíaca no excluye el embarazo, pero aumenta el riesgo para la madre y para el feto y requiere de un tratamiento especial. Los cambios hemodinámicos propios del embarazo pueden hacer sospechar la presencia de enfermedad cardíaca, por lo que es importante conocer los síntomas y signos indicadores de cardiopatía estructural en la mujer embarazada. La morbimortalidad materna dependerá del tipo de cardiopatía y de la capacidad funcional en el momento de la concepción. De otro lado las gestaciones en madres cardiópatas se han asociado también a mayor incidencia de problemas para el feto, y por tanto, de un aumento de la mortalidad perinatal.

  12. The Law of Large Numbers for the Free Multiplicative Convolution

    Haagerup, Uffe; Möller, Sören

    2013-01-01

    In classical probability the law of large numbers for the multiplicative convolution follows directly from the law for the additive convolution. In free probability this is not the case. The free additive law was proved by D. Voiculescu in 1986 for probability measures with bounded support and...... extended to all probability measures with first moment by J.M. Lindsay and V. Pata in 1997, while the free multiplicative law was proved only recently by G. Tucci in 2010. In this paper we extend Tucci’s result to measures with unbounded support while at the same time giving a more elementary proof for the...... case of bounded support. In contrast to the classical multiplicative convolution case, the limit measure for the free multiplicative law of large numbers is not a Dirac measure, unless the original measure is a Dirac measure. We also show that the mean value of lnx is additive with respect to the free...

  13. ‘COROJO 2006’: NUEVA VARIEDAD CUBANA DE TABACO NEGRO (Nicotiana tabacum L.

    Vivaldo García Morejón

    2013-01-01

    Full Text Available En la Estación Experimental del Tabaco, de San Juan y Martínez, Pinar del Río durante la campaña tabacalera 2001-2002, se realizó un cruzamiento sexual con el objetivo de obtener una variedad de tabaco negro con mayor rendimiento que la comercial ‘Criollo 98’, resistente al moho azul ( Peronospora hyocyami de Bary, a la pata prieta ( Phytophthora parasitica Dast. var . Nicotianae Breda de Haan, al virus del mosaico del tabaco (VMT y a la necrosis ambiental. Después de cinco generaciones de autofecundación y selección por el método genealógico se obtuvieron siete variedades resistentes. El cruce originó la nueva variedad `Corojo 2006 ́ que superó a la `Criollo 98 ́.

  14. Avaliação do efeito antiparasitário do omeprazol na prevenção do desenvolvimento de lesões cutâneas em hamsters infectados por Leishmania brasiliensis Evaluation of omeprazole's antiparasitary effect preventing the development of cutaneous lesions due to Leishmania brasiliensis in hamsters

    Hélio Amante Miot

    2005-12-01

    Full Text Available FUNDAMENTOS: A leishmaniose tegumentar americana permanece doença endêmica em diversas regiões brasileiras. A sobrevivência do parasita no interior dos macrófagos se deve, em parte, pela atividade de uma K+/H+-ATPase de membrana que pode ser inibida pelo omeprazol. OBJETIVOS: Avaliar a eficácia do omeprazol na prevenção do desenvolvimento de lesões de leishmaniose em hamsters. MÉTODOS: Empregaram-se 18 hamsters, divididos em três grupos: o grupo L recebeu apenas a inoculação de L. brasiliensis na pata anterior direita, o grupo O recebeu apenas doses diárias de 0,4mg de omeprazol subcutâneo, e o grupo L+O recebeu o inóculo de leishmanias e o tratamento com omeprazol desde o dia da inoculação. O estudo foi conduzido por 42 dias, realizaram-se medidas dos diâmetros das patas semanalmente, e, ao final do estudo, foram realizados esfregaços das lesões para verificação dos parasitas. RESULTADOS: Os hamsters dos grupos L e L+O desenvolveram lesões de leishmaniose tegumentar havendo ulceração em duas patas do grupo L e uma do grupo L+O. Ao final do estudo, a mobilidade e vitalidade no grupo L foram menores que em L+O, e estas menores que no grupo O. Os diâmetros das patas inoculadas nos grupos L e L+O foram significativamente maiores que no início do estudo (pBACKGROUND: Cutaneous leishmaniasis remains an endemic disease in several brazilian regions. The parasite’ survival in macrophages is due to a membrane K+/H+-ATPase that can be inhibited by omeprazole. OBJECTIVES: Evaluate omeprazole’s efficacy preventing the development of cutaneous leishmaniasis in hamsters. METHODS: Eighteen hamsters were divided in 3 groups: the L group received an inoculation of L. brasiliensis on right paw, the O group received daily 0,4mg omeprazole subcutaneously, and L+O group received both omeprazole and the inocule. The study was performed in 42 days, and the measurements of the diameter of paws were done weekly. At the end of the study

  15. Processing of Phonemic Consonant Length: Semantic and Fragment Priming Evidence from Bengali.

    Kotzor, Sandra; Wetterlin, Allison; Roberts, Adam C; Lahiri, Aditi

    2016-03-01

    Six cross-modal lexical decision tasks with priming probed listeners' processing of the geminate-singleton contrast in Bengali, where duration alone leads to phonemic contrast ([pata] 'leaf' vs. [pat:a] 'whereabouts'), in order to investigate the phonological representation of consonantal duration in the lexicon. Four form-priming experiments (auditory fragment primes and visual targets) were designed to investigate listeners' sensitivity to segments of conflicting duration. Each prime derived from a real word ([k(h)[symbol: see text]m]/[g(h)en:]) was matched with a mispronunciation of the opposite duration (*[k(h)[symbol: see text]m:]/*[g(h)en]) and both were used to prime the full words [k(h)[symbol: see text]ma] ('forgiveness') and [g(h)en:a] ('disgust') respectively. Although all fragments led to priming, the results showed an asymmetric pattern. The fragments of words with singletons mispronounced as geminates led to equal priming, while those with geminates mispronounced as singletons showed a difference. The priming effect of the real-word geminate fragment was significantly greater than that of its corresponding nonword singleton fragment. In two subsequent semantic priming tasks with full-word primes a stronger asymmetry was found: nonword geminates (*[k(h)[symbol: see text]m:a]) primed semantically related words ([marjona] 'forgiveness') but singleton nonword primes (*[ghena]) did not show priming. This overall asymmetry in the tolerance of geminate nonwords in place of singleton words is attributed to a representational mismatch and points towards a moraic representation of duration. While geminates require a mora which cannot be derived from singleton input, the additional information in geminate nonwords does not create a similar mismatch. PMID:27089807

  16. Differences in MRI findings between subgroups of recent-onset childhood arthritis

    Kirkhus, Eva [Oslo University Hospital, Rikshospitalet, Department of Radiology, Oslo (Norway); Flatoe, Berit; Smith, Hans-Joergen [Oslo University Hospital, Rikshospitalet and University of Oslo, Faculty of Medicine, Department of Radiology, Oslo (Norway); Riise, Oeystein [Oslo University Hospital, Rikshospitalet, Department of Pediatrics, Oslo (Norway); Reiseter, Tor [Oslo University Hospital, Ullevaal, Department of Radiology, Oslo (Norway)

    2011-04-15

    MRI is sensitive for joint inflammation, but its ability to separate subgroups of arthritis in children has been questioned. Infectious arthritis (IA), postinfectious arthritis (PA), transient arthritis (TA) and juvenile idiopathic arthritis (JIA) are subgroups that may need early, different treatment. To determine whether MRI findings differ in IA, PA/TA and JIA in recent-onset childhood arthritis. Fifty-nine children from a prospective study of incidence of arthritis (n = 216) were, based on clinical and biochemical criteria, examined by MRI. Joint fluid, synovium, bone marrow, soft tissue and cartilage were scored retrospectively and analysed by Pearson chi-square test and logistic regression analysis. Fifty-nine children had MRI of one station. IA was suggested by bone marrow oedema (OR 7.46, P = 0.011) and absence of T1-weighted and T2-weighted low signal intensity synovial tissue (OR 0.06, P = 0.015). Furthermore, soft-tissue oedema and reduced contrast enhancement in the epiphyses were more frequent in children with IA. JIA correlated positively with low signal intensity synovial tissue (OR 13.30, P < 0.001) and negatively with soft-tissue oedema (OR 0.20, P = 0.018). No significant positive determinants were found for PA/TA, but bone marrow oedema, soft-tissue oedema, irregular thickened synovium and low signal intensity synovial tissue was less frequent than in IA/JIA. In children with high clinical suspicion of recent onset arthritis, there was a significant difference in the distribution of specific MRI features among the diagnostic groups. (orig.)

  17. Differences in MRI findings between subgroups of recent-onset childhood arthritis

    MRI is sensitive for joint inflammation, but its ability to separate subgroups of arthritis in children has been questioned. Infectious arthritis (IA), postinfectious arthritis (PA), transient arthritis (TA) and juvenile idiopathic arthritis (JIA) are subgroups that may need early, different treatment. To determine whether MRI findings differ in IA, PA/TA and JIA in recent-onset childhood arthritis. Fifty-nine children from a prospective study of incidence of arthritis (n = 216) were, based on clinical and biochemical criteria, examined by MRI. Joint fluid, synovium, bone marrow, soft tissue and cartilage were scored retrospectively and analysed by Pearson chi-square test and logistic regression analysis. Fifty-nine children had MRI of one station. IA was suggested by bone marrow oedema (OR 7.46, P = 0.011) and absence of T1-weighted and T2-weighted low signal intensity synovial tissue (OR 0.06, P = 0.015). Furthermore, soft-tissue oedema and reduced contrast enhancement in the epiphyses were more frequent in children with IA. JIA correlated positively with low signal intensity synovial tissue (OR 13.30, P < 0.001) and negatively with soft-tissue oedema (OR 0.20, P = 0.018). No significant positive determinants were found for PA/TA, but bone marrow oedema, soft-tissue oedema, irregular thickened synovium and low signal intensity synovial tissue was less frequent than in IA/JIA. In children with high clinical suspicion of recent onset arthritis, there was a significant difference in the distribution of specific MRI features among the diagnostic groups. (orig.)

  18. Dinâmica espacial da clorose variegada dos citros em três regiões do Estado de São Paulo

    Laranjeira Francisco F

    2004-01-01

    Full Text Available A Clorose Variegada dos Citros (CVC tem sido considerada a mais importante doença citrícola no Brasil, mas diversos aspectos de sua epidemiologia ainda não são bem conhecidos. O presente trabalho objetivou estudar o arranjo espacial das plantas afetadas, visando caracterizar a dinâmica da doença em três regiões do Estado de São Paulo (Noroeste, Centro e Sul. Por meio de avaliação de sintomas visuais, foram mapeados, quinzenalmente, três talhões de laranja-doce (Citrus sinensis Pêra enxertada em limão Cravo (Citrus limonia, em três regiões do Estado de São Paulo, desde julho de 1998 até dezembro de 2000. Para o estudo da dinâmica espacial, foram aplicadas as seguintes análises: seqüências ordinárias; áreas isópatas; lei de Taylor modificada; índice de dispersão e análise de dinâmica e estrutura de focos. As seqüências ordinárias indicaram uma tendência à aleatoriedade na maioria das avaliações, indicando baixa transmissão a plantas imediatamente vizinhas. A análise de áreas isópatas mostrou pouca formação de focos compactos, numa tendência à uniformidade da incidência da CVC. As demais análises demonstraram pouca diferença no padrão espacial da doença entre as regiões, que pode ser considerado levemente agregado.

  19. Efeitos farmacológicos e toxicológicos do extrato de Posoqueria acutifolia Mart. (Rubiaceae em roedores

    O. V. SOUSA

    2009-01-01

    Full Text Available

    O presente trabalho investigou os efeitos farmacológicos e toxicológicos do extrato metanólico dos galhos de Posoqueria acutifolia. Foram realizados os testes de contorções abdominais, formalina, placa quente, edema de pata e pleurisia, bem como para a toxicidade aguda. As doses de 100, 200 e 400 mg/kg inibiram as contorções abdominais. No teste da formalina, a dose de 400 mg/kg reduziu o tempo de lambida da primeira fase, enquanto este efeito foi observado nas doses de 200 e 400 mg/kg sobre a segunda fase. O tempo de permanência sobre a placa quente aumentou na dose de 400 mg/kg, embora a dose de 200 mg/kg também tenha tido efeito significativo após 90 minutos de tratamento. Houve uma redução do edema de pata, do volume do exsudato e da migração leucocitária nas doses testadas. O extrato testado não foi tóxico nas doses avaliadas. Portanto, o extrato metanólico de P. acutifolia exibe efeitos analgésico e antiinflamatório, o que poderia estar relacionado a seu uso na medicina popular. Palavras-chave: Posoqueria acutifolia; Rubiaceae; efeito analgésico; efeito antiinflamatório; toxicidade aguda.

  20. Comportamiento reproductivo y mutilaciones en el cangrejo de las rocas Grapsus grapsus (Linnaeus, 1758 (Crustacea, Decapoda

    Leonardo Romero

    2013-06-01

    Full Text Available El presente trabajo analiza información de las mudas y observaciones del comportamiento reproductivo de G. grapsus, relacionando las frecuencias de mutilaciones y el comportamiento caní- bal observado en las cópulas. Las colectas de mudas y observaciones sobre las cópulas se llevaron a cabo entre diciembre de 1990 y diciembre de 2001, en 200 m de una orilla rocosa al sur de la Bahía de Ancón, Lima, Perú. G. grapsus vive en grupos de número variable y asociados a grietas donde los individuos buscan refugio. El comportamiento de cortejo observado fue el de "búsqueda-intercepción" he incluyó diferencias como la defensa de territorios no temporales, largas persecusiones e intercepción por varios machos. Un total de 312 cópulas fueron observadas siendo más frecuentes durante el verano. Un total de once intentos de cópula produjeron la muerte de los individuos, siete fueron machos. En todo el periodo de estudio se colectaron un total de 8421 mudas de las cuales 418 presentaban mutilaciones o heridas en el cefalotórax o abdomen. No se observan diferencias significativas entre las tallas de mutilados de ambos sexos. El 73% de las mudas mutiladas presentan una sola mutilación, el 20% presentan dos mutilaciones y el 6% tres; se encontraron mudas hasta con siete apéndices mutilados. Las frecuencias de mutilaciones son significativamente mayores en machos. Las mutilaciones de las quelas y la segunda pata caminadora son más frecuentes en machos, mientras que en las hembras las mutilaciones de la cuarta y tercera pata caminadora son más frecuentes. Se propone que las mutilaciones se producen durante los intentos de cópula, principalmente por diferencias entre el tamaño de los individuos.

  1. Larval Pacific herring, Clupea pallasii (Valenciennes), are highly susceptible to viral haemorrhagic septicaemia and survivors are partially protected after their metamorphosis to juveniles

    Hershberger, P.K.; Gregg, J.; Pacheco, C.; Winton, J.; Richard, J.; Traxler, G.

    2007-01-01

    Pacific herring were susceptible to waterborne challenge with viral haemorrhagic septicaemia virus (VHSV) throughout their early life history stages, with significantly greater cumulative mortalities occurring among VHSV-exposed groups of 9-, 44-, 54- and 76-day-old larvae than among respective control groups. Similarly, among 89-day-1-year-old and 1+year old post-metamorphosed juveniles, cumulative mortality was significantly greater in VHSV-challenged groups than in respective control groups. Larval exposure to VHSV conferred partial protection to the survivors after their metamorphosis to juveniles as shown by significantly less cumulative mortalities among juvenile groups that survived a VHS epidemic as larvae than among groups that were previously nai??ve to VHSV. Magnitude of the protection, measured as relative per cent survival, was a direct function of larval age at first exposure and was probably a reflection of gradual developmental onset of immunocompetence. These results indicate the potential for easily overlooked VHS epizootics among wild larvae in regions where the virus is endemic and emphasize the importance of early life history stages of marine fish in influencing the ecological disease processes. ?? 2007 The Authors.

  2. Consumers’ perception and knowledge of food safety: results of questionnaires accessible on IZSalimenTO website

    Amaranta Traversa

    2015-04-01

    Full Text Available The present survey was undertaken to investigate consumers’ knowledge of the main foodborne agents and dietary regimen during pregnancy. Data were collected using monthly questionnaires available on IZSalimenTO website between March 2013 and January 2014. Hepatitis A virus questionnaire: 20 respondents (77% recognized berries as foodstuff linked to the outbreak of hepatitis A. The majority correctly indicated as precautionary advice to boil berries before consumption. Botulism questionnaire: 29 respondents (62% indicated pesto as food involved in botulism alert in July 2013. The risk of infant botulism in infant less than 1 year old due to honey consumption is known by 24 respondents (51%. Main foodborne disease questionnaire: the risk of infection by Salmonella after the consumption of foods made with raw eggs is known by the majority (94%; N=17 as well as the treatments to be applied in order to make fresh fish safe from parasites (76%. Pregnancy questionnaire: 20 respondents (74% believed that washing vegetables and fruits with sodium bicarbonate or chlorate solution is able to inactivate Toxoplasma; only 4 (15% reported both raw meat and vegetables washed with sodium bicarbonate as food at risk. Results indicate that all consumers should be trained on behaviour and dietary regimen to be adopted in pregnancy and in infant <1 year old. The website may be considered as a useful tool to assess consumers’ knowledge: both the news section and the contents published may be a source of information and education for consumers on food safety.

  3. Epidemiological study of non-systemic parasitism in dogs in southeast Mediterranean Spain assessed by coprological and post-mortem examination.

    Martínez-Carrasco, C; Berriatua, E; Garijo, M; Martínez, J; Alonso, F D; de Ybáñez, R Ruiz

    2007-01-01

    The prevalence and risk factors of non-systemic canine ecto- and endoparasitism and anthelminthic use in Murcia located at the centre of the Spanish Mediterranean coastal arch, was investigated by coprology and necropsy in up to 275 pet, city shelter and stray dogs in 2001-2004. Faecal parasite stages were detected in 25% of dogs. Species frequency was 6-10% for Toxocara canis, Ancylostomatidae spp., Toxascaris leonina and Isospora canis, and 0.4-1% for Trichuris vulpis, Giardia lamblia, and Dipylidium caninum. Logistic regression indicated that the risk of intestinal parasitism was highest for dogs 1 year old, in the middle to low weight range and kept at the city shelter. Although risk factors varied according to the species, T. canis was most common in <1 year old and Ancylostomatidae spp. was more prevalent in older dogs. This suggests that the dominant species was Uncinaria spp. and not the more zoonotically important Ancylostoma spp. This was further supported by necropsy findings; however, the degree of agreement between post-mortem and coprological examination for intestinal parasites was generally poor. Necropsy revealed 10%G. lamblia, 12%Taenia spp. 38%D. caninum infections. Fleas, ticks and lice were also found in 38%, 6% and 2% of necropsied stray dogs. These results demonstrate the need for an urgent parasite control programme at the city dog shelter and the need to improve the owner's education on zoonotic risks, the proper use of anthelminthics, and other parasite control practices. PMID:17542962

  4. Prevalence of Giardia intestinalis and other zoonotic intestinal parasites in private household dogs of the Hachinohe area in Aomori prefecture, Japan in 1997, 2002 and 2007.

    Itoh, Naoyuki; Kanai, Kazutaka; Hori, Yasutomo; Hoshi, Fumio; Higuchi, Seiichi

    2009-12-01

    An epidemiological study on canine intestinal parasites was undertaken to evaluate changes in the prevalence among private household dogs from the Hachinohe region of Aomori prefecture, Japan, in 1997, 2002 and 2007, using the formalin-ethyl acetate sedimentation technique. The risk of zoonotic transmission from household dogs to humans was also discussed. All intestinal parasites detected in the present study (Giardia intestinalis, Isospora spp., Toxocara canis, Ancylostoma caninum, Trichuris vulpis and Strongyloides stercoralis) showed no changes in prevalence over the past 10 years based on analysis considering canine epidemiological profiles. In particular, prevalence of Giardia intestinalis in dogs under 1 year old, derived from pet shops/breeding kennels and kept indoors was unchanged, remaining at a high level of >15.0% at each time point. Toxocara canis also showed no changes in the group of dogs under 1 year old, bred by private owners and kept outdoors, and the prevalence was >10.0% every year. The present results indicate that the prevalence of Giardia intestinalis and other intestinal parasites in private household dogs has not always decreased, and the potential for direct parasitic zoonotic transmission from dogs to humans may be relatively high level, than from the environment (indoors and outdoors). We recommend careful surveillance of intestinal parasites and aggressive use of anthelminthic in private household dogs under considering the epidemiological factors. PMID:19934595

  5. The essential oil qualitative and quantitative composition in the needles of Pinus sylvestris L. growing along industrial transects

    The aim of this study was to evaluate composition of the essential oils in the needles of Pinus sylvestris growing in the areas affected by a cement factory (CF), and an oil refinery (OR). Volatile components of the needles were analyzed by GC and GC/MS. The most heavily polluted CF stand had significantly higher concentration of γ-Terpinene, Caryophyllene oxide in the current-year needles, while higher concentration of δ-3-Carene, α-Terpinene, γ-Terpinene and Terpinolene was documented for 1-year-old needles. The most heavily polluted OR stand had a significantly higher concentration of Sabinene + β-Pinene, 1-epi-Cubenol in the current-year needles and a significantly higher concentration of Camphene, Sabinene + β-Pinene, Myrcene, α-Cadinene, 1-epi-Cubenol in the 1-year-old needles than the least polluted site. Along transects an increase in the amount of some diterpenes and a decrease in the components of the shorter chain essential oils was observed. These effects could be at least partially attributed to SO2. - Quantities of components of essential oil in the needles of Scots pine growing around two factories are described in relation to pollution

  6. PMCV and PRV occurrence in wild and farmed fish in Denmark

    Mikkelsen, Susie Sommer; Arnö, J.; Bruun, Morten Sichlau

    family of Reoviridae, while Piscine myocarditis virus (PMCV) is a double-stranded RNA virus of the Totiviridae family. Wild and farmed salmon and trout have not been tested for PRV or PMCV in Denmark before, but both viruses are found in Norway, where they are suspected of causing Heart and Skeletal......Every year salmon are restocked in the 7 rivers Storå, Skjern Å, Varde Å, Sneum Å, Kongeå, Ribe Å and Gudenåen. Six-month-old and 1-year-old salmon for about 2 mio. Kr (€268000) are restocked every year. The salmon are restocked in both the main rivers as well as the larger inlets. 6-month......-old salmon are restocked in smaller rivers where the spawning and growth is ideal. They are released from a boat drifting downstream between September and October. 1-year-old smolt are restocked in a few places in the main rivers in April. They are restocked in large numbers to provide better protection...

  7. Uptake and translocation of 54Mn and 65Zn applied on foliage and bark surfaces on balsam fir (Abies balsamea (L.) Mill.) seedlings

    Uptake and translocation of 54Mn and 65Zn in balsam fir [Abies balsamea (L.) Mill.] seedlings were studied with the radioisotopes applied directly on shoot or main-stem surfaces in a growth chamber. Concentration and distribution of the absorbed radioisotopes in different plant parts depended on distances between source (the application site) and sink (the rest of the seedling), as well as on tissue growth activity. Acidic wetness significantly enhanced radioisotope absorption. 54Mn and 65Zn were found to be concentrated primarily in 1-year old needles at the middle and top levels of the seedling crown. There were significant (P < 0.05) differences in accumulation (Bq g−1) between 54Mn and 65Zn in needles and twigs from foliar uptake. The absorption by seedlings (including the washed application shoot) 70 days after application was 24–32% of the remaining activities for 54Mn and 25–30% for 65Zn. Less than 1% of the absorbed isotopes was translocated from the bark application sites to other plant organs, whereas more than 54% of the activity absorbed at 1-year old shoots moved to the rest of the seedling. (author)

  8. Hepatopatía crónica asociada a fibrosis quística: gasto energético en reposo, factores de riesgo y repercusión en la evolución de la enfermedad Chronic liver disease associated with cystic fibrosis: energy expended at rest, risk factors and impact on the disease's progress

    S. Tabernero da Veiga

    2004-02-01

    Full Text Available Introducción y objetivos: La fibrosis quística es la enfermedad recesiva más frecuente. Existen diferentes alteraciones hepatobiliares; la más importante es el desarrollo de obstrucción biliar y fibrosis periportal. El objetivo es valorar la influencia de la hepatopatía en el estado nutricional, la evolución de la enfermedad y los factores de riesgo asociados. Ámbito: Unidad de Nutrición del Servicio de Gastroenterología del Hospital Infantil La Paz. Material y métodos: Estudio longitudinal prospectivo con 53 pacientes valorados en tres momentos durante 3 años; al inicio, al año y a los 3 años. Solo 37 se siguieron los 3 años. Se realizan 111 mediciones que incluyen: análisis de la composición corporal, del gasto energético, de la ingesta y de las pérdidas energéticas así como balance nitrogenado. Simultáneamente se realizan pruebas de función respiratoria y se valora la presencia de reagudización respiratoria. Resultados: 37 pacientes, 19 mujeres y 18 varones (edad media 13,04 años ± 3,28. Doce (32,43% fueron diagnosticados de hepatopatía (edad media 12,16 años ± 3,86 DS, 11 varones, 1 mujer de los cuales 1 presentó íleo meconial, 5 eran homocigotos, 5 heterocigotos y los 2 restantes presentaban otras mutaciones. Los hepatópatas presentan parámetros antropométricos mejores o similares que los pacientes sin hepatopatía (p NS. Media del índice de Waterlow en hepatópatas: 93,62% ± 7,87 DS; no hepatópatas: 93,06% ± 10,97 DS (p NS. Media de FEV1 en hepatópatas: 88,81 ± 27,32 DS; no hepatópatas: 75,21 ± 27,92 DS (p Introduction and goals: Cystic fibrosis is the most frequent recessive disease. There are various hepato-biliary alterations, of which the most important is the development of biliary obstruction and periportal fibrosis. The goal is to assess the influence of liver disease on the nutritional status, the progress of the disease and the associated risk factors. Scope: Nutrition Unit of the

  9. CO2 uptake of Opuntia ficus-indica (L. Mill. whole trees and single cladodes, in relation to plant water status and cladode age

    Giorgia Liguori

    2013-02-01

    Full Text Available Most of net photosynthesis determinations in Opuntia ficus-indica come from measurements on individual cladodes. However, they have limitations when used to scale up to whole canopy gas exchange, because a large variability of carbon assimilation may occur within the canopy, due to, among others, differences in cladode age and intercepted radiation or individual cladode response to abiotic stresses. The aim of this work was to evaluate the application of open gas exchange chambers, simultaneously applied around the whole canopy, to measure net CO2 uptake, continuously over a 24 h period, in single Opuntia ficus-indica (L. Mill. potted trees and in relation with their water status. Net CO2 uptake was also measured for single cladodes differentiated by age. O. ficus-indica trees continued their photosynthetic activity 60 days after the irrigation was stopped, when soil water content was lower than 5%. At this stage, current-year and 1-year-old cladodes had become flaccid but still the daily net CO2 uptake of non-irrigated trees kept the same rate than at the beginning of the experiment, while watered trees had doubled their net CO2 uptake. The highest instantaneous rates and total daily net CO2 uptake for both well-watered and non-irrigated trees occurred 60 days after the onset of the dry period, when maximal instantaneous rates were 11.1 in well-watered trees and 8.4 mol m–2 s–1 in non-irrigated trees. During the drought period, the chlorenchyma fresh weight decreased by 45% and 30%, in 1- and 2-yearold drought cladodes respectively, and marginally increased in currentyear ones (+20%. Net CO2 uptake for 1-year-old and 2-year-old cladodes changed only at highest photosynthetic photon flux density and temperatures, and average seasonal net CO2 uptake of 2-year-old cladodes was 15% lower than for 1-year-old ones. Whole-tree gas exchange measurements applied for the first time to O. ficus-indica indicated that whole cactus pear trees maintain

  10. Changes in phytochemical synthesis, chalcone synthase activity and pharmaceutical qualities of sabah snake grass (Clinacanthus nutans L.) in relation to plant age.

    Ghasemzadeh, Ali; Nasiri, Alireza; Jaafar, Hawa Z E; Baghdadi, Ali; Ahmad, Izham

    2014-01-01

    In the current study, changes in secondary metabolite synthesis and the pharmaceutical quality of sabah snake grass leaves and buds were considered in relation to plant age (1 month, 6 months, and 1 year old). The activity of the enzyme chalcone synthase (CHS, EC 2.3.1.74) was measured, as it is a key enzyme for flavonoid production. Significant differences in total flavonoid (TF) production were observed between the three plant growth periods and the different plant parts. The highest contents of TF (6.32 mg/g dry weight [DW]) and total phenolic (TP) (18.21 mg/g DW) were recorded in 6-month-old buds. Among the flavonoids isolated in this study the most important ones based on concentration were from high to low as follows: catechin > quercetin > kaempferol > luteolin. Production of phenolic acids increased from 1 to 6 months, but after 6 months up to 1 year of age, they decreased significantly. The highest contents of caffeic acid (0.307 mg/g DW) and gallic acid (5.96 mg/g DW) were recorded in 1-year and 6-month-old buds, respectively. The lowest and highest activity of CHS was recorded in 1-month and 6-month-old buds with values of 3.6 and 9.5 nkat/mg protein, respectively. These results indicate that the increment in flavonoids and phenolic acids in 6-month-old buds can be attributed to an increase in CHS activity. The highest 1,1-diphenyl-2-picrylhydrazyl (DPPH) activity was observed in the extract of 1-year-old buds followed by 6-month-old buds, with 50% of free radical scavenging (IC50) values of 64.6 and 73.5 µg/mL, respectively. Interestingly, a ferric reducing antioxidant power (FRAP) assay showed a higher activity in 6-month-old buds (488 μM of Fe(II)/g) than in 1-year-old buds (453 μM of Fe(II)/g), in contrast to the DPPH result. Significant correlations (p < 0.05) were observed between CHS enzyme activity and FRAP activity, TF, catechin, and kaempferol content. Extracts of 6-month-old bud exhibited a significant in vitro anticancer activity against

  11. Changes in Phytochemical Synthesis, Chalcone Synthase Activity and Pharmaceutical Qualities of Sabah Snake Grass (Clinacanthus nutans L. in Relation to Plant Age

    Ali Ghasemzadeh

    2014-10-01

    Full Text Available In the current study, changes in secondary metabolite synthesis and the pharmaceutical quality of sabah snake grass leaves and buds were considered in relation to plant age (1 month, 6 months, and 1 year old. The activity of the enzyme chalcone synthase (CHS, EC 2.3.1.74 was measured, as it is a key enzyme for flavonoid production. Significant differences in total flavonoid (TF production were observed between the three plant growth periods and the different plant parts. The highest contents of TF (6.32 mg/g dry weight [DW] and total phenolic (TP (18.21 mg/g DW were recorded in 6-month-old buds. Among the flavonoids isolated in this study the most important ones based on concentration were from high to low as follows: catechin > quercetin > kaempferol > luteolin. Production of phenolic acids increased from 1 to 6 months, but after 6 months up to 1 year of age, they decreased significantly. The highest contents of caffeic acid (0.307 mg/g DW and gallic acid (5.96 mg/g DW were recorded in 1-year and 6-month-old buds, respectively. The lowest and highest activity of CHS was recorded in 1-month and 6-month-old buds with values of 3.6 and 9.5 nkat/mg protein, respectively. These results indicate that the increment in flavonoids and phenolic acids in 6-month-old buds can be attributed to an increase in CHS activity. The highest 1,1-diphenyl-2-picrylhydrazyl (DPPH activity was observed in the extract of 1-year-old buds followed by 6-month-old buds, with 50% of free radical scavenging (IC50 values of 64.6 and 73.5 µg/mL, respectively. Interestingly, a ferric reducing antioxidant power (FRAP assay showed a higher activity in 6-month-old buds (488 μM of Fe(II/g than in 1-year-old buds (453 μM of Fe(II/g, in contrast to the DPPH result. Significant correlations (p < 0.05 were observed between CHS enzyme activity and FRAP activity, TF, catechin, and kaempferol content. Extracts of 6-month-old bud exhibited a significant in vitro anticancer activity

  12. Deuteronation and aging.

    Olgun, Abdullah; Oztürk, Kamile; Bayir, Selda; Akman, Serif; Erbil, M Kemal

    2007-04-01

    Deuterium has one proton and one neutron in its atomic nucleus, but hydrogen has only proton. The natural abundance of deuterium is 1 per approximately 6600 hydrogen atoms. Therefore deuterated water (both HOD + D(2)O [heavy water]) abundance is 1 per approximately 3300 water molecules. One dissociation product of deuterated and heavy water is deuteron (proton + neutron, D(+), H(2)OD(+)/D(3)O(+)). Because heavy water has a lower ionization constant than water, the D(+)/H(+) ratio is approximately 1/15,000 in biological fluids. O-D bond length is shorter than O-H, and D-O-D angle is lesser than H-O-H. Once a deuteron exchanges with proton on the water-exposed surface of a macromolecule, it can lead to a conformational change and the reverse exchange will be less likely. Deuteron bonds are stronger than proton bonds. Therefore an increase of deuteronated macromolecules can be expected in due course of time. In order to test this hypothesis, we conducted a pilot study and measured the D/H ratio in the tails of three Sprague-Dawley rats at different ages (4 weeks, 5 weeks, and >1-year old) by elemental analysis coupled with isotope ratio mass spectrometry (EA-IRMS) technique. To prevent the effect of daily water consumption, the homogenized tails were lyophilized before analysis. The results, as mean of several measurements, of 4 weeks, 5 weeks, and >1-year-old rats were per thousand-94 +/- 9.56, per thousand-101.71 +/- 6.89, per thousand-83.68 +/- 3.46 delta((2)H) relative to VSMOW, respectively. Although there is a slight increase in >1-year-old rat, the difference among the animals was not significant. We propose that, before reaching to a final conclusion about the accumulation of deuterium with aging, the measurements should be done not in whole tissue samples but in purified macromolecules from a larger set of animals. PMID:17460204

  13. Vitamin D Status: A Different Story in the Very Young versus the Very Old Romanian Patients

    Chirita-Emandi, Adela; Socolov, Demetra; Haivas, Carmen; Calapiș, Anca; Gheorghiu, Cristina; Puiu, Maria

    2015-01-01

    Background In Romania (latitude 48°15’N to 43°40’N), vitamin D supplementation is common practice mostly in infants 0-1 year old. No published information is available regarding epidemiological data on vitamin D status in the Romanian population for a wide age range and geographical territory. In this context, we aimed to evaluate the seasonal and age variation of vitamin D status in a large Romanian population. Methods 6631 individuals from across Romania had performed 7544 vitamin D assessments (2012-2014) in a chain of private laboratories. Vitamin D (25-hydroxyvitamin D2 and 25-hydroxyvitamin D3) was measured using High Performance Liquid Chromatography. Vitamin D levels were classified as severe deficiency100ng/ml. Results Male to female ratio was 1:2.9. Age ranged from 0 to 85 years. Mean vitamin D levels increased from April (26.3ng/ml) to September (35.6ng/ml) and decreased from October (33.5ng/ml) to March (24.4 ng/ml). Overall 40% had sufficient vitamin D, while the rest were insufficient 33%, deficient 22%, severely deficient 4% and 1% potentially harmful (of them 81% under 1 year old). Males compared to females showed higher percentages of sufficiency (47% vs. 38%). Children 0- 2 years presented the highest percentage of vitamin D sufficiency (77%). Lowest percentages (21%) of sufficiency were in people 80-84 years. Conclusion In Romania, suboptimal vitamin D levels are common (59%), especially in older age, wintertime and in women. Vitamin D supplementation would be most warranted from January to April in the Romanian population. 25-hydroxyvitamin D levels>100ng/ml were relatively prevalent in children 0-1 year old (17.3%). This was attributed to supplementation errors and the fact that high-risk individuals were more likely to visit for medical check-up. Nonetheless, it stresses the need to increase awareness of the importance of preventing Vitamin D supplementation administration errors in the young. PMID:26024516

  14. Delincuente sexual en serie y alteraciones psicopáticas: una relación ocasional Repeat sex offender and psychopathic changes: An incidental relationship

    M. Ventura Alvarez

    2003-04-01

    Full Text Available Los delincuentes sexuales en serie son tomados frecuentemente como psicópatas, en parte como consecuencia de la creciente popularidad del término. Un delincuente sexual en serie es aquel que ha actuado sobre dos o más víctimas en diferentes fechas; un psicópata es un tipo de trastorno de la personalidad que exhibe un patrón duradero de conductas socialmente irresponsables que desprecian los derechos de los demás. El presente trabajo presenta un caso de violador en serie interrumpido precozmente gracias a la actuación policial. Desde la óptica de su modus operandi lo consideramos dentro de los que Nicholas Groth denomina violador "confirmador de poder" y, tras su estudio clínico y psicométrico, no obtuvimos ningún dato que nos indujera a pensar que nos encontrábamos ante un psicópata. Revisamos ambos perfiles, los de psicopatía y los de agresor sexual en serie. Coincidimos con Marshall en la dificultad de caracterizar la personalidad del delincuente sexual y extraemos estudios como los de Quinsey y Malcolm, quienes encuentran, respectivamente, un 30% y un 7,5 % de psicopatías entre los delincuentes sexuales presos. Llamamos la atención sobre la relación poco clara entre la psicopatía y esta modalidad delictiva. Muchos de los estudios norteamericanos se han limitado a establecer patrones de comportamiento clasificatorios en función de la victimología, motivos o modo de operar de los agresores, muy útiles para las líneas de investigación policial, pero poco reveladores para el psiquiatra forense. Posiblemente no exista un claro patrón de personalidad debajo de la conducta de un violador, pero lamentamos la escasa producción científica al respecto.Repeat sex offenders are often taken for psychopaths, partly due to the increasing popularity of the term. A repeat sex offender is one who has had one or more victims at different times; a psychopath is a type of personality imbalance which displays a lasting pattern of socially

  15. Effects of NaCl Stress on Chlorophyll Fluorescence Parameters in Cinnamomum japonicum var. chenii%NaCl胁迫对普陀樟叶绿素荧光参数的影响

    李影丽; 汪奎宏; 杜国坚; 许利群; 杨华; 肖纪军

    2008-01-01

    [Objective] Study on the changes of chlorophyll fluorescence parameters in Cinnamomum japonicum var. chenii under NaCl stress. [Method] The seedling growth increment, chlorophyll content and chlorophyll fluorescence parameters in leaves of 1-year old Cinnamomum japonicum var. chenii were investigated in field experiment. [Result] Under NaCl stress, seedling growth increment reduced and the chlorophyll content decreased to a stable value; changes of Fv/Fm and Fv/Fo showed identical increasing trend and double peak type. With the aggravation of salt stress, most variations were ob- served in Fo, correlations among chlorophyll fluorescence parameters presented "rise-drop" trend (in the treatment of 7 g/L NaCl). [Condusion] Cinna-momum japonicum var. chenii is endowed with strong salt resistance and wide adaptability.

  16. Phonetic description of babbling in Danish toddlers born with and without unilateral cleft lip and palate

    Willadsen, Elisabeth; Albrechstn, Helle

    2006-01-01

    Objective: To investigate prelinguistic vocalization sequences of 1-year-old children with and without cleft lip and palate. Design: Prospective study. Participants: Thirty-eight children born with unilateral cleft lip and palate and 36 control children born without clefts. The cleft children had...... the lip, soft palate, and posterior part of the hard palate repaired at 4 months of age. The lip was closed ad modum Millard, the nose was corrected according to McComb, and the soft palate was closed with a posteriorly based vomer flap. Methods: Data were obtained from a clinical visit during which...... entered the canonical babbling stage. Results: No significant differences were observed between the cleft and control groups concerning frequency of occurrence of vocalization sequences, contoids, or vocoids. Structural differences between the groups seem to influence the contoid inventory, with a higher...

  17. Mosaic Ring Chromosome 14 and Monosomy 14 Presenting with Growth Retardation, Epilepsy, and Blepharophimosis.

    Jia-Woei Hou

    2004-05-01

    Full Text Available Ring chromosomes are rare chromosomal anomalies and usually not stable in nature.Patients carrying ring chromosome have various phenotypes depending on the degree ofstructural rearrangement. A 1-year-old boy, presenting with hypotonia, blepharophimosis,ptosis, a bulbous nose, mild psychomotor retardation, and epilepsy, was found to havemosaicism of chromosome ring 14 and monosomy 14. His karyotype is described as hithertounreported mos 46, XY, r(14(p11.2q32.31 or q32.2[84]/45, XY,-14[10]/46, XY, dicr(14[6]. His seizures responded well to phenobarbital. He has marked growth retardationbut less serious delays in mental and motor development than those with ring 14 describedin the literature.

  18. Optimization of pediatric chest radiographic images using optical densities ratio

    Souza, Rafael T.F.; Miranda, Jose R.A. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Inst. de Biociencias de Botucatu; Pina, Diana R. [Faculdade de Medicina de Botucatu (UNESP), Botucatu, SP (Brazil). Hospital das Clinicas. Dept. de Doencas Tropicais e Diagnostico por Imagem; Duarte, Sergio B. [Centro Brasileiro de Pesquisas Fisicas (CBPF/MCT), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    The aim of this study is the optimization of radiographic images for the pediatric patients in the age range between 0 and 1 years old, through Optical Density Ratio (ODR), considering that pediatric patients are overexposed to radiation in the repeated attempts to obtain radiographic images considered of good quality. The optimization of radiographic techniques was carried out with the RAP-PEPP (Realistic Analytical Phantom coupled to homogeneous Phantom Equivalent to Pediatric Patient) phantom in two incubators and one cradle. The data show that the clinical routine radiographic techniques generate low-quality images at up to 18.8% when evaluated by the ODRs, and increases in doses up to 60% when compared to the optimized techniques doses. (author)

  19. A preliminary assessment of individual doses in the environs of Berkeley, Gloucestershire, following the Chernobyl nuclear reactor accident

    A preliminary assessment has been made of the individual doses to critical group members of the public in the environs of Berkeley arising from fallout resulting from the Chernobyl accident. The assessment was based on measurements of airborne radionuclide concentrations, ground deposition and nuclide concentrations in rainwater, tapwater, grass, milk and green vegetables. The committed effective dose-equivalent was found to be as follows:- Adult - 200 μSv, 1 year old child - 500 μSv, the 10 year old child receiving a dose intermediate between these two values. The estimate accounts only for the nuclides measured and the specific exposure routes considered namely ingestion of milk and vegetables, inhalation and external exposure. However, it is believed that the inclusion of a range of other nuclides of potential significance, which may have been present but not measured, and potential intakes from additional routes is unlikely to increase the above estimates by more than a factor of 2. (author)

  20. Growth, temperature and density relationships of North Sea cod ( Gadus morhua )

    Rindorf, Anna; Jensen, Henrik; Schrum, Corinna

    2008-01-01

    temperature; however, although temperature increased, distribution of 1-year-olds changed concurrently and no increase in length at age 1 occurred. Growth from age 1 to age 2 decreased as ambient biomass of sandeel and density of cod decreased, whereas growth of cod older than 2 years decreased with......This study presents an analysis of the relationship between ambient temperature, cod density, fishing mortality, prey fish biomass, and growth of North Sea cod (Gadus morhua) as estimated from survey catches during the period from 1983 to 2006. Growth of young cod was positively related to...... increasing density of cod and increased with increasing biomass of demersal fish prey. Though growth of juveniles was strongly positively correlated to ambient temperature, no indication of direct temperature limitation of growth of older North Sea cod was found....

  1. Values for preventing influenza-related morbidity and vaccine adverse events in children

    Schwartz Benjamin

    2005-03-01

    Full Text Available Abstract Background Influenza vaccination recently has been recommended for children 6–23 months old, but is not currently recommended for routine use in non-high-risk older children. Information on disease impact, costs, benefits, risks, and community preferences could help guide decisions about which age and risk groups should be vaccinated and strategies for improving coverage. The objective of this study was to measure preferences and willingness-to-pay for changes in health-related quality of life associated with uncomplicated influenza and two rarely-occurring vaccination-related adverse events (anaphylaxis and Guillain-Barré syndrome in children. Methods We conducted telephone interviews with adult members selected at random from a large New England HMO (n = 112. Respondents were given descriptions of four health outcomes: uncomplicated influenza in a hypothetical 1-year-old child of their own, uncomplicated influenza in a hypothetical 14-year-old child of their own, anaphylaxis following vaccination, and Guillain-Barré syndrome. "Uncomplicated influenza" did not require a physician's visit or hospitalization. Preferences (values for these health outcomes were measured using time-tradeoff and willingness-to-pay questions. Time-tradeoff questions asked the adult to assume they had a child and to consider how much time from the end of their own life they would be willing to surrender to avoid the health outcome in the child. Results Respondents said they would give a median of zero days of their lives to prevent an episode of uncomplicated influenza in either their (hypothetical 1-year-old or 14-year-old, 30 days to prevent an episode of vaccination-related anaphylaxis, and 3 years to prevent a vaccination-related case of Guillain-Barré syndrome. Median willingness-to-pay to prevent uncomplicated influenza in a 1-year-old was $175, uncomplicated influenza in a 14-year-old was $100, anaphylaxis $400, and Guillain-Barré syndrome $4000

  2. Evaluation using MRI T2 mapping of the articular cartilage after anterior cruciate ligament injury in young athletes

    Articular cartilage damage coexisting in the anterior cruciate ligament (ACL) injury in young athletes is not rare. We evaluated the conditions of the articular cartilage using MRI T2 mapping method and compared the vesults with the findings of arthroscopy. From June to August in 2010, we performed ACL reconstruction in 31 patients. We selected 17 cases (eleven men and six women, mean age 19.1 years old), all of whom were athletes and the under 29 years old. Articular cartilage damage was observed in six out of 10 cases, and their T2 values were high on MRI T2 mapping. On the other hand, damage was observed only in one out of seven cases, and T2 values were in the normal level of the mapping. Using MRI T2 mapping, we can evaluate the articular cartilage at an early phase noninvasively. MRI T2 mapping is useful and effective for athletes. (author)

  3. Tracheal bronchus

    Abnormalities of the major airways are uncommon congenital conditions which occur in approximately 2% of the population. A tracheal bronchus arises from the trachea or mainstem bronchus and can aerate the entire upper lobe or a segment. Congenital tracheobronchial abnormalities may be asymptomatic and discovered as incidental findings or may present with stridor, recurrent pneumonia or atelectasis. We present the rare case of a 1 year old baby with a tracheal bronchus associated with recurrent pneumonia of the right upper lobe. In the daily clinical routine delayed diagnosis is quite frequent because anatomical variants of the airways are not routinely included in the differential diagnosis of persistent or recurrent pulmonary infections. The ability to diagnose and characterize these developmental abnormalities of the bronchial tree non-invasively has been enhanced by use of the multidetector computerized tomography (MDCT) and 3D airway reconstructions. (authors)

  4. Poland syndrome (anomaly with congenital hemangioma: A new association

    Riyaz Najeeba

    2006-01-01

    Full Text Available Unilateral defect of pectoral muscle and ipsilateral syndactyly constitute Poland syndrome. Absence or hypoplasia of the breast and nipple, axillary hair loss and dermatoglyphic abnormalities have also been reported in this syndrome. The primary defect could be in the development of the proximal subclavian artery with early deficit of blood flow to the distal limb and the pectoral region, resulting in partial loss of tissue in those regions. However, the association of congenital hemangioma with Poland sequence has not been observed so far. Such an association is being reported here in a 1-year-old infant, second-born of nonconsanguineous parents, who also had polydactyly instead of the documented syndactyly.

  5. Biological responses to the chemical recovery of acidified fresh waters in the UK

    We report biological changes at several UK Acid Waters Monitoring Network lakes and streams that are spatially consistent with the recovery of water chemistry induced by reductions in acid deposition. These include trends toward more acid-sensitive epilithic diatom and macroinvertebrate assemblages, an increasing proportional abundance of macroinvertebrate predators, an increasing occurrence of acid-sensitive aquatic macrophyte species, and the recent appearance of juvenile (<1 year old) brown trout in some of the more acidic flowing waters. Changes are often shown to be directly linked to annual variations in acidity. Although indicative of biological improvement in response to improving water chemistry, 'recovery' in most cases is modest and very gradual. While specific ecological recovery endpoints are uncertain, it is likely that physical and biotic interactions are influencing the rate of recovery of certain groups of organisms at particular sites. - Recently observed changes in the species composition of UK lakes and streams are consistent with chemical recovery from acidification

  6. TWO-STAGE SURGICAL TREATMENT OF A CHILD OF ONE YEAR FROM CONGENITAL HEART DISEASE AND BILIARY CIRRHOSIS

    S. V. Gautier

    2014-01-01

    Full Text Available Aim: Clinical case of successful two-stage surgical treatment of a 1-year-old child with congenital heart disease and biliary cirrhosis is represented in this article. At the first day of life laparotomy was performed because of high intestinal obstruction. Kasai procedure and Roux-en-Y choledochojejunostomy were per- formed on 12th day and at the end of second month of life, respectively. Liver biopsy showed the signs of biliary cirrhosis. At the same time ventricular septal defect and atrial septal defect with pulmonary hyper- tension were diagnosed. The first step of treatment was the surgical septal defects closure. No complications during procedure, cardiopulmonary bypass and post-operative period were registered. There were no nega- tive effects on liver function after cardiac surgery. 11 months later living-donor liver transplantation was performed without any complications. Patient was discharged at 35th post-transplant day with stable graft function. 

  7. FNIRS-based evaluation of cortical plasticity in children with cerebral palsy undergoing constraint-induced movement therapy

    Cao, Jianwei; Khan, Bilal; Hervey, Nathan; Tian, Fenghua; Delgado, Mauricio R.; Clegg, Nancy J.; Smith, Linsley; Roberts, Heather; Tulchin-Francis, Kirsten; Shierk, Angela; Shagman, Laura; MacFarlane, Duncan; Liu, Hanli; Alexandrakis, George

    2015-03-01

    Sensorimotor cortex plasticity induced by constraint-induced movement therapy (CIMT) in six children (10.2 ± 2.1 years old) with hemiplegic cerebral palsy (CP) was assessed by functional near-infrared spectroscopy (fNIRS). The activation laterality index and time-to-peak/duration during a finger tapping task were quantified before, immediately after, and six months after CIMT. Five age-matched healthy children (9.8 ± 1.3 years old) were also imaged at the same time points to provide comparative activation metrics for normal controls. In children with CP the activation time-to-peak/duration for all sensorimotor centers displayed significant normalization immediately after CIMT that persisted six months later. In contrast to this longer term improvement in localized activation response, the laterality index that depended on communication between sensorimotor centers improved immediately after CIMT, but relapsed six months later.

  8. [Chronic disseminated intravascular coagulopathy in a dog with lung worm infection].

    Schmitz, S; Moritz, A

    2009-06-01

    The clinical and laboratory findings in a 1-year-old male Jack Russel Terrier dog with lung worm induced coagulopathy are described. The diagnosis was based upon history, clinical findings, radiography, endoscopy, cytology and laboratory results. The presenting complaint was chronic cough. Radiographically, a diffuse interstitial to bronchial lung pattern was observed. Blood analysis revealed thrombocytopaenia and prolonged coagulation times. Disseminated intravascular coagulopathy (DIC) was diagnosed based on D-dimer and fibrinogen measurements, and by thrombelastogram results. After stabilisation of the patient, bronchoscopy with a bronchoalveolar lavage was performed, where large amounts of lung worm larvae were found cytologically. After treatment with fresh frozen plasma and fenbendazole, coagulation parameters improved and the cough resolved. PMID:19496048

  9. Temperament, stereotypies and anticipatory behaviour as measures of welfare in mink

    Hansen, Steffen W.; Jeppesen, Leif Lau

    2006-01-01

    and 24 of the non-stereotyping animals were selected and exposed to Pavlovian conditioning with both positive and negative rewards. Their behaviour during anticipation of the reward changed, however, they also showed a great variation and dependence on feeding time as well as stereotypy status. So......A farm mink population of 290 1-year-old wild-coloured females was scanned for stereotyped behaviour in October 2003. At the same time the temperament of the individuals was established with a stick test. Some of the females performed no stereotypies in 54 scans and this fraction of the population......, 73 individuals, included significantly more fearful animals (38.4%) as opposed to the stereotyping part of the population (22.6% fearful animals). Since fear observed under farming conditions directs to reduced welfare, the results suggest that stereotypy should not unconditionally be used as a...

  10. Potenciales evocados auditivos del tallo cerebral en monos rhesus (Macaca mulatta en diferentes etapas fisiológicas en condiciones de cautiverio Brainstem's auditory evoked potentials in rhesus monkeys (Macaca mulatta in different physiologic stages under captivity

    A Ibáñez-Contreras

    2011-01-01

    Full Text Available La audición juega un papel importante en el desarrollo de conductas más elaboradas en los organismos a medida en que se asciende en la escala filogenética. El objetivo de este estudio fue evaluar la respuesta de la vía auditiva en la especie Macaca mulatta, en diferentes etapas fisiológicas, a través de los Potenciales Evocados Auditivos del Tallo Cerebral (PEATC. Se utilizaron 30 primates no humanos de la especie Macaca mulatta divididos en dos grupos de 15 machos y 15 hembras. Cada grupo estuvo constituido por 3 machos y 3 hembras: Grupo 1 (0,1-3,1 años; Grupo 2 (3,2-6,1 años; Grupo 3 (6,2-9,1 años; Grupo 4 (9,2-12,1 años y Grupo 5 (12,2-27,1 años. Los PEATC se obtuvieron mediante la estimulación de los oídos con “clicks” de rarefacción a 50 dB de intensidad. La actividad eléctrica cerebral fue recogida por medio de electrodos de disco, colocados en las derivaciones Cz (+, A1, A2 (- y Fz como tierra, según el sistema 10/20 internacional. Se observaron cuatro ondas; debido a que no se encontraron diferencias significativas en t de student por aferencias separadas, se realizó ANOVAs con las aferencias unidas. Se observó que los grupos 1 y 5 presentan diferencias significativas en todas las ondas evaluadas, presentando las latencias más alargadas en relación a los demás grupos. Se concluye que a través de los PEATC es posible conocer los cambios que se generan a partir del desarrollo, maduración y envejecimiento de los monos rhesus.In the phylogenetic scale, audition plays a very important role in the development of elaborated behaviors. The aim of this study was to evaluate the auditive response in the Macaca mulatta species at different physiologic stages, through brainstem's auditory evoked potentials (BAEP. 30 non-human primates Macaca mulatta were allotted into two groups of 15 males and 15 females distributed in five age-dependant groups of 2 males and 2 females as follows: Group 1 (0,1-3,1 year old; Group 2 (3,2-6,1

  11. Spontaneous tumours in captive African hedgehogs (Atelerix albiventris): a retrospective study.

    Raymond, J T; Garner, M M

    2001-01-01

    Forty tumours were diagnosed in 35 (53%) of 66 captive African hedgehogs documented at Northwest ZooPath (NZP) between 1994 and 1999. Three hedgehogs had more than one type of tumour and the remaining 32 had a single type. Of the 35 hedgehogs with tumours, 14 were female, 11 were male, and 10 were of unknown gender; 21 were from zoological parks and 14 were privately owned. Twenty of the hedgehogs with tumours were adult (>1 year old) with a median age of 3.5 years (range 2-5.5 years); 15, of unreported age, were classified as adult. Thirty-four (85%) of the 40 tumours were classified as malignant and six (15%) as benign. The integumentary, haemolymphatic, digestive and endocrine systems were common sites for tumours. The most common tumours were mammary gland adenocarcinoma, lympho-sarcoma and oral squamous cell carcinoma. PMID:11222009

  12. Changes in the Essential Oil Composition in the Needles of Scots Pine (Pinus sylvestris L. Under Anthropogenic Stress

    Asta Judzentiene

    2007-01-01

    Full Text Available Unfavorable anthropogenic factors, such as air pollution, lead to biochemical responses in trees. Changes in the amounts of secondary metabolites may be early indicators of invisible injuries. The aim of this study was to evaluate composition of the essential oils in the needles of Scots pine (Pinus sylvestris L. growing in the areas affected by pollutant emissions of main factories in Lithuania: a nitrogen fertilizer factory (NFF, a cement factory (CF, and an oil refinery (OR. Totally, 14 pine stands were examined along transects from the factories (July 2005. Volatile components of the needles were extracted and analyzed by GC and GC/MS. Over 70 components of the essential oils were identified in current-year and 1-year-old needles.

  13. A case of recurrent acute encephalopathy with febrile convulsive status epilepticus with carnitine palmitoyltransferase II variation.

    Sakai, Eiko; Yamanaka, Gaku; Kawashima, Hisashi; Morishima, Yasuyuki; Ishida, Yu; Oana, Shingo; Miyajima, Tasuku; Shinohara, Mayu; Saitoh, Makiko; Mizuguchi, Masashi

    2013-08-01

    Acute encephalopathy with febrile convulsive status epilepticus (AEFCSE) is the most common type of acute encephalopathy in childhood in Japan, which develops with prolonged febrile convulsion, followed by mild unconsciousness. It is generally sporadic and nonrecurrent. In this report, a 1-year-old girl showed signs of AEFCSE triggered by respiratory syncytial virus infection. Two years later, she presented with AEFCSE triggered by influenza virus infection, resulting in severe neurologic sequelae. The patient had a thermolabile genotype of carnitine palmitoyltransferase II (CPT II) variations consisting of three single nucleotide polymorphisms in exons 4 [1055T > G/F352C and 1102G > A/V368I] and 5 [1939A > G/M647V]. The polymorphism has been identified as a genetic predisposition for acute encephalopathy. This report presents the first case of recurrent encephalopathy with CPT II variations that may partially associate with pathogenesis of recurrent AEFCSE. PMID:23450341

  14. Prevenção de anemia no primeiro ano de vida em centros de saúde do município de Santo André, São Paulo

    Szarfarc, S C; Berg, Gabriele; Santos, A L;

    1996-01-01

    The aim of this study was to evaluate the efficacy of an iron prophylactic supplementation program, in three health centers of Santo André, in São Paulo state. The prevalence of anemia was identified in a control group consisting of 201 children of 1 year old. The intervention group consisted...... and anemia and its risk to children's health. When the children were 12 months old, the diagnosis of anemia was made through dosage of hemoglobin concentration and the results were compared with those of the control group. It was verified that the 2 groups presented similar prevalences. It is important...... to realize that children with low frequency of visits to the health centers had prevalence of anemia significantly higher than those with high frequency. Some factors that possibly contributed to the result of the intervention are discussed....

  15. Agammaglobulinemia in a Patient with Smith-Lemli-Opitz Syndrome: Case Report

    H. Halik Akar

    2016-02-01

    Full Text Available Smith-Lemli-Opitz syndrome (SLO is a rare autosomal recessive (AR inherited genetic disorder characterized by multiple congenital anomalies, microcephaly, muscular hypotonia, and severe developmental delay. The deficiency of 7-dehydrocholesterol reductase enzyme leads to this syndrome. Patients with SLO display recurrent respiratory infections due to secondary muscular hypotonia which leads to decreased motility and respiratory effort. In this study, we report a 1-year-old boy with SLO presented with recurrent urinary infections and chronic diarrhea with Klebsiella pneumonia positivity in the rectal swabs. The patient had also markedly decreased immunoglobulin G (IgG between 50-100 g/dl. In follow-up of patient, markedly clinical improvement was observed with intravenous immunoglobulin (IVIG replacement. With this study, we would like to draw attention; recurrent infections may indicate primary immunodeficiencies such as agammaglobulinemia in patients with SLO.

  16. Spring mobilization of storage /sup 32/P in gingko trees

    Shim, K.K. (City Univ. of Seoul, Korea); Chung, K.H.; Kwon, S.H.

    1978-01-01

    The labelled phosphorus was supplied to the roots of 1-year-old gingko (Gingko biloba L.) trees during dormant period in the glass house and the mobilization of stored /sup 32/P determined in the following early growing season. /sup 32/P was detected in all growing tissues, the level of radioactivity being greatest in the root tissues over the 4-week sampling period. At dormant period, only 0.44% of /sup 32/P was found in storage tissues although the accumulation of /sup 32/P occurred especially in root tissues. During early growing season, /sup 32/P was transported from root tissues to new growing tissues. Eight percent of the initial /sup 32/P in storage tissues was transported to new growing tissues. During the period, the /sup 32/P in the bud tissues increased about 12 fold.

  17. PREVALÊNCIA E CORRELAÇÃO ENTRE OBESIDADE, HIPERTENSÃO ARTERIAL E A PRÁTICA DE ATIVIDADE FÍSICA

    Natália Turri da Silva

    2011-06-01

    Full Text Available In the recent decades, obesity and overweight, important risk factors for the cardiovascular disease development, had a significant increase being the sedentarism one of the most important causes. Considering it, this study aims at analysing the prevalence of obesity and hypertension in users of CEAFiR, besides correlating BMI with SBP and DBP. For that, weight and height were collected to calculate BMI and BP of 163 subjects (114 women and 49 men whose average age was 53.0 ± 16.1 years old. The results showed that 30.1% were classified as obese and 43.6% as overweight. Regarding to HA, 22,7% were classified in 1, 2 or 3 stages of hypertension and 7.4% as isolated systolic hypertension. Therefore, 73,7% were classified as overweight and 30.1% with hypertension. This result reinforces the importance of preventional programs aiming at orient the population, promoting positive changes in lifestyle.

  18. Airway management in Escobar syndrome: A formidable challenge

    Shaji Mathew

    2013-01-01

    Full Text Available Escobar syndrome is a rare autosomal recessive disorder characterized by flexion joint and digit contractures, skin webbing, cleft palate, deformity of spine and cervical spine fusion. Associated difficult airway is mainly due to micrognathia, retrognathia, webbing of neck and limitation of the mouth opening and neck extension. We report a case of a 1 year old child with Escobar syndrome posted for bilateral hamstrings to quadriceps transfer. The child had adequate mouth opening with no evidence of cervical spine fusion, yet we faced difficulty in intubation which was ultimately overcome by securing a proseal laryngeal mask airway (PLMA and then by intubating with an endotracheal tube railroaded over a paediatric fibreoptic bronchoscope passed through the lumen of a PLMA.

  19. Rhabdovirus carpio as a causative agent of disease in rainbow trout (Oncorhynchus mykiss - Walbaum

    Jeremić Svetlana

    2006-01-01

    Full Text Available High mortality of 1-year old rainbow trout occurred on a fish farm in the spring season, with clinical symptoms typical for acute septicemia. Histological examination revealed inflammatory changes and necrosis of the internal organs. The causative agent was isolated on RTG-2 and EPC cell lines and identified by serum neutralisation, enzyme-linked immunosorbent assay (ELISA and immunofluorescence (IFAT as Rhabdovirus carpio. Experimental infection using the virus isolated from rainbow trout caused disease in carp fry, as well. This is the first case of disease of rainbow trout caused by Rhabdovirus carpio, and the first reported isolation of Rhabdovirus carpio from rainbow trout in Serbia. Also, this is the first successful infection of carp with Rhabdovirus carpio isolated from rainbow trout.

  20. Dystocia Ystocia Due to Due to Mummifiedummified Foetaloetal Monsteronster in ain a Yankasaankasa Ewewe: A Casease Reporteport

    A.I. Kisani

    2012-06-01

    Full Text Available A 1 year old Yyankasa ewe weighing 24 kg was presented to the Large Animal Clinic unit of the Veterinary Teaching Hospital, University of Agriculture Makurdi, Nigeria. The owner with the complained t that she has been in labour for 24 h without delivery. Vital parameters were taken and found to be within the normal ranges. the The patient underwent general and obstetrical animal was examinationed. A diagnosis of dystocia was made with Tthe foetus was found to be in anterior presentation of the fetus, bilateral with the carpalus and shoulder flexioned and the neck deviated laterally.lateral deviation of the neck. Manual traction to deliver the foetus was not successful. Caesarean section was performed with the patient under sedation and epidural anaesthesiatherefore recommended. This was carried out and the dead foetus removed. Recovery post surgery was complete and the ewe was discharged five days post surgery.

  1. Leaching of mercury-containing cement monoliths aged for one year.

    Svensson, Margareta; Allard, Bert

    2008-01-01

    A directive from the Swedish Government states that waste containing more than 1% of mercury shall be permanently deposited. The stabilization of mercury by conversion to a sparingly soluble compound like the sulphide is crucial to ensure long-term immobilization in a permanent storage. Immobilization by the solidification/stabilization (S/S) method and possible formation of HgS from mercury oxide or elemental mercury by reaction with a sulphur source (S or FeS) is investigated by a modified version of the NEN 7345 Dutch tank-leaching test. The diffusion of mercury during 11 months from 1-year-old mercury containing monoliths of Portland and slag cement is demonstrated. In a geologic repository under conditions representative of deep granitic bedrock (bicarbonate buffered to pH 8.6), a favourable monolith combination is slag cement with addition of the iron sulphide troilite. The apparent diffusion coefficient of mercury is estimated. PMID:17544639

  2. Control age - and irradiation-induced seed deterioration in lettuce (Lactuca sativa L.) by hydration-dehydration treatments

    Hydration-dehydration treatment of stored lettuce seed (1-year-old, medium-vigour), greatly slowed down their deterioration during subsequent storage under accelerated and natural ageing conditions. Hydration-dehydration of seeds, before or soon after X- and γ-irradiation, considerably minimized the adverse effect of irradiation on the development of biological after-effects responsible for the fall in germinibility, especially the large reduction of root growth of seedlings. Pre- and post-irradiation treatments gave broadly similar effects. The results have been discussed in terms of a possible involvement of a cellular (biochemical) repair mechanism in the hydration phase and also on the basis of a physico-chemical control of free radical pathology in the aged and irradiated seed. (author)

  3. Mycobacterium fortuitum lipoid pneumonia in a dog.

    Leissinger, M K; Garber, J B; Fowlkes, N; Grooters, A M; Royal, A B; Gaunt, S D

    2015-03-01

    A 1-year old female spayed German Shepherd dog was evaluated for acute onset of dyspnea. Pyogranulomatous inflammation and green globoid structures were present on aspirates of the affected lung. Impression smears and histopathology confirmed pyogranulomatous pneumonia, with large amounts of lipid corresponding to the green structures noted cytologically, and identified poorly staining bacterial rods within lipid vacuoles. Special stains confirmed the presence of acid-fast bacterial rods, and polymerase chain reaction and DNA sequencing identified the organism as Mycobacterium fortuitum. M. fortuitum pneumonia is well described in humans and has previously been reported in 4 dogs and 1 cat. Lipid was a prominent cytologic and histologic feature, as is often described in humans and in the single feline case report. Additionally, this case highlights the variable cytologic appearance of lipid, as well as Mycobacterium spp, which are classically nonstaining with Wright-Giemsa. PMID:24788402

  4. Effect of CO2 enhancement on beech (Fagus sylvatica L. seedling root rot due to Phytophthora plurivora and Phytophthora cactorum

    Tkaczyk Miłosz

    2014-09-01

    Full Text Available Global climate change is associated with higher concentrations of atmospheric carbon dioxide (CO2. The ongoing changes are likely to have significant, direct or indirect effects on plant diseases caused by many biotic agents such as phytopathogenic fungi. This study results showed that increased CO2 concentration did not stimulate the growth of 1-year-old beech Fagus sylvatica L seedlings but it activated pathogenic Phytophthora species (P. plurivora and P. cactorum which caused significant reduction in the total number of fine roots as well as their length and area. The results of the greenhouse experiment indicated that pathogens once introduced into soil survived in pot soil, became periodically active (in sufficient water conditions and were able to damage beech fine roots. However, the trees mortality was not observed during the first year of experiment. DNA analyses performed on soil and beech tissue proved persistence of introduced Phytophthora isolates.

  5. Intervention analysis of introduction of rotavirus vaccine on hospital admissions rates due to acute diarrhea

    Maria de Lourdes Teixeira Masukawa

    2014-10-01

    Full Text Available The aim of this study is to investigate the impact of rotavirus vaccine on hospitalization rates for acute diarrhea in children younger than 5 years old after the introduction of the vaccine in 2006. A descriptive analytical observational study was carried out of the hospitalization rates occurred between 2000 and 2011 in 22 Regional Health Centers of Paraná State, Brazil. The effect of the vaccine was assessed by applying the SARIMA/Box-Jenkins time series methodology of intervention analysis, which allows verifying the slopes of the series are different after the introduction of the vaccine and estimating the magnitude of these effects for children younger than five years of age, by age group, for each region center. It was verified a statistically significant reduction by center/month on hospitalization rates for children 1 year old and younger, with averages of 47% and 58%, respectively, in December 2011.

  6. Spring mobilization of storage 32P in gingko trees

    The labelled phosphorus was supplied to the roots of 1-year-old gingko (Gingko biloba L.) trees during dormant period in the glass house and the mobilization of stored 32P determined in the following early growing season. 32P was detected in all growing tissues, the level of radioactivity being greatest in the root tissues over the 4-week sampling period. At dormant period, only 0.44% of 32P was found in storage tissues (bark, wood and bud) although the accumulation of 32P occurred especially in root tissues. During early growing season, 32P was transported from root tissues to new growing tissues (buds). Eight percent of the initial 32P in storage tissues was transported to new growing tissues. During this period, the 32P in the bud tissues increased about 12 fold. (author)

  7. Delleman Oorthuys syndrome

    Syed Wajahat A Rizvi

    2015-01-01

    Full Text Available Oculocerebrocutaneous or Delleman syndrome is a rare congenital syndrome characterized by microphthalmia/anophthalmia with or without orbital cysts, focal skin defects, intracranial cysts and skin appendages. We here report a case of 1-year-old male child with periocular skin tags, lid colobomas, and dermal hypoplasia. The patient had delayed developmental milestones and history of tonic-clonic seizures. Magnetic resonance imaging of the head revealed a large arachnoid cyst, aplastic cerebellar vermis and polymicrographic pattern of the cerebral cortex. A complex cyst of spleen was also noted on abdominal ultrasonography. Orbital cysts depending on the size can be excised or left alone. Neuroimaging evaluation of patients with congenital orbital cysts and skin appendages is emphasized for early and appropriate management.

  8. Influence of solar UV radiation on the nitrogen metabolism in needles of Scots pine (Pinus sylvestris L.).

    Krywult, Marek; Smykla, Jerzy; Kinnunen, Heli; Martz, Françoise; Sutinen, Marja-Liisa; Lakkala, Kaisa; Turunen, Minna

    2008-12-01

    Needles of 20-year-old Scots pine (Pinus sylvestris L.) saplings were studied in an ultraviolet (UV) exclusion field experiment (from 2000 to 2002) in northern Finland (67 degrees N). The chambers held filters that excluded both UV-B and UV-A, excluded UV-B only, transmitted all UV (control), or lacked filters (ambient). UV-B/UV-A exclusion decreased nitrate reductase (NR) activity of 1-year-old needles of Scots pines compared to the controls. The proportion of free amino acids varied in the range 1.08-1.94% of total proteins, and was significantly higher in needles of saplings grown under UV-B/UV-A exclusion compared to the controls or UV-B exclusion. NR activity correlated with air temperature, indicating a "chamber effect". The study showed that both UV irradiance and increasing temperature are significant modulators of nitrogen (N) metabolism in Scots pine needles. PMID:18508165

  9. Sudden death in a captive meerkat (Suricata suricatta with arterial medial and myocardial calcification

    Laura Bongiovann

    2016-04-01

    Full Text Available A 1-year-old male meerkat was found dead by the owner. The animal was clinically healthy and was regularly vaccinated for distemper virus. Necropsy revealed multifocal to confluent dry white areas in the myocardium, pneumonia and congestive hepatopathy. All the other organs, including gross vessels, were macroscopically normal. The heart showed histologically large, multifocal to confluent areas of mineralization of the myocardium and the wall of small coronary artery. Vascular calcifications were also observed in the hepatic portal tracts and kidneys arteries of small/medium sizes. The arterial lumen appeared narrowed and the wall thickened due to the calcification of the tunica media. In veterinary medicine, arterial mineralization is regarded as a metastatic calcification, as the result of hypercalcemia and/or hyperphosphatemia. However, today, the pathogenesis of medial artery calcification in humans seems to be the results of an active process resembling embryonic osteogenesis, rather than a mere passive process.

  10. Breath test measurements in combination with indirect calorimetry for estimation of 13C-leucine oxidation in mink (Mustela vison)

    Tauson, Anne-Helene; Ali, Abdalla; Kanska, Katarzyna;

    2000-01-01

    Gas exchange measurements by means of indirect calorimetry can be used to calculate quantitative substrate oxidation. The results represents average net oxidation values (substrate disappearance rate), but they cannot describe the dynamics of the oxidation processes. Breath test measurements...... to feeding and fasting. Twelve 1-year-old male mink (Mustela vison) were measured in each five consecutive periods by means of indirect calorimetry and simultaneous breath test. In Periods 1, 3 and 5, each lasting 3 days, the animals were fed ad libitum and Periods 2 and 4 were fasting periods, each of 48 h...... before measurements started and expired air was then sucked out of the respiration chamber and collected into breath bags at frequent intervals until 5.5 h after the start of measurements. The ratio of 13C/12C was measured by means of an IRIS infrared analyser and results are reported in terms of delta...

  11. High-dose I-131 MIBG treatment for young children with high-risk neuroblastoma, and its practical problem. From the experience of the youngest case in Japan

    High-dose I-131 MIBG (metaiodobenzylguanidine) therapy combined with auto- or allo-hematopoietic stem cell transplantation is becoming a potential treatment for patients with high-risk neuroblastoma worldwide. However, only older children, who can perform personal care, had been given high-dose I-131 MIBG treatment to avoid the needless radiation exposure to caregivers and medical staff in Japan. In this case report, we have used the high dose MIBG therapy followed by autologous PBSCT (peripheral blood stem cell transplantation) for a 1-year-old boy with a newly diagnosed high-risk neuroblastoma with MYCN amplifications. The total radiation exposure to all parties involved was very limited, even in the youngest case in Japan, probably due to adequate preparations. This encouraging experience may remove the age limit for high-dose I-131 MIBG treatment for the patients with high-risk neuroblastoma in Japan. (author)

  12. [Hermansky-Pudlak syndrome].

    Atili, A; Lübke, J; Shoukier, M; Schittkowski, M P

    2013-02-01

    A 1-year-old female child suffering from nystagmus and abnormal head posture (AHP) was presented by the parents in our clinic. The family history revealed the presence of von Willebrand's disease in both parents. General examination showed a female child with light blond colored skin accompanied by black-haired parents. Physical and ophthalmic examination revealed nystagmus, AHP and oculocutaneous albinism. The molecular genetic analysis showed a mutation in the HPS-1 gene which confirmed the suspected diagnosis of Hermansky-Pudlak syndrome (HPS). Of clinical significance, patients with HPS commonly have hemorrhagic diathesis, granulomatous colitis or restrictive lung fibrosis. A detailed full medical history, ophthalmic examination as well as genetic analyses are essential in establishing the diagnosis of HPS. Treatment includes correcting refraction anomalies with spectacles or contact lenses, prescription of tinted glasses or surgical correction of the AHP. An internal medical consultation is also necessary for the management of other associated symptoms, such as hemorrhagic diathesis. PMID:22806537

  13. Infective endocarditis of the aortic valve in a Border collie dog with patent ductus arteriosus.

    Aoki, Takuma; Sunahara, Hiroshi; Sugimoto, Keisuke; Ito, Tetsuro; Kanai, Eiichi; Fujii, Yoko

    2015-03-01

    Infective endocarditis (IE) in dogs with cardiac shunts has not been reported previously. However, we encountered a dog with concurrent patent ductus arteriosus (PDA) and IE. The dog was a 1-year-old, 13.9-kg female Border collie and presented with anorexia, weight loss, pyrexia (40.4 °C) and lameness. A continuous murmur with maximal intensity over the left heart base (Levine 5/6) was detected on auscultation. Echocardiography revealed a PDA and severe aortic stenosis (AS) caused by aortic-valve vegetative lesions. Corynebacterium spp. and Bacillus subtilis were isolated from blood cultures. The dog responded to aggressive antibiotic therapy, and the PDA was subsequently surgically corrected. After a series of treatments, the dog showed long-term improvement in clinical status. PMID:25391395

  14. Kinetics of carnitine palmitoyltransferase I (CPT I) in Chinese sucker (Myxocyprinus asiaticus) change with its development.

    Liu, Cai-Xia; Luo, Zhi; Hu, Wei; Tan, Xiao-Ying; Zheng, Jia-Lang; Chen, Qi-Liang; Zhu, Qing-Ling

    2014-02-01

    The present study was conducted to evaluate the ontogeny and kinetic of CPT I in several tissues of the Chinese sucker Myxocyprinus asiaticus. To this end, liver, muscle and intestine tissues were examined at five various developmental stages of Chinese sucker: newly-hatched larvae, 68-day-old, 4-month-old, 1- and 2-year-old Chinese sucker, respectively. The total carnitine (TC) content in the liver increased from birth to 1-year-old Chinese sucker and then declined in the 2-year-old Chinese sucker. From the 68-day-old to the 1-year-old Chinese sucker, both free and total concentrations in muscle increased. Both acyl carnitine (AC) and TC concentrations in intestine were very variable at different stages. The ratio of AC to free carnitine (FC) in liver progressively increased from hatching to 4 months, and declined at the age of 1 year, and then increased by 2 years. In muscle, the highest and lowest ratios of AC/FC were observed at 68-days-old and 4 month-old Chinese sucker. The highest proportion of AC/FC in intestine was also observed at 68-day-old Chinese sucker. All the Chinese sucker larvae at hatching had a high value of the Michaelis constant (K(m)) for carnitine. Maximal velocity (V(max)) in intestine increased with age. V(max) in liver and muscle increased with age except a decrease at 4 months in liver and at 2 years in muscle. The FC concentration in the examined tissues at all developmental stages were less than the respective K(m), indicating that Chinese suckers require supplemental carnitine in their food to ensure that CPT I activity is not constrained by carnitine availability. PMID:24264360

  15. Sulfadiazine uptake and effects in common hazel (Corylus avellana L.).

    Michelini, Lucia; Meggio, Franco; Reichel, Rüdiger; Thiele-Bruhn, Sören; Pitacco, Andrea; Scattolin, Linda; Montecchio, Lucio; Alberghini, Sara; Squartini, Andrea; Ghisi, Rossella

    2015-09-01

    Soil contamination by antibiotics is a possible consequence of animal husbandry waste, sewage sludge, and reclaimed water spreading in agriculture. In this study, 1-year-old hazel plants (Corylus avellana L.) were grown in pots for 64 days in soil spiked with sulfadiazine (SDZ) in the range 0.01-100 mg kg(-1) soil. Leaf gas exchanges, fluorescence parameters and plant growth were measured regularly during the experiment, whereas plant biomass, sulfonamide concentrations in soil and plant tissues, and the quantitative variation of culturable bacterial endophytes in leaf petiole were analyzed at the end of the trial. During the experiment, photosynthesis and leaf transpiration as well as fluorescence parameters were progressively reduced by the antibiotic. Effects were more evident for leaf transpiration and for the highest SDZ spiking concentrations, whereas growth analyses did not reveal negative effects of the antibiotic. At the end of the trial, a high number of culturable endophytic bacteria in the leaf petiole of plants treated with 0.1 and 0.01 mg kg(-1) were observed, and SDZ was extractable from soil and plant roots for spiking concentrations ≥1 mg kg(-1). Inside plants, the antibiotic was mainly stored at the root level with bioconcentration factors increasing with the spiking dose, and the hydroxylated derivate 4-OH-SDZ was the only metabolite detected. Overall results show that 1-year-old hazel plants can contribute to the reduction of sulfonamide concentrations in the environment, however, sensitive reactions to SDZ can be expected at the highest contamination levels. PMID:25940473

  16. Influence of nutrient supply on shade-sun acclimation of Picea abies seedlings: effects on foliar morphology, photosynthetic performance and growth.

    Grassi, G.; Minotta, G.

    2000-05-01

    Norway spruce seedlings (Picea abies Karst.) were grown in low light for one year, under conditions of adequate and limiting nutrition, then transferred to high light. Three months after transfer we measured photosynthesis, leaf nitrogen concentration, leaf chlorophyll concentration and leaf mass per area (LMA) of current-year and 1-year-old shoots; silhouette area ratio (SAR, the ratio of shoot silhouette area to projected needle area) was also measured in current-year shoots. At the foliage level, the effects of light and nutrient treatments differed markedly. Light availability during foliage expansion primarily affected LMA and SAR (morphological acclimation at the needle and shoot level, respectively). By contrast, nutrient supply in high light affected photosynthetic capacity per unit of leaf tissue (physiological acclimation at the cellular level) but did not affect LMA and SAR. The capacity for shade-sun acclimation in foliage formed before transfer to high light differed greatly from that of foliage formed following the transfer. The morphological inflexibility of mature needles (measured by LMA) limited their shade-sun acclimation potential. In contrast, at high nutrient supply, shoots that developed just after the change in photosynthetic photon flux density largely acclimated, both morphologically and physiologically, to the new light environment. The acclimation response of both current- and 1-year-old shoots was prevented by nutrient limitation. Analysis of growth at the whole-plant level largely confirmed the conclusions drawn at the shoot level. We conclude that nutrient shortage subsequent to the opening of a canopy gap may strongly limit the acclimation response of Norway spruce seedlings. Successful acclimation was largely related to the plant's ability to produce sun foliage and adjust whole-plant biomass allocation rapidly. PMID:12651514

  17. Transfer of chlorine from the environment to agricultural foodstuffs

    The factors governing chlorine transfer from Phaeozem and Greyzem soils to various important crop species (foodstuff and forage) were determined in natural conditions in the Kiev region of Ukraine. The stable chlorine concentration ratio (CR) values were the lowest in apple (0.5 ± 0.3) and strawberry (2 ± 1), higher in vegetables (5 ± 3), seeds (15 ± 7) and reached a maximum in straw (187 ± 90). The average CR values of 36Cl were estimated for the most important crops using all experimental data on 36Cl and stable chlorine transfer into plants from various soils. It was experimentally shown that boiling potatoes in water leads to an equilibrium between 36Cl specific content in the water and moisture in the cooked potato. The 36Cl processing factor (PF) for boiling various foodstuffs is equal to the ratio of water mass in the cooked foodstuff to the total water mass (in the food and the decoction). 36Cl PF for cereal flour can be estimated as 1. The 36Cl processing factor for dairy products is equal to the ratio of residual water mass in the product to initial water mass in milk. At a 36Cl specific activity in soil of 1 Bq kg-1, the estimated annual dietary 36Cl intake into human organism (adult man) is about 10 kBq. Sixty to seventy percent of the above amount will be taken in via milk and dairy products, 7-16% via meat, 14-16% via bread and bakery items and 8-12% via vegetables. The highest annual 36Cl intake, 10.7 kBq, is predicted for 1-year-old children. The expected effective doses from annual 36Cl intake are higher for younger age groups, increasing from 0.008 mSv in adults to 0.12 mSv in 1-year-old children

  18. Human exposure to trace elements through the skin by direct contact with clothing: Risk assessment

    Rovira, Joaquim [Laboratory of Toxicology and Environmental Health, School of Medicine, IISPV, Universitat Rovira i Virgili, Sant Llorenç 21, 43201 Reus, Catalonia (Spain); Environmental Engineering Laboratory, Departament d' Enginyeria Quimica, Universitat Rovira i Virgili, Av. Països Catalans 26, 43007 Tarragona, Catalonia (Spain); Nadal, Martí [Laboratory of Toxicology and Environmental Health, School of Medicine, IISPV, Universitat Rovira i Virgili, Sant Llorenç 21, 43201 Reus, Catalonia (Spain); Schuhmacher, Marta [Laboratory of Toxicology and Environmental Health, School of Medicine, IISPV, Universitat Rovira i Virgili, Sant Llorenç 21, 43201 Reus, Catalonia (Spain); Environmental Engineering Laboratory, Departament d' Enginyeria Quimica, Universitat Rovira i Virgili, Av. Països Catalans 26, 43007 Tarragona, Catalonia (Spain); Domingo, José L., E-mail: joseluis.domingo@urv.cat [Laboratory of Toxicology and Environmental Health, School of Medicine, IISPV, Universitat Rovira i Virgili, Sant Llorenç 21, 43201 Reus, Catalonia (Spain)

    2015-07-15

    Metals in textile products and clothing are used for many purposes, such as metal complex dyes, pigments, mordant, catalyst in synthetic fabrics manufacture, synergists of flame retardants, antimicrobials, or as water repellents and odour-preventive agents. When present in textile materials, heavy metals may mean a potential danger to human health. In the present study, the concentrations of a number of elements (Al, As, B, Ba, Be, Bi, Cd, Co, Cr, Cu, Fe, Hg, Mg, Mn, Mo, Ni, Pb, Sb, Sc, Se, Sm, Sn, Sr, Tl, V, and Zn) were determined in skin-contact clothes. Analysed clothes were made of different materials, colours, and brands. Interestingly, we found high levels of Cr in polyamide dark clothes (605 mg/kg), high Sb concentrations in polyester clothes (141 mg/kg), and great Cu levels in some green cotton fabrics (around 280 mg/kg). Dermal contact exposure and human health risks for adult males, adult females, and for <1-year-old children were assessed. Non-carcinogenic and carcinogenic risks were below safe (HQ<1) and acceptable (<10{sup −6}) limits, respectively, according to international standards. However, for Sb, non-carcinogenic risk was above 10% of the safety limit (HQ>0.1) for dermal contact with clothes. - Highlights: • We determined in skin-contact clothes the concentrations of a number of metals. • Dermal contact exposure and health risks for adults and for 1-year-old children were assessed. • Carcinogenic risks were considered as acceptable (<10{sup −6}). • For non-carcinogenic risks, only Sb exceeded a 10% of the HQ for dermal contact with clothes.

  19. The use of intonation for turn anticipation in observed conversations without visual signals as source of information

    Anne eKeitel

    2015-02-01

    Full Text Available The anticipation of a speaker’s next turn is a key element of successful conversation. This can be achieved using a multitude of cues. In natural conversation, the most important cue for adults to anticipate the end of a turn (and therefore the beginning of the next turn is the semantic and syntactic content. In addition, prosodic cues, such as intonation, or visual signals that occur before a speaker starts speaking (e.g., opening the mouth help to identify the beginning and the end of a speaker’s turn. Early in life, prosodic cues seem to be more important than in adulthood. For example, it was previously shown that 3-year-old children anticipated more turns in observed conversations when intonation was available compared with when not, and this beneficial effect was present neither in younger children nor in adults (Keitel, Prinz, Friederici, von Hofsten, & Daum, 2013. In the present study, we investigated this effect in greater detail. Videos of conversations between puppets with either normal or flattened intonation were presented to children (1-year-olds and 3-year-olds and adults. The use of puppets allowed the control of visual signals: The verbal signals (speech started exactly at the same time as the visual signals (mouth opening. With respect to the children, our findings replicate the results of the previous study: 3-year-olds anticipated more turns with normal intonation than with flattened intonation, whereas 1-year-olds did not show this effect. In contrast to our previous findings, the adults showed the same intonation effect as the 3-year-olds. This suggests that adults’ cue use varies depending on the characteristics of a conversation. Our results further support the notion that the cues used to anticipate conversational turns differ in development.

  20. 小儿营养性缺铁性贫血的临床分析%To Explore the Clinical Nutritional Iron Deficiency Anemia of Infantile

    田秀华

    2015-01-01

    目的:分析小儿营养缺铁性贫血情况。方法回顾性总结90例小儿营养缺铁性贫血患者临床资料,分析其临床发病特点和相关危险因素。结果61.11%儿童营养缺铁性贫血年龄为7个月~1岁;农村儿童多于城市儿童;纯母乳喂养未添加辅食儿童易患缺血性贫血。结论7个月~1岁属于小儿营养缺铁性贫血高发期,应该及时预防、诊断、治疗,降低该病发生率。%Objective To analyze nutritional iron deficiency anemia of infantile.Methods Selected 90 cases nutritional iron deficiency anemia of infantile with clinical data retrospective summary, analysis the clinical characteristics and related risk factors. Results 61.11% of nutritional iron deifciency anemia children at age 7 months to 1 year old, Rural children more than city children, exclusive breastfeeding not add side dish was susceptible to ischemic anemia.Conclusion 7 months to 1 year old belongs to infantile nutritional iron deifciency anemia intensiifes period, prevention timely, diagnosis, treatment and reduce the incidence of the disease.

  1. Germination and ultrastructural studies of seeds produced by a fast-growing, drought-resistant tree: implications for its domestication and seed storage.

    Fotouo-M, Helene; du Toit, Elsa S; Robbertse, Petrus J

    2015-01-01

    Seed ageing during storage is one of the main causes of reduction in seed quality and this results in loss of vigour and failure to thrive. Finding appropriate storage conditions to ameliorate deterioration due to ageing is, therefore, essential. Ultrastructural changes in cellular organelles during storage and seed germination rates are valuable indices of damage that occurs during seed ageing. There is increasing interest in Moringa oleifera Lam. because of its multiple uses as an agroforestry crop. Seeds of this species lose their viability within 6-12 months of harvest but no scientific information is available on the longevity of seed stored in the fruit (capsules). In most undeveloped countries, seeds are still stored inside the fruit by traditional methods in special handmade structures. In this experiment we tried to simulate these traditional storage conditions. Capsules of Moringa were stored at ambient room temperature for 12, 24 and 36 months. The ultrastructure, solute leakage and viability of seed were investigated. The ultrastructure of 1-year-old seed showed no sign of deterioration. It was evident, however, that some cells of the 3-year-old seed had deteriorated. The remnants of the outer and inner two integuments that remain tightly attached to the cotyledons probably play a role in seed dormancy. No significant difference was found between germination percentage of fresh and 1-year-old seed. The germination percentage decreased significantly from 2 years of storage onward. The decrease in seed viability during storage was associated with a loss in membrane integrity which was evidenced by an increase in electrolyte leakage. Our findings indicate that the longevity of M. oleifera seeds can be maintained if they are stored within their capsules. PMID:25725083

  2. Favorable outcome in non-infant children with MLL-AF4-positive acute lymphoblastic leukemia: a report from the Tokyo Children's Cancer Study Group.

    Tomizawa, Daisuke; Kato, Motohiro; Takahashi, Hiroyuki; Fujimura, Junya; Inukai, Takeshi; Fukushima, Takashi; Kiyokawa, Nobutaka; Koh, Katsuyoshi; Manabe, Atsushi; Ohara, Akira

    2015-11-01

    Unlike acute lymphoblastic leukemia (ALL) in infants, MLL gene rearrangement (MLL-r) is rare in ALL children (≥1 year old). The outcome and optimal treatment options for MLL-r ALL remain controversial. Among the 1827 children enrolled in the Tokyo Children's Cancer Study Group ALL studies L95-14, L99-15, L99-1502, L04-16, and L07-1602 (1995-2009), 25 MLL-r ALL patients (1.3 %) were identified. Their median age and leukocyte count at diagnosis was 2 years old (range 1-15 years) and 27,690/μL (range 1800-1,113,000/μL), respectively. All but one patient achieved complete remission (CR) after induction therapy, and 19 underwent allogeneic hematopoietic stem cell transplantation (HSCT) in first CR according to the protocol. The 5-year event-free survival (EFS) and overall survival (OS) rate were 60.0 % [standard error (SE), 9.7 %] and 64.0 % (SE 9.6 %), respectively. Notably, 9/12 cases with MLL-AF4-positive ALL are alive in continuous CR with a 75.0 % (SE 12.5 %) EFS rate. The causes of treatment failure were as follows: one induction failure, five relapses, and five transplant-related deaths. With intensive chemotherapy and allogeneic HSCT, favorable outcome of children (≥1 year old) with MLL-AF4-positive ALL was observed. However, considering the risk of acute and late toxicities associated with HSCT, its indication should be restricted. PMID:26410102

  3. The use of intonation for turn anticipation in observed conversations without visual signals as source of information.

    Keitel, Anne; Daum, Moritz M

    2015-01-01

    The anticipation of a speaker's next turn is a key element of successful conversation. This can be achieved using a multitude of cues. In natural conversation, the most important cue for adults to anticipate the end of a turn (and therefore the beginning of the next turn) is the semantic and syntactic content. In addition, prosodic cues, such as intonation, or visual signals that occur before a speaker starts speaking (e.g., opening the mouth) help to identify the beginning and the end of a speaker's turn. Early in life, prosodic cues seem to be more important than in adulthood. For example, it was previously shown that 3-year-old children anticipated more turns in observed conversations when intonation was available compared with when not, and this beneficial effect was present neither in younger children nor in adults (Keitel et al., 2013). In the present study, we investigated this effect in greater detail. Videos of conversations between puppets with either normal or flattened intonation were presented to children (1-year-olds and 3-year-olds) and adults. The use of puppets allowed the control of visual signals: the verbal signals (speech) started exactly at the same time as the visual signals (mouth opening). With respect to the children, our findings replicate the results of the previous study: 3-year-olds anticipated more turns with normal intonation than with flattened intonation, whereas 1-year-olds did not show this effect. In contrast to our previous findings, the adults showed the same intonation effect as the 3-year-olds. This suggests that adults' cue use varies depending on the characteristics of a conversation. Our results further support the notion that the cues used to anticipate conversational turns differ in development. PMID:25713548

  4. The Long-term Decrease of 90Sr in the Environment and its Transfer to Man after a Nuclear Fallout

    Due to its long physical half-life, and the fact that its long-term mobility in the environment as well as its radiotoxicity is higher than that of 137Cs, the long-term bio-availability of 90Sr in the environment is of importance with regard to the long-term population exposure after fallout from nuclear weapons detonations or a severe reactor accident. It will also substantially influence the time-span required until re-utilisation of highly contaminated territory is possible again. An assessment of the long-term decrease of the activity concentration in all foodstuffs relevant for internal exposure after severe 90Sr fallout was performed. The observed effective half-lives were approximately 1.8-2.1 years in the first 2-3 years after the end of fallout and 8-10 years in the following three decades. This is equivalent to a biological half-life of about 13.2 years and results in a total 50 year dose of 6.2 times the first year exposure. Due to this decline in 90Sr-availability, the average annual activity intake of 90Sr in Austria has decreased from 840 Bq at the climax of the nuclear weapons tests to about 42 Bq in 1997 for adults, and from 500 Bq to about 35 Bq for 1 year old infants. This is equivalent to a 90Sr ingestion dose of 1.2 μSv for adults and 2.5 μSv for 1 year old infants in 1997 or less than 0.4% of the ingestion dose by natural radionuclides in the diet. (author)

  5. Ethylene Evolution Changes in Tilted Fraxinus mandshurica Rupr. var. japonica Maxim. Seedlings in Relation to Tension Wood Formation

    Sha Jiang; Ke Xu; Na Zhao; Shu-Xin Zheng; Yan-Ping Ren; Yu-Bao Gao; Song Gu

    2009-01-01

    The effects of ethylene on tension wood formation were studied in 3-year-old Fraxinus mandshurica Rupr. var. japonica Maxim, seedlings in two separate experiments. In experiment 1, ethylene evolution of buds and stems was measured using gas chromatography after 0, 2,4, 7,14, and 21 d of treatment; in experiment 2, both aminoethoxyvinylglycine (AVG) and AgNO3 were applied to the horizontally-placed stems, and the cell numbers on sites of applications were measured after 40 d. Ethylene evolution from buds was found to be much greater in tilted seedlings than in upright ones. The cell numbers of wood fibers in shoots and 1-year-old stems were reduced in treatments with 12.5 x 10-7 μmol/L AVG, 12.5 x 10-8 μmol/L AVG, and 11.8 x 10-8 μmol/L AgNO3; whereas the horizontal and vertical diameters were reduced by treatment of 12.5 x 10-7 μnol/L AVG. Ethylene evolutions of shoots and 1-year-old stems were inhibited greatly in comparison with the control by applying 12.5 x 10-7 μmol/L AVG. The formation of a gelatinous layer of wood fibers was affected by neither AVG nor AgNO3 application. These results suggest that ethylene regulates the quantity of wood production, but does not affect G-layer formation in F. mandshurica Rupr. var. japonica Maxim, seedlings.

  6. Critical tidal level for forestation with hypocotyl of Rhizophora stylosa Griff along the Guangxi coast of China

    Binyuan HE; Tinghe LAI

    2009-01-01

    From August 2004 to August 2005, three replicate experimental platforms were constructed in a section of the tidal flats in Yingluo Bay, Guangxi Province to study the growth and physiological responses of Rhizophora stylosa Griff seedlings to tidal waterlogging stress in a diurnal tidal zone. A total of eight tidal flat elevation (TFE) treatments, i.e., 320, 330, 340, 350, 360,370, 380 and 390 cm above Yellow Sea Datum (YSD),were created on each platform. The results showed that lower TFEs (320-330cm YSD) slightly increased the seedling stem height of 1-year old seedlings, while higher TFEs (> 340 cm YSD) increased the seedling growth significantly. Moderate TFEs (350-370 cm YSD) favored the development of knots. Number of leaves, leaf conservation rate and leaf area per seedling all decreased dramatically with decreasing TFE. Lower TFEs caused large damage to Chl a, but Chl b was less affected. The Chl a/b ratio decreased with decreasing TFE. Prolonged waterlogging induced higher SOD activity in roots, while moderate TFE inhibited the SOD activity in leaves. The POD activity in roots and leaves increased with decreasing TFE. Waterlogging stress decreased the biomass of individual organs and entire seedlings. With increasing waterlogging, the biomass partitioning in 1-year old seedlings increased from leaf to stem. The survival rate decreased sharply from 88.9% to 40.0% as TFE decreased,while more than 80% of the seedlings were able to survive at the TFE level of 370 cm YSD and above. We propose that the local mean sea level should be adopted as the critical tidal level for forestation with hypocotyls of R.stylosa along the Guangxi coast.

  7. The Effects of Run-of-River Hydroelectric Power Schemes on Fish Community Composition in Temperate Streams and Rivers

    2016-01-01

    The potential environmental impacts of large-scale storage hydroelectric power (HEP) schemes have been well-documented in the literature. In Europe, awareness of these potential impacts and limited opportunities for politically-acceptable medium- to large-scale schemes, have caused attention to focus on smaller-scale HEP schemes, particularly run-of-river (ROR) schemes, to contribute to meeting renewable energy targets. Run-of-river HEP schemes are often presumed to be less environmentally damaging than large-scale storage HEP schemes. However, there is currently a lack of peer-reviewed studies on their physical and ecological impact. The aim of this article was to investigate the effects of ROR HEP schemes on communities of fish in temperate streams and rivers, using a Before-After, Control-Impact (BACI) study design. The study makes use of routine environmental surveillance data collected as part of long-term national and international monitoring programmes at 23 systematically-selected ROR HEP schemes and 23 systematically-selected paired control sites. Six area-normalised metrics of fish community composition were analysed using a linear mixed effects model (number of species, number of fish, number of Atlantic salmon—Salmo salar, number of >1 year old Atlantic salmon, number of brown trout—Salmo trutta, and number of >1 year old brown trout). The analyses showed that there was a statistically significant effect (p<0.05) of ROR HEP construction and operation on the number of species. However, no statistically significant effects were detected on the other five metrics of community composition. The implications of these findings are discussed in this article and recommendations are made for best-practice study design for future fish community impact studies. PMID:27191717

  8. Prevalence of intestinal parasites in breeding kennel dogs in Japan.

    Itoh, Naoyuki; Kanai, Kazutaka; Kimura, Yuya; Chikazawa, Seishiro; Hori, Yasutomo; Hoshi, Fumio

    2015-03-01

    The present study is the first to show overall prevalences of intestinal parasites among breeding kennel dogs in Japan. A total of 573 fresh fecal samples were collected from dogs at 12 breeding kennels. Giardia-specific coproantigen was examined by ELISA kit (SNAP(®) Giardia, IDEXX Laboratories, Inc., Maine, USA). Other intestinal parasites were determined microscopically using the formalin-ethyl acetate sedimentation technique. Overall prevalences of two genera of protists, Giardia spp. and Cystoisospora spp., were 25.7 and 1.2 %, respectively. The prevalence of helminthes was recorded as: Toxocara canis 0.2 %, Toxascaris leonina 0.9 %, Ancylostoma caninum 0.2 %, Trichuris vulpis 2.1 %, and Spirometra erinacei 0.4 %. According to age categories, Giardia spp., Cystoisospora spp., and T. leonina in <1-year-old dogs were significantly more prevalent than in ≥ 1-year-old dogs (61.0 vs. 19.8 %, P < 0.0001; 7.3 vs. 0.2 %, P < 0.0001; and 4.9 vs. 0.2 %, P < 0.001; respectively). With respect to fecal condition, the prevalences of T. leonina and T. vulpis were significantly higher in unformed stool dogs than in formed ones (2.4 vs. 0 %, P < 0.01, and 4.3 vs. 0.8 %, P < 0.05, respectively). In all of the breeding kennels except for one kennel, intestinal parasite infections were found at the high prevalent, ranging from 16.0 to 70.0 %. PMID:25627028

  9. The Effects of Run-of-River Hydroelectric Power Schemes on Fish Community Composition in Temperate Streams and Rivers.

    Gary S Bilotta

    Full Text Available The potential environmental impacts of large-scale storage hydroelectric power (HEP schemes have been well-documented in the literature. In Europe, awareness of these potential impacts and limited opportunities for politically-acceptable medium- to large-scale schemes, have caused attention to focus on smaller-scale HEP schemes, particularly run-of-river (ROR schemes, to contribute to meeting renewable energy targets. Run-of-river HEP schemes are often presumed to be less environmentally damaging than large-scale storage HEP schemes. However, there is currently a lack of peer-reviewed studies on their physical and ecological impact. The aim of this article was to investigate the effects of ROR HEP schemes on communities of fish in temperate streams and rivers, using a Before-After, Control-Impact (BACI study design. The study makes use of routine environmental surveillance data collected as part of long-term national and international monitoring programmes at 23 systematically-selected ROR HEP schemes and 23 systematically-selected paired control sites. Six area-normalised metrics of fish community composition were analysed using a linear mixed effects model (number of species, number of fish, number of Atlantic salmon-Salmo salar, number of >1 year old Atlantic salmon, number of brown trout-Salmo trutta, and number of >1 year old brown trout. The analyses showed that there was a statistically significant effect (p<0.05 of ROR HEP construction and operation on the number of species. However, no statistically significant effects were detected on the other five metrics of community composition. The implications of these findings are discussed in this article and recommendations are made for best-practice study design for future fish community impact studies.

  10. Recruitment in a Colorado population of big brown bats: Breeding probabilities, litter size, and first-year survival

    O'Shea, T.J.; Ellison, L.E.; Neubaum, D.J.; Neubaum, M.A.; Reynolds, C.A.; Bowen, R.A.

    2010-01-01

    We used markrecapture estimation techniques and radiography to test hypotheses about 3 important aspects of recruitment in big brown bats (Eptesicus fuscus) in Fort Collins, Colorado: adult breeding probabilities, litter size, and 1st-year survival of young. We marked 2,968 females with passive integrated transponder (PIT) tags at multiple sites during 2001-2005 and based our assessments on direct recaptures (breeding probabilities) and passive detection with automated PIT tag readers (1st-year survival). We interpreted our data in relation to hypotheses regarding demographic influences of bat age, roost, and effects of years with unusual environmental conditions: extreme drought (2002) and arrival of a West Nile virus epizootic (2003). Conditional breeding probabilities at 6 roosts sampled in 2002-2005 were estimated as 0.64 (95% confidence interval [95% CI] = 0.530.73) in 1-year-old females, but were consistently high (95% CI = 0.940.96) and did not vary by roost, year, or prior year breeding status in older adults. Mean litter size was 1.11 (95% CI = 1.051.17), based on examination of 112 pregnant females by radiography. Litter size was not higher in older or larger females and was similar to results of other studies in western North America despite wide variation in latitude. First-year survival was estimated as 0.67 (95% CI = 0.610.73) for weaned females at 5 maternity roosts over 5 consecutive years, was lower than adult survival (0.79; 95% CI = 0.770.81), and varied by roost. Based on model selection criteria, strong evidence exists for complex roost and year effects on 1st-year survival. First-year survival was lowest in bats born during the drought year. Juvenile females that did not return to roosts as 1-year-olds had lower body condition indices in late summer of their natal year than those known to survive. ?? 2009 American Society of Mammalogists.

  11. To Explore the Clinical Nutritional Iron Deficiency Anemia of Infantile%小儿营养性缺铁性贫血的临床分析

    田秀华

    2015-01-01

    Objective To analyze nutritional iron deficiency anemia of infantile.Methods Selected 90 cases nutritional iron deficiency anemia of infantile with clinical data retrospective summary, analysis the clinical characteristics and related risk factors. Results 61.11% of nutritional iron deifciency anemia children at age 7 months to 1 year old, Rural children more than city children, exclusive breastfeeding not add side dish was susceptible to ischemic anemia.Conclusion 7 months to 1 year old belongs to infantile nutritional iron deifciency anemia intensiifes period, prevention timely, diagnosis, treatment and reduce the incidence of the disease.%目的:分析小儿营养缺铁性贫血情况。方法回顾性总结90例小儿营养缺铁性贫血患者临床资料,分析其临床发病特点和相关危险因素。结果61.11%儿童营养缺铁性贫血年龄为7个月~1岁;农村儿童多于城市儿童;纯母乳喂养未添加辅食儿童易患缺血性贫血。结论7个月~1岁属于小儿营养缺铁性贫血高发期,应该及时预防、诊断、治疗,降低该病发生率。

  12. The recovery over several seasons of 15N-labelled fertilizer applied to Miscanthusxgiganteus ranging from 1 to 3 years old

    In a field experiment 60 kg N ha-1 of 15N-labelled fertilizer was applied to Miscanthusxgiganteus planted 1, 2 or 3 years previously. Plots were destructively sampled at senescence 1, 2 or 3 years after labelled N was applied with aerial biomass harvested in intervening years. The objective was to quantify N uptake and distribution within the plant, labelled N remaining in the soil (0-50 cm) and overall losses. We report results for the 2nd and 3rd years and compare them to 1st year data previously published. Total biomass more than doubled over 2 years of growth but N concentration did not change. More labelled N was recovered by 3-year-old plants (65%) than by 2-year-old plants (55%) or 1-year-old plants (38%). Between 19% and 26% was found in the soil (0-50 cm) and more than 85% of this N was in topsoil (0-23 cm). Total recovery in plant and soil was 60-71% for 1-year-old plants, 76-81% for 2-year-old plants and 84% for 3-year-old plants. Overall losses (18-24%) from 2- and 3-year-old plants are similar to those from arable and permanent grass crops on the same soil type given similar amounts of N. Labelled (and unlabelled) N stored in rhizomes will take several years to decline because of transfers between rhizomes and shoots. Similarly, labelled N remaining in soil will decline slowly over many years; any N mineralized in subsequent years will be subject to plant uptake and/or loss

  13. Forest age stands affect soil respiration and litterfall in a Black pine forest managed by a shelterwood system in the Central Spain?

    Hedo de Santiago, Javier; Borja, Manuel Esteban Lucas; Candel, David; Viñegla Pérez, Benjamin

    2016-04-01

    This study aims to investigate the effects that stand age and forest structure generates on soil respiration and litterfall quantity. The effect of stand age on these variables was studied in a shelterwood system Spanish Black pine chronosequence in central Iberian Peninsula composed of 0-20, 20-40, 40-60, 60-80, 80-100-year-old. For each stand age, six forest stands with similar characteristics of soil type and site preparation were used. Also, a forest area ranging 80-120 years old and without forest intervention was selected and used as control. We also measured organic matter, C:N ratio, soil moisture and pH in the top 10 mineral soil at each compartment. Soil respiration measurements were carried out in three time points (3, 8 and 12 days). Results showed a clear trend in soil respiration, comparing all the experimental areas. Soil respiration showed the same trend in all stands. It initially showed higher rates, reaching stability in the middle of the measurement process and finally lightly increasing the respiration rate. The older stands had significantly higher soil respiration than the younger stands. Soil organic matter values were also higher in the more mature stands. C:N ratio showed the opposite trend, showing lower values in the less mature stands. More mature stands clearly showed more quantity of litterfall than the younger ones and there was a positive correlation between soil respiration and litterfall. Finally, the multivariate PCA analysis clearly clustered three differenced groups: Control plot; from 100 to 40 years old and from 39 to 1 years old, taking into account both soil respiration and litterfall quantity, also separately. Our results suggest that the control plot has a better soil quality and that extreme forest stand ages (100-80 and 19-1 years old) and the associated forest structure generates differences in soil respiration.

  14. Infant Mortality Risk and Paternity Certainty Are Associated with Postnatal Maternal Behavior toward Adult Male Mountain Gorillas (Gorilla beringei beringei.

    Stacy Rosenbaum

    Full Text Available Sexually selected infanticide is an important source of infant mortality in many mammalian species. In species with long-term male-female associations, females may benefit from male protection against infanticidal outsiders. We tested whether mountain gorilla (Gorilla beringei beringei mothers in single and multi-male groups monitored by the Dian Fossey Gorilla Fund's Karisoke Research Center actively facilitated interactions between their infants and a potentially protective male. We also evaluated the criteria mothers in multi-male groups used to choose a preferred male social partner. In single male groups, where infanticide risk and paternity certainty are high, females with infants <1 year old spent more time near and affiliated more with males than females without young infants. In multi-male groups, where infanticide rates and paternity certainty are lower, mothers with new infants exhibited few behavioral changes toward males. The sole notable change was that females with young infants proportionally increased their time near males they previously spent little time near when compared to males they had previously preferred, perhaps to encourage paternity uncertainty and deter aggression. Rank was a much better predictor of females' social partner choice than paternity. Older infants (2-3 years in multi-male groups mirrored their mothers' preferences for individual male social partners; 89% spent the most time in close proximity to the male their mother had spent the most time near when they were <1 year old. Observed discrepancies between female behavior in single and multi-male groups likely reflect different levels of postpartum intersexual conflict; in groups where paternity certainty and infanticide risk are both high, male-female interests align and females behave accordingly. This highlights the importance of considering individual and group-level variation when evaluating intersexual conflict across the reproductive cycle.

  15. Human exposure to trace elements through the skin by direct contact with clothing: Risk assessment

    Metals in textile products and clothing are used for many purposes, such as metal complex dyes, pigments, mordant, catalyst in synthetic fabrics manufacture, synergists of flame retardants, antimicrobials, or as water repellents and odour-preventive agents. When present in textile materials, heavy metals may mean a potential danger to human health. In the present study, the concentrations of a number of elements (Al, As, B, Ba, Be, Bi, Cd, Co, Cr, Cu, Fe, Hg, Mg, Mn, Mo, Ni, Pb, Sb, Sc, Se, Sm, Sn, Sr, Tl, V, and Zn) were determined in skin-contact clothes. Analysed clothes were made of different materials, colours, and brands. Interestingly, we found high levels of Cr in polyamide dark clothes (605 mg/kg), high Sb concentrations in polyester clothes (141 mg/kg), and great Cu levels in some green cotton fabrics (around 280 mg/kg). Dermal contact exposure and human health risks for adult males, adult females, and for <1-year-old children were assessed. Non-carcinogenic and carcinogenic risks were below safe (HQ<1) and acceptable (<10−6) limits, respectively, according to international standards. However, for Sb, non-carcinogenic risk was above 10% of the safety limit (HQ>0.1) for dermal contact with clothes. - Highlights: • We determined in skin-contact clothes the concentrations of a number of metals. • Dermal contact exposure and health risks for adults and for 1-year-old children were assessed. • Carcinogenic risks were considered as acceptable (<10−6). • For non-carcinogenic risks, only Sb exceeded a 10% of the HQ for dermal contact with clothes

  16. Amazon Paleofires Records: Comparison Between Land Use Change and Palaeoclimatic Events

    Cordeiro, R. C.; Turcq, B.; Moreira, L. S.; Rodrigues, R. D. A.; Simões Filho, F. L.; Martins, G. S.; Santos, A. B.; Barbosa, M.; da Conceição, M. C. G.; Rodrigues, R. D. C.; Evangelista, H.; Moreira-Turcq, P. F.; Penido, Y. P.; Sifeddine, A.; Seoane, J.

    2014-12-01

    Interpreting the geological record of Amazon biomass combustion requires comparing charcoal accumulation rates in various biomes at different time scales. Charcoal accumulation rates, a proxy for palaeofire records, were obtained in sediment cores from Amazon lakes surrounded by several vegetation types and from a reservoir in an intense land use change region. The records presented in this study were obtained in the following areas i) a reservoir in Alta Floresta region (northern Mato Grosso State); ii) Lago do Saci (southern Pará State), a lake close to Alta Floresta and located at the southern border of Pará State; iii) a bog in an ecotone area in the Humaitá region (southern Amazonas State); iv) lakes in lateritic iron crust of the Carajás Hills (southeastern Pará State); v) Lago Comprido, a floodplain lake close to the Amazon River and surrounded by tropical rain forest (Monte Alegre, Pará State; vi) Lagoa da Pata in the Morro dos Seis Lagos alkaline complex (São Gabriel da Cachoeira, Amazonas State) and vii) Lago Caracaranã, a secluded lake in the northern Amazon cerrado (Roraima State). The highest charcoal accumulation rates were observed for modern records related to an intense change in land use at Alta Floresta, which had no precedent during the Holocene history of the Amazon. High charcoal accumulation rates that were observed in the Carajás region during low lake level phases in the Amazon in the mid-Holocene were comparable to those at the onset of the human settlement in Alta Floresta region. An increase in charcoal accumulation rate was observed in the late Holocene when the lake level was high, suggesting an interaction between climates and human presence. Low charcoal accumulation rates are typical of modern high rainfall environments, as observed in Lagoa da Pata where the environment is not susceptible to occurrences of wildfires even during relatively drier climatic phases. Low charcoal accumulation rates also exist in the relatively

  17. O efeito do plasma rico em plaquetas no reparo de lesões musculares em ratos

    Marcelo Luiz Quarteiro

    2015-10-01

    Full Text Available resumo Objetivo: A necessidade de opções terapêuticas para lesões musculares, cada vez mais fre quentes entre os esportistas, fundamentou este estudo experimental, cujo objetivo foi avaliar os efeitos histológicos do plasma rico em plaquetas (PRP no reparo do tecido mus cular de ratos. Métodos: O PRP foi obtido por dupla centrifugação do sangue de cinco animais. Em 30 ratos, foi produzido um trauma no terço médio do ventre do músculo gastrocnêmio de cada mem bro traseiro. Essas lesões não receberam tratamento em seis ratos (12 patas. Em 24 ratos, injeções intralesionais de soro fisiológico a 0,9% e de PRP foram aplicadas nas patas esquer das e direitas, respectivamente. Amostras do tecido tratado e não tratado foram avaliadas histologicamente sete e 21 dias após os procedimentos. Resultados: A quantidade de colágeno nas lesões tratadas com PRP foi significativamente menor do que a das demais lesões na avaliação feita sete dias após o procedimento, mas se equiparou à dos demais grupos na avaliação feita no 21° dia. Houve aumento significativo (p < 0,001 na quantidade de colágeno do sétimo para o 21° dia nas lesões tratadas com PRP, o que não ocorreu nas lesões tratadas de outra forma. O processo inflamatório se mostrou mais intenso nas lesões tratadas com PRP em comparação com as lesões dos outros grupos de tratamento na avaliação feita sete dias após o procedimento; todavia, os aspectos mor fológicos dessas lesões se mostraram similares ao das lesões não tratadas 21 dias após o procedimento. Conclusão: OPRP promoveu completa restituição tecidual entre o sétimo e o 21° dia em lesões musculares experimentais.

  18. Efeito analgésico e anti-inflamatório do extrato aquoso das folhas de trevo-roxo (Scutellaria agrestis A. St.-Hil. ex Benth. - Lamiaceae em roedores

    A.B. Oliveira

    2014-06-01

    Full Text Available Scutellaria agrestis é utilizada por comunidades ribeirinhas do Amazonas principalmente para o tratamento de otites por via tópica utilizando-se o extrato bruto obtido por maceração. O presente trabalho visou investigar preliminarmente o perfil fitoquímico, a segurança toxicológica e as ações analgésica, anti-inflamatória e antiedematogência do extrato aquoso das folhas de S. agrestis. Foram coletados 80 indivíduos da espécie no horto medicinal da Universidade Nilton Lins, Manaus, Brasil. O perfil fitoquímico foi obtido por meio de prospecção da droga vegetal para heterosídeos cianogênicos, terpenos, compostos fenólicos e alcaloides. A toxicologia foi avaliada pelo teste de toxicidade aguda. As atividades analgésicas/ anti-inflamatórias foram analisadas por meio dos testes de formalina em camundongos e a atividade antiedematogência, pelo teste de edema de pata em ratos. Os metabólitos detectados foram fenóis (taninos hidrolisáveis, cumarinas e várias classes de flavonoides e terpenos (esteroides livres, saponinas. Não foi possível estabelecer DL50, haja visto que o extrato não provocou a morte de nenhum animal durante o teste de toxicidade aguda, provavelmente devido à ausência de heterosídeos cianogênicos na sua composição. Apesar de não provocar morte, considerou-se que o extrato apresenta uma discreta toxicidade, uma vez que foi observada a ocorrência de espasmos na primeira hora de observação dos animais. O extrato apresentou ainda efeito analgésico e anti-inflamatório significativo nas doses de 30, 100 e 300 mg/kg pelo teste da formalina, sendo o resultado na maior dose equivalente ao obtido com a droga padrão (fentanil. No entanto, não observamos efeito antiedematogênico nas doses testadas durante as 5 horas de registro do edema de pata. Os resultados obtidos nesta pesquisa conferem base científica preliminar quanto à segurança e ao efeito analgésico e antiinflamatório da droga vegetal, o

  19. A Mídia e o Processo de Pulverização da Figura do Sujeito Cerebral

    Gustavo Zambenedetti

    2012-01-01

    Full Text Available La expresión “sujeto cerebral” se refiere a una forma de relación consigo que expresa los modos contemporáneos de subjetivación, los cuales tienen tomado el cerebro como referencia para el sentimiento de identidad, definiendo lo que somos y lo que/como debemos ser. Nuestro objetivo es analizar el modo como la figura del sujeto cerebral es vehiculada en los medios de comunicación. Este análisis se hará a partir de reportajes presentados en dos telediarios brasileños. Entendemos que los reportajes posibilitan la comprensión del modo como el lenguaje científico-académico es agregado en el cotidiano, propiciando una ‘difusión’ y naturalización de la figura del sujeto cerebral. Desde la perspectiva de la ontología del presente, propuesta por Michel Foucault, proponemos cambiar lo que los reportajes vehiculan de la posición de evidencia para la posición de problematización. Al analizar reportajes que vehiculan lo que ocurre en el cerebro como explicación para comportamientos y trastornos mentales, discutimos la ambigüedad del significado de la palabra “explicación”, así como la diferencia entre el cerebro ser entendido como causa de determinado fenómeno o condición de posibilidad para que el ocurra. Desde tres reportajes que vehiculan informaciones sobre diferencias o similitudes entre los cerebros, respectivamente, de homosexuales y heterosexuales, pedófilos y no pedófilos, psicópatas y no psicópatas, discutimos las diferencias entre la delimitación de hechos y la atribución de valores a tales hechos, así como posibles efectos de la confusión entre los dos procesos. Presentamos todavía, una serie de reportajes en los que el cerebro surge como matriz explicativa para fenómenos muy diversos, apuntando el movimiento de generalización y difusión de la figura del sujeto cerebral. Afirmamos un posicionamiento político que no desconsidera el avance de las neurociencias y la importancia del cerebro como uno de

  20. SPATA17的单核苷酸多态性可能是日本减速分裂阻滞患者的遗传危险因素

    Toshinobu Miyamoto[日本; Akira Tsujimura[日本; Yasushi Miyagawa[日本; Eitetsu Koh[日本; Naoko Sakugawa[日本; Hiroe Miyakawa[日本; Hisashi Sato[日本; Mikio Namiki[日本; Akihiko Okuyama[日本; Kazuo Sengoku[日本

    2009-01-01

    遗传机制已经成为一些男性患者不育的一个病因。近年来,通过人类睾丸组织的基因芯片分析鉴定了10个与人类精子发生相关的新基因。其中一个是精子发生相关17基因(SPATA17)。为了研究是否SPATA17基因缺陷与减数分裂导致的无精症有关,我们进行了突变分析,将18个日本减数分裂导致的无精症患者的SPATA17编码区域进行了测序,以及统计分析,其中包括18个减数分裂阻滞患者,20个唯支持细胞综合征(SCOS)患者和96个健康对照男性。没有SPATA17发生突变。但是,减数分裂阻滞患者组检测到了3个单核苷酸多态性(cSNPs:SNPI—SNP3)。减数分裂阻滞患者与其他患者的SNP1和SNP2基因型与等位基因频率无明显不同。但是,SNP3的等位基因频率在减数分裂阻滞患者组中明显升高(P〈0.05)。这项研究表明,sPATA17在人类精子发生,尤其是减数分裂中可能起关键性作用。

  1. O papel do esteroide anabolizante sobre a hipertrofia e força muscular em treinamentos de resistência aeróbia e de força

    Everton Crivoi do Carmo

    2011-06-01

    Full Text Available INTRODUÇÃO: Os efeitos dos esteroides anabolizantes (EA sobre a massa muscular e força são controversos e dependentes do treinamento realizado e das fibras musculares recrutadas. Com isso, o objetivo deste estudo foi avaliar os efeitos da associação de EA ao treinamento de força ou aeróbio sobre a hipertrofia e força muscular. MÉTODOS: Ratos Wistar (42 foram divididos em seis grupos: sedentário (SC, n = 7, sedentário anabolizante (SA, n = 7, treinado natação controle (TNC, n = 7, treinado natação anabolizante (TNA, n = 7, treinado força controle (TFC, n = 7 e treinado força anabolizante (TFA, n = 7. O EA foi administrado duas vezes por semana (10mg/kg/semana. Os protocolos de treinamento foram realizados durante 10 semanas, cinco sessões semanais. Foram avaliadas a hipertrofia dos músculos sóleo, plantar e gastrocnêmio (massa muscular corrigida pelo comprimento da tíbia, a proteína total muscular (Bradford e a força muscular em patas traseiras (testes de resistência à inclinação. RESULTADOS: Não foram observadas diferenças significantes na hipertrofia do músculo sóleo. Os grupos TFC e TFA apresentaram, respectivamente, hipertrofia de 18% e 31% no músculo plantar comparado ao grupo SC. A hipertrofia foi 13% maior no grupo TFA em relação ao grupo TFC. Resultados semelhantes foram encontrados no músculo gastrocnêmio. Os grupos TFC e TFA apresentaram significantes aumentos na quantidade total de proteína nos músculos plantares, sendo essa mais pronunciada no grupo TFA e positivamente correlaciona a hipertrofia muscular. Observamos aumento de força nas patas traseiras nos grupos TCF e TAF. CONCLUSÃO: A administração de EA ou sua associação ao treinamento aeróbio não aumenta a massa muscular e força. Porém, à associação ao treinamento de força leva a maior hipertrofia muscular em fibras glicolíticas. Portanto, o tipo de treinamento físico, recrutamento muscular e características das fibras

  2. Efeito do gel da babosa (Aloe barbadensis Mill. associado ao ultrassom em processo inflamatório agudo Effect of aloe (Aloe barbadensis Mill. gel combined with ultrasound in the acute inflammatory process

    A.L.M Maia-Filho

    2011-01-01

    Full Text Available O presente trabalho teve por objetivo analisar a ação antiinflamatória do gel da Babosa a 2% (Aloe barbadensis Mill. associado ao Ultrassom pulsátil no modelo de edema de pata. Foram utilizados 25 ratos Wistar, (200-250 g, divididos em 5 grupos de 5 animais cada. Grupo1 (controle: ratos tratados com solução salina a 0,9%; Grupo 2: ratos tratados topicamente com gel de A. barbadensis Mill. a 2%; Grupo 3: animais tratados com Ultrassom; Grupo 4: ratos tratados com gel de A. barbadensis Mill. a 2% associado ao Ultrassom; Grupo 5 (controle positivo: ratos tratados com Indometacina na dose de 5 mg Kg-1. Os animais dos grupos 1 e 5 receberam os respectivos tratamentos por via intra-peritoneal 30 minutos antes da injeção intra-plantar de carragenina e os grupos 2, 3 e 4 foram tratados por aplicação tópica de gel de A. barbadensis Mill. a 2%, Ultrassom pulsátil e gel de A. barbadensis Mill. associado ao Ultrassom respectivamente 15 minutos após a indução do edema. Os animais do grupo 04 demonstraram redução significativa do edema quando comparados ao grupo controle, ao mesmo tempo, que se mostrou comparável à indometacina. Observou-se que o gel de aloe associado à fonoforose é capaz reduzir a formação do edema de pata em ratosThis work aimed to evaluate the anti-inflammatory action of 2% aloe (Aloe barbadensis Mill. gel combined with pulsed ultrasound in the paw edema model. Twenty-five Wistar rats (200-250 g were divided into 5 groups of 5 animals each. Group1 (control: rats treated with 0.9% saline; Group 2: rats topically treated with 2% aloe gel; Group 3: rats treated with ultrasound; Group 4: rats treated with 2% aloe gel combined with ultrasound; Group 5 (positive control: rats treated with indomethacin at 5 mg Kg-1. Animals of groups 1 and 5 were intraperitoneally treated 30 min before intraplantar carrageenan injection and groups 2, 3 and 4 were treated by topical application of 2% aloe gel, pulsed ultrasound and aloe gel

  3. A síndrome anserina Anserine syndrome

    Milton Helfenstein Jr

    2010-06-01

    Full Text Available Dor no joelho é uma condição comum na clínica diária e a patologia anserina, também conhecida como pata de ganso, tem sido considerada uma das principais causas. O diagnóstico tem sido realizado de maneira eminentemente clínica, o que tem gerado equívocos. Os pacientes queixam-se tipicamente de dor na parte medial do joelho, com sensibilidade na porção ínferomedial. Estudos de imagem têm sido realizados para esclarecer se tais pacientes possuem bursite, tendinite ou ambos os distúrbios na região conhecida como pata de ganso. Entretanto, o defeito estrutural responsável pelos sintomas permanece desconhecido, motivo pelo qual preferimos intitular como "Síndrome Anserina". O diabetes mellitus é um fator predisponente bem reconhecido. O sobrepeso e a osteoartrite de joelho parecem ser fatores adicionais de risco, contudo, seus papéis na gênese da moléstia ainda não são bem entendidos. O tratamento atual inclui anti-inflamatório, fisioterapia e infiltração de corticoide, com evolução muito variável, que oscila entre 10 dias e 36 meses. A falta de conhecimento sobre a etiofisiopatologia e dados epidemiológicos exige futuros estudos para esse frequente e intrigante distúrbio.Knee pain is a common complaint in clinical practice, and pes anserinus tendino-bursitis syndrome (PATB has been frequently diagnosed based only on clinical features that may cause equivocal interpretations. Patients complain of characteristic spontaneous medial knee pain with tenderness in the inferomedial aspect of the joint. Studies with different imaging modalities have been undertaken during the last years to identify whether these patients suffer from bursitis, tendinitis, or both. Nevertheless, little is known regarding the structural defect responsible for this disturbance. Due to these problems and some controversies, we suggest the term "anserine syndrome" for this condition. Diabetes Mellitus is a known predisposing factor for this syndrome

  4. Japan, quality tourist destiny: a learner option for Colima

    Irma Magaña Carrillo

    2007-11-01

    Full Text Available In this research feature presentation some results are presented as "A Propose Plan to implement a Culture with Quality Control in Tourism Business making Mexico an Attractive site in the Asia-Pacific market and Active within the PATA organism in the XXI Millennium". Which was performed in Japan from 2001 to 2004. This thesis acquires the category of qualitative and emergent and it arouse as a first attempt in reaching the point of a systematic application of the theory of the Model for Total Quality through the Total Control of Quality to the tourist product its basis and service as well as to be delivered with the purpose of giving benefits to the Mexican tourist sector, so that it would provide a gaining position of tourist from Asia, mostly Japanese and in this way it would take advantage Mexico’s participation in PATA.During the search field wok several investigation works were carried out, such as depth interviews to top level management (owner and or proprietor manager level of service area from a ransom selection of some Japanese enterprises. It had the start point in the premise that most of the chosen Japanese business selected for search, are managed with own forms of management to serve the base service and deliver it with quality to reach the external customer satisfaction. In this presentation the analysis result of some interviews are shown. For the planned interviews, this search process used some techniques to get precise information whit sound impact on the research about the following key factors: a customer satisfaction in all their needs, b customer satisfaction in their expectations, c customer loyalty to their supplier.Data collected are qualitative and its informant source was bases on the facts of the way they live the reality of serving the base service or product, which whit its delivery and know-how to their external customer. Techniques application has been carefully revised inside the Japanese cultural context

  5. Efeitos de um minuto e dez minutos de deambulação em ratos com artrite induzida por adjuvante completo de Freund sobre os sintomas de dor e edema

    Raquel Pinheiro Gomes

    2014-04-01

    Full Text Available Este estudo avaliou o efeito de dois protocolos de exercício na nocicepção, edema e migração celular em ratos com artrite induzida por CFA. Ratos Wistar fêmeas (200 - 250 g, n = 50 foram induzidos à monoartrite por adjuvante completo de Freund (CFA, Mycobacterium butyricum; 0,5 mg/mL; 50 μL na articulação do joelho direito (TF; n = 24 ou tornozelo direito (TT; n = 26. A incapacitação articular foi mensurada pelo tempo de elevação da pata (TEP; s em 1 minuto de avaliação. O edema do joelho ou tornozelo foi avaliado pela medida do diâmetro articular (AD, cm e pelo edema de pata (EP, mL, respectivamente. Ambos foram avaliados durante 10 dias consecutivos. Dois protocolos de exercício foram realizados: (a exercício constante (TF, n = 6; TT, n = 6, realizando 1 minuto diário de exercício no cilindro (3 r.p.m.; (b exercício variável (TF, n = 6; TT, n = 7, exercício com aumento de 1 minuto por dia, totalizando 10 minutos no último dia. Os grupos-controle (TF, n = 12; TT, n = 13 não realizaram exercício. Após 10 dias, os animais foram eutanasiados para contagem total (células/mm3 e diferencial (mononucleares e polimorfos nucleares; células/mm3 de leucócitos do tecido inflamado. O exercício variável inibiu a incapacitação e o edema em ambas as articulações. Entretanto, reduziu a migração total de leucócitos apenas na articulação TF. O exercício constante inibiu o edema nas duas articulações e reduziu a migração total de leucócitos da articulação TT. Porém, não reduziu a incapacitação. O exercício variável pareceu ser mais efetivo em reduzir os parâmetros inflamatórios em comparação com o exercício constante.

  6. Potencial antioxidante in vitro das folhas da Bauhinia ungulata L.

    Cristiane da Silva Paula

    2014-04-01

    Full Text Available A Bauhinia ungulata L. (Pata de Vaca é uma planta nativa do Brasil, encontrada principalmente na região Amazônica, Cerrado e Mata Atlântica, utilizada popularmente no tratamento do diabetes. Este trabalho descreve uma análise in vitro do potencial antioxidante do extrato bruto etanólico e frações (hexano, clorofórmio, acetato de etila e hidroalcoólica residual obtidos de folhas desta espécie, através de três metodologias distintas: 1 captura de radical orgânico 2,2-difenil-1-picril-hidrazila-DPPH•, 2 redução do complexo fosfomolibdênio e 3 quantificação de produtos formados durante a peroxidação de lipídios (TBARS. O potencial antioxidante do extrato e frações foi variável de acordo com a metodologia utilizada com destaque para a fração acetato de etila que apresentou atividade similar aos padrões utilizados nos três métodos. Os resultados obtidos fornecem evidências de que as folhas de B. ungulata L. são uma potencial fonte de antioxidantes naturais, estimulando novos estudos que objetivem a produção de possíveis medicamentos destinados ao tratamento de patologias associadas aos radicais livres.

  7. Convolution powers in the operator-valued framework

    Anshelevich, Michael; Fevrier, Maxime; Nica, Alexandru

    2011-01-01

    We consider the framework of an operator-valued noncommutative probability space over a unital C*-algebra B. We show how for a B-valued distribution \\mu one can define convolution powers with respect to free additive convolution and with respect to Boolean convolution, where the exponent considered in the power is a suitably chosen linear map \\eta from B to B, instead of being a non-negative real number. More precisely, the Boolean convolution power is defined whenever \\eta is completely positive, while the free additive convolution power is defined whenever \\eta - 1 is completely positive (where 1 stands for the identity map on B). In connection to these convolution powers we define an evolution semigroup related to the Boolean Bercovici-Pata bijection. We prove several properties of this semigroup, including its connection to the B-valued free Brownian motion. We also obtain two results on the operator-valued analytic function theory related to the free additive convolution powers with exponent \\eta. One of...

  8. STUDI PERKEMBANGAN STRUK TUR KOMUNITAS IKAN KARANG DI TERUMBU BUATAN BERBENTUK HEXADOME PADA BERBAGAI KONDISI PERAIRAN DI KABUPATEN BULELENG, BALI

    YUNALDI YUNALDI

    2015-06-01

    Full Text Available Artificial reefs are made to act as temporary substitutes for small areas of damaged original reef. The structures attract fish and other marine organisms, which can eventually be exploited (e.g. for human food, so it is expected that they will form the basis around which natural reefs can grow and recover. The purpose of this study is to document recruitment of organisms onto the artificial structures, evaluate the effectiveness of the structures in terms of shape and recruitment potential, and use the recruitment information to show which species occur in the surrounding reefs. This research was conducted from May-July 2010 in north Bali, in the Village District Gerokgak Patas, Kampung Baru Village in Buleleng District, and Penuktukan Village, Kecematan Tejakula. The research method used was a visual census method to determine the number of fish species and fish abundance on artificial reefs at three different locations. Three replications were performed at each location. 2481 individuals from 18 families (38 species of reef fish were observed. The area with the greatest abundance of fish and the highest number of fish species was in Kampung Baru, with 1170 individuals from 21 species of fish. Dominant reef fish species were Plotosus lineatus (Cat Fish - 510 individuals, Pomacentrus auriventris (Goldbelly damsel- 256 individuals, Dascyllus trimaculatus (Three spot damsel - 335 individuals, Pseudanthias squamipinnis (Lyretail Anthias - 320 individuals. A Sorensen analysis showed that reef fish communities on the artificial reefs in the form of 'hexadomes' were not derived from the surrounding reefs.

  9. The Patient’s Experience of the Psychosocial Process That Influences Identity following Stroke Rehabilitation: A Metaethnography

    E. Hole

    2014-01-01

    Full Text Available Background and Purpose. Patient experience is increasingly being recognised as a key health outcome due to its positive correlation with quality of life and treatment compliance. The aim of this study was to create a model of how patient’s experiences of rehabilitation after stroke influence their outcome. Methods. A metaethnography of qualitative articles published since 2000 was undertaken. A systematic search of four databases using the keywords was competed. Original studies were included if at least 50% of their data from results was focused on stroke survivors experiences and if they reflected an overarching experience of stroke rehabilitation. Relevant papers were appraised for quality using the COREQ tool. Pata analysis as undertaken using traditional processes of extracting, interpreting, translating, and synthesizing the included studies. Results. Thirteen studies were included. Two themes (1 evolution of identity and (2 psychosocial constructs that influence experience were identified. A model of recovery was generated. Conclusion. The synthesis model conceptualizes how the recovery of stroke survivors’ sense of identity changes during rehabilitation illustrating changes and evolution over time. Positive experiences are shaped by key psychosocial concepts such as hope, social support, and rely on good self-efficacy which is influenced by both clinical staff and external support.

  10. Interacciones de pesquerías ribereñas en Bahía Magdalena-Almejas, Baja California Sur

    Miguel A. Ojeda Ruiz de la Peña

    2012-01-01

    Full Text Available Con el fin de aportar al desarrollo de un modelo conceptual sobre la pesca ribereña o artesanal en el área de Bahía Magdalena-Almejas, Baja California Sur, se jerarquizó la importancia de 14 pesquerías de la región. La calificación se basó en un análisis cualitativo por puntos y en la estimación de un índice de importancia relativa, con indicadores como los promedios de captura, valor y frecuencia de registro de especies objetivo en desembarcos de embarcaciones menores, de 1998 a 2009; entre ellas están: almeja catarina, escama, camarón, callo de hacha, tiburón, jaiba, calamar, almeja pata de mula, rayas, lisa, pulpo, abulón, langosta y caracol chino. La interacción temporal entre varias de ellas es controlada por vedas oficiales, pero cuando ocurre se reconocen posibles efectos por pesca incidental e ilegal y modificaciones al ecosistema.

  11. [Biocultural study of infant malnutrition of primary cause in the urban setting of La Plata, Buenos Aires Province, Argentina].

    Ortale, S; Rodrigo, M A

    1996-06-01

    The present study, of microsocial nature, attempts to recover the biology-culture unity in the analysis of child undernutrition. A sample was selected of 52 children with primary undernutrition and their families, from the population attending the Nutritional Rehabilitation Unit of La Plata Children Hospital. The specific index was used to measure the low socioeconomic level in families with undernourished children. The mothers were interviewed to obtain information on the perception and recognition of undernutrition. Observation and interviews to the medical staff were performed in ten centers of primary health care (PHC), in order to reveal the medical practices related to this problem. The results obtained showed that the studied families conjugated the most unfavorable life conditions within poverty. Children with adequate weight at birth were nutritionally affected between 3 and 18 months of age, leading to height disorders. The representations and practices sustained by the mothers, relating undernutrition to a popular disease named "pata de cabra" lead to limitations in treatment. In PHC centers, conceptual and operative limitations are recorded for its detection and early treatment. It is concluded that cultural factors present in the two most directly related agents to child health (the mother and the PHC center) do not allow to modify the environmental effects that prematurely affect the children of poverty. PMID:9239292

  12. Autoconsumo de hierbas medicinales en usuarios con enfermedades cardio-vasculares en una comuna de Chile

    Lizet Veliz-Rojas

    2015-09-01

    Full Text Available Objetivo: Caracterizar el autoconsumo de hierbas medicinales en usuarios con enfermedades cardiovasculares. Metodología: Estudio de tipo cuantitativo y transversal, con una muestra de 257 personas. Los instrumentos recolectores de datos fueron un cuestionario y la revisión de la ficha clínica. Se utilizó un análisis descriptivo univariante apoyado en SPSS. Resultados: El 80,80% de los encuestados usó hierbas medicinales, y el 72,76% señaló no informar esta práctica al equipo de salud. Las hierbas medicinales más utilizadas para el control de la enfermedad cardiovascular fueron: el limón (20,6% para bajar la presión arterial, la pata de vaca (7% para reducir la glicemia y la alcachofa (3,5% para controlar el colesterol. Conclusiones: La mayoría de los participantes recurrieron a las hierbas medicinales, pese a ser una práctica de autocuidado prevalente, no es informada al equipo de salud. Algunas hierbas utilizadas por la muestra para controlar la enfermedad cardiovascular, están descritas sus usos para otras causas. Esta situación podría reflejar el desconocimiento sobre su utilización. Se sugiere el desarrollo de estrategias para el adecuado uso de las hierbas medicinales en atención primaria, enfocado en la integralidad en salud.

  13. Demodicose suína no norte do estado do Rio de Janeiro: relato de caso

    R.L Silveira

    2012-06-01

    Full Text Available Um leitão oriundo de um criatório do norte do estado do Rio de Janeiro, mantido no biotério do Hospital Veterinário da Universidade Estadual do Norte Fluminense Darcy Ribeiro e utilizado como caso piloto de projeto de pesquisa para investigações sobre o acesso videolaparoscópico retal (NOTES - Natural Orifice Translumenal Endoscopic Surgery, foi eutanasiado e necropsiado. Amostras do ponto de acesso do tubo de inserção na região mucocutânea anal foram colhidas, fixadas em formalina neutra tamponada a 10%, processadas por inclusão em parafina e coradas pela hematoxilina e eosina para histologia. Observou-se o comprometimento de folículos que, dilatados, exibiam formações que lembravam Demodex spp. cortados em vários sentidos e, por se tratar de ácaros espécie-específicos, concluiu-se como D. phylloides. Na citopatologia, o ácaro foi recuperado e identificado a fresco, mostrando-se alongado, com quatro pares de patas ventrais e no terço anterior do corpo. Este se refere ao primeiro registro de demodicose suína no estado do Rio de Janeiro.

  14. A new genus and species of the family Lethaxonidae (Acari, Parasitengona, Hydrachnidia from the island of Coiba (Panama

    Valdecasas, A. G.

    2010-06-01

    Full Text Available Transitia carlosi n. gen. n. sp. of the family Lethaxonidae is described from the interstitial environment of a small stream in Central America. Following a morphological revision of the adult variation in the family, Transitia n. gen. is proposed, characterized by a posteriorly tapering body shape, three pairs of acetabula arranged linearly, median position of male gonopore in relation to first pair of genital acetabula and slight sexual dimorphism of male legs.

    Se describe Transitia carlosi n. gen. n. sp. de la familia Lethaxonidae del medio intersticial de un pequeño río en America Central. Tras la revisión morfológica de la variación en los adultos de la familia se propone Transitia n. gen., caracterizado por una forma del cuerpo estrechada posteriormente, tres pares de acetábulas dispuestos linealmente, posición media del gonóporo del macho en relación a los acetábulas genitales y ligero dimorfismo sexual de las patas del macho.

  15. Mayas de Yucatán, México

    Judith Ortega Canto

    2006-01-01

    Full Text Available El artículo describe y analiza el proceso de transformación de las representaciones sociales respecto a la salud/enfermedad/atención de procesos de embarazo-partopuerperio, a través de tres generaciones de parejas y la condición de género. Es a partir del papel que juega la ideología biomédica representada en las clínicas de campo de la seguridad social, y las relaciones que operan entre hombres y mujeres, que es posible distinguir los elementos protectivos y curativos, así como los elementos de tensión existentes. El trabajo muestra cómo juegan los géneros a través de tres generaciones en términos de colaboración mutua, su demanda y evaluación a la atención recibida por las parteras o a los servicios de atención alópatas, y el efecto de la medicalización sobre hombres y mujeres de la tercera generación.

  16. Is sexually transmitted fungal infection evidence for size-related mating success in Neotropical guava fruit flies?

    Ingemar Hedström

    1998-12-01

    Full Text Available The influence of wing length on mate preference was examined in natural populations of the Neotropical guava fruit fly, Anastrepha striata Schiner, at two locations in Costa Rica. Based on evidence that the fungi are transmitted during mating, site-specific infection by Laboulbeniales fungi on the body surface was used to assess mating history. Males and females that carried fungi on the legs and/or on the ventral part of the thorax (males, and on both sides of the notum and/or the dorsal base of the abdomen (females, had significantly longer wings than males and females without fungi. This suggests that individuals of both sexes with longer wings (i.e. larger individuals enjoy higher mating success. Fungus infection is more frequent in the wet than in the seasonally dry forest, possibly because hosts are available year-round in the wet forest.Se estudió poblaciones naturales de la mosca frutera Anastrepha striata Schiner, en dos lugares de Costa Rica. Los hongos Laboulbeniales se transmiten en éstas durante la cópula. Hembras y machos con hongos en las patas y/o parte ventral del tórax (machos, y en ambos lados del noto y/o base dorsal del abdomen (hembras, tenían alas significativamente más largas que los individuos no parasitados. Esto sugiere que los individuos más grandes logran más apareamientos.

  17. Hormonas de utilidad diagnóstica en Medicina Veterinaria Hormones of diagnostic value in Veterinary Medicine

    R MATAMOROS

    2002-01-01

    Full Text Available Como muchas áreas de la medicina veterinaria, la endocrinología clínica ha experimentado importantes avances en el conocimiento de la fisiología, fisiopatología y el diagnóstico de las enfermedades en los animales domésticos. La presente revisión pretende entregar la información disponible, en la actualidad, de las pruebas endocrinas más relevantes de una manera concisa y práctica, tanto para los estudiantes de medicina veterinaria que están en su etapa de residencia clínica, como para los colegas que deseen más información sobre la determinación de condiciones fisiológicas y el diagnóstico diferencial entre alteraciones endocrinas y otras patAs many areas of the veterinary medicine, clinical endocrinology has experienced significant advances in the knowledge of physiology, physiopathology and the diagnosis of diseases in domestic animals. The present review seeks to provide an up-to-date information of most currently used endocrine tests in a concise and practical way for the students of veterinary medicine that are in their clinical residence and for the colleagues that want more information on the understanding of physiologic conditions and the differential diagnosis between endocrine disorders and other pathologies

  18. Discursos homeopáticos. Hacia la legalización de la disciplina en Buenos Aires (1933-1940

    Manuel A. González Korzeniewski

    2009-05-01

    Full Text Available En este artículo se da cuenta de los argumentos publicados en las páginas de la revista Homeopatía durante los debates con distintos actores, detractores de la homeopatía, con los que se discutía el carácter legítimo de esta disciplina antes del reconocimiento jurídico de la institución que los nucleaba en Argentina. En la primera parte se presentan, descriptiva y cronológicamente, tres casos: la expulsión de un homeópata de la Universidad Nacional de La Plata, la prohibición de medicamentos homeopáticos y la pelea con el Departamento de Higiene previa a la obtención de personería jurídica. En la segunda parte, se contraponen los discursos utilizados en dichas discusiones con su contexto histórico, y se analizan a partir de dos ejes: la puesta en discusión de la dicotomía entre lo moderno y lo arcaico, y los argumentos de validez y cientificidad como categorías de legitimidad.

  19. Informes psicológicos: el sujeto doble de la Psicología y el Derecho

    Judit Bembibre-Serrano

    2006-01-01

    Full Text Available El objetivo de este estudio teórico es intentar establecer la naturaleza de algunas dificultades que enfrenta el psicólogo ante la elaboración de un informe pericial. Se centra en dos de ellas: la imposibilidad de una evaluación psicológica independiente del hecho jurídico y la confusión de la idea de sujeto que, en la práctica, tienen los diferentes tipos de profesionales implicados. Como consecuencia, asistimos a una psicologización de la Justicia, que proporciona tanto un elemento de control de los individuos como un mecanismo de conocimiento que oculta la naturaleza históricosocial subyacente a los trastornos psicológicos. En esta confusión, el juez se desdobla en terapeuta, mientras el psicólogo asume funciones de juez de instrucción y, en general, se vuelve a la concepción medieval al juzgar no el delito sino las características personales, como en el caso del psicópata. Se concluye que los problemas derivados de esta psicologización de la Justicia no tienen una solución técnica sino que requerirían una reformulación política del marco jurídico.

  20. Trasplante cardiaco

    Donato Salas-Segura

    2008-12-01

    Full Text Available La insuficiencia cardiaca es un cuadro clínico frecuente y de apreciable mortalidad. A menudo de nuestra área de atracción emergen cardiópatas con diferentes grados de discapacidad, dependientes de familiares para su atención y que requieren re-hospitalizaciones y tratamientos costosos y a pesar de ello con mal pronóstico. Las autoridades sanitarias y particularmente el estado invierten anualmente mucho dinero en el tratamiento de los enfermos que la padecen y también en la cobertura de incapacidades para estos individuos. El trasplante cardiaco se ha implementado en el mundo como una excelente opción de tratamiento de los pacientes con insuficiencia cardiaca, capaz de brindar al menos 10 años de vida a pesar de lo riguroso del seguimiento, tanto para el paciente y su familia, como para el personal medico. El Hospital R. A. Calderón Guardia inició hace un año un Programa de Trasplante Cardiaco, presentamos aquí los 2 primeros pacientes y su seguimiento.

  1. Three accounts for regional carbon emissions from both fossil energy consumption and industrial process

    In this paper, we classify the carbon emission inventories into three perspectives through a case study in Beijing: territory account (TA), production account (PA) and consumption account (CA). A single-regional–input–output (SRIO) method was used to calculate production account and consumption account with a traditional competitive input–output (IO) table. Results show that both TA and PA have the same final values, but disparity exists at the sectoral distribution level. Both PA and CA increased from 2000 to 2007, but CA was bigger than PA and increased faster than PA. This indicates that Beijing was a carbon importer with an increasing trend. Sectoral analysis shows that “melting and pressing of metals (14)”, “Nonmetal mineral products (13)” and “Petroleum processing, coking, and nuclear fuel processing (11)” have higher direct carbon emissions from production perspective (TA), whilst “Construction” and “Service” sectors have higher emissions from consumption perspective (PA and TA). High embodied emission sectors in PA/TA, particularly the “Construction” sector, deserve more attentions for carbon emission mitigation. - Highlights: • We evaluated regional carbon emissions from three accounts perspective. • Three accounts were discussed and compared by taking Beijing as a case study. • Production account was different with territory account in sectoral distribution. • Iron and steel industries were high emission sectors from territory account. • Construction sector deserved more attentions from consumption perspective

  2. Caracterização microbiológica e clínica de surtos de "red leg" em Minas Gerais e avaliação do efeito bactericida in vitro do Vantocil IB® para Aeromonas hydrophila Microbiological and clinical characterization of "red leg" outbreaks in Minas Gerais, Brazil, and evaluation of in vitro bacterial effects of Vantocil IB® for Aeromonas hydrophila

    Anna Christina de Almeida

    2000-08-01

    Full Text Available Com o objetivo da caracterização da ocorrência de "red leg" em Minas Gerais, avaliaram-se rãs jovens e adultas que apresentavam úlceras nas patas e dedos, derrame hemorrágico na pele da região ventral, incoordenação motora, altas taxas de mortalidade em adultos e abscessos hepáticos à necropsia. No cultivo de fragmentos de pele lesada e abscessos, foi isolado e identificado Aeromonas hydrophila. O efeito bactericida do VANTOCIL IB® foi superior ao permanganato de potássio, determinado pela concentração inibitória mínima para colónias isoladas.With the objective of characterizating lhe ocurrence of "red leg" in Minas Gerais, Brazill, young and adult frogs which presented in theirpads and limbs hemorragie in the skin of the ventral region, incordination, high death rate in adults and hepatic abscess at necropsy, have been evaluated. In fragment culture ofdamage skin and abscess, Aeromonas. hydrophila hás been isolated and identified. The bactericidal effect of VANTOCIL IB® was higher than that of potassium permanganate, as determinated by the minimal inhibitory concentration for isolated colonies.

  3. Atividade antiinflamatória do granulado de Calendula officinalis L. e Matricaria recutita L.

    L.R. Sartori

    2003-01-01

    Full Text Available Este trabalho descreve os resultados da atividade antiinflamatória de um granulado composto pelos extratos secos de Calendula officinalis L. e Matricaria recutita L. (GECOMR® - granulado encapsulado de Calendula officinalis e Matricaria recutita. Estas espécies são utilizadas na medicina popular devido às suas atividades antiinflamatória, antiúlcera gástrica e antiespasmódica. A redução do processo edematogênico nos grupos de animais tratados com o GECOMR foi observada para todos agentes inflamatórios testados (Carragenina, dextrana e histamina. Esta associação mostrou-se eficaz sobre os modelos de edema de pata induzidos pelas diferentes substâncias inflamatórias, com as doses de 100 e 250 mg.kg-1. A associação dos extratos hidroalcoólicos destas espécies medicinais não modificou a indicação isolada de cada uma.

  4. Notas sobre Algunas Arañas de Antioquia.

    H. Daniel

    1940-09-01

    Full Text Available Las arañas son animales del grupo de los artrópodos, que se caracterizan por la presencia de dos partes marcadamente distintas del cuerpo, la anterior, denominada cefalotórax, de la cual se desprenden las patas en número de cuatro pares, y la posterior o abdomen, que es relativamente prominente, en cuya terminación, por la parte inferior, se halla el opérculo anal rodeado generalmente de seis pequeños mamelones o hileras que son el órgano esencial para la fabricación de la tela. Por regla general, los arácnidos están provistos de glándulas secretoras de substancias tóxicas. El estudio de estos venenos y su acción en los organismos vivos y en especial en el hombre, constituye lo que se llama el araneísmo. Las arañas que hacen sus telas en los rincones de las habitaciones no presentan importancia a este respecto, pues cuando por una rara circunstancia algunas de estas arañas han picado a alguno, dicha no tiene trascendencia de ninguna especie; su presencia puede ser más bien útil, pues destruyen zancudos, polillas, etc., de modo que si no fuera por el singular adorno de sus .telas que dan aspecto de suciedad a una habitación, podría hasta conservárselas.

  5. La "Dea Artio" celta y la "Artemis" griega: Un aspecto religioso de la afinidad celto-iliria

    Martín S. RUIPÉREZ

    2009-10-01

    Full Text Available En una partida de estatuillas romanas de bronce encontradas en 1832 en Muri, en las inmediaciones de Berna (Suiza, se hallaban una figura de osa, una diosa sentada teniendo una patera con frutas, una cesta, un árbol tortuoso y un pedestal con la inscripción Deae Artioni/ Licinia Sabinilla. En seguida se vio que la diosa, el cesto y el árbol tenían su sitio señalado en el pedestal, pero hasta 1899 no se reconstruyó el grupo en su integridad al probar Vionnet que las patas de la osa habían dejado su huella sobre el pedestal, entre el árbol y la diosa (ver grabado adjunto. La inscripción aparece recogida en CIL, XI11, 5.160, y el grupo escultórico fue publicado por S. Reinach, Revue Celtique, 21, 1900, p. 288, en un artículo, al que nos referiremos después, sobre "Les survivances du totémisme chez les anciens Celtes".

  6. Enfermedades y entidades anímicas del entorno natural. Etiologías religioso-rituales y espacio-ambientales entre los toba del Chaco Central, Argentina

    Gustavo J. Martínez

    2010-05-01

    Full Text Available El trabajo documenta, en el marco del estudio de la etnomedicina de los tobas del Chaco Central (Argentina, el rol que desempeñan entidades anímicas del monte chaqueño (plantas y animales en torno a los desequilibrios ambientales y religioso-rituales, esto es aquellos que devienen de la proximidad a ambientes negativos enfermantes, o bien de la transgresión de tabúes durante el ciclo vital y de trastornos en las relaciones con seres míticos. El material analizado proviene de la observación participante, entrevistas abiertas, extensas y en profundidad e instancias de investigación participativa, junto a la documentación de campo del material etnobiológico en cuestión. Asimismo se procura interpretar, desde el punto de vista de los nativos, aspectos vinculados con la nomenclatura vernácula, las representaciones etiológicas y las principales prácticas preventivas y terapéuticas de algunas de estas dolencias, tales como las odontalgias, los orzuelos, la conjuntivitis y otros taxa locales como “laiel” o pata de cabra, entre otros. Finalmente y a partir del material documentado se discuten algunos aspectos de la relación naturaleza-cultura evidenciados en la etnomedicina toba.

  7. Carbohydrate composition of serum low and high density lipoproteins of nonhuman primate species.

    Pargaonkar, P S; Radhakrishnamurthy, B; Srinivasan, S R; Berenson, G S

    1977-01-01

    1. Carbohydrate composition of serum low and high density lipoproteins obtained from 5 nonhuman primate species (chimpanzee, patas, baboon, rhesus, and spider) and humans was studied. 2. Individual lipoproteins were isolated from pooled sera of each species by ultracentrifugal flotation between the densities 1.019-1.063 for LDL-2; 1.063-1.12 for HDL-2; and 1.12-1.21 for HDL-3. After delipidation, sialic acid, fucose, glucosamine, mannose, galactose, and glucose were determined on apo LDL-2, apo HDL-2, and apo HDL-3. 3. Glucosamine, galactose, and mannose constituted a major component of the sugars in apo LDL-2, with similar relative proportions in all species. Sialic acid, fucose, and glucose formed a minor component, the proportions of which varied greatly among the species. 4. Unlike apo LDL-2, sialic acid, fucose, and glucosamine constituted the bulk of the sugars in apo HDL-2 and apo HDL-3. Mannose, galactose, and glucose were minor components, with galactose predominating. 5. Qualitative differences were observed in electrophoretic mobilities of apo HDL-2 and apo HDL-3 on polyacrylamide gel. One faster moving band was unique to chimpanzee. 6. Intraspecies differences in the content of sialic acid and fucose of apolipoproteins may be related to lipoprotein metabolism and species susceptibility (or resistance) to either spontaneous or diet-induced atherosclerosis. PMID:233783

  8. The structure of the cyanobactin domain of unknown function from PatG in the patellamide gene cluster

    The highly conserved domain of unknown function in the cyanobactin superfamily has a novel fold. The protein does not appear to bind the most plausible substrates, leaving questions as to its role. Patellamides are members of the cyanobactin family of ribosomally synthesized and post-translationally modified cyclic peptide natural products, many of which, including some patellamides, are biologically active. A detailed mechanistic understanding of the biosynthetic pathway would enable the construction of a biotechnological ‘toolkit’ to make novel analogues of patellamides that are not found in nature. All but two of the protein domains involved in patellamide biosynthesis have been characterized. The two domains of unknown function (DUFs) are homologous to each other and are found at the C-termini of the multi-domain proteins PatA and PatG. The domain sequence is found in all cyanobactin-biosynthetic pathways characterized to date, implying a functional role in cyanobactin biosynthesis. Here, the crystal structure of the PatG DUF domain is reported and its binding interactions with plausible substrates are investigated

  9. Efeito da mosca-dos-chifres, Haematobia irritans (L. (Diptera: Muscidae, no ganho de peso de bovinos Nelore Effects of the horn fly, Haematobia irritans (L. (Diptera: Muscidae in the weight gain on Nellore cattle

    Ivo Bianchin

    2004-06-01

    Full Text Available A presente investigação foi realizada devido à escassez, no Brasil, de informações sobre os possíveis danos decorrentes da ação hematófaga da mosca-dos-chifres, Haematobia irritans (L., em bovinos da raça Nelore. O estudo foi realizado durante quatro estações chuvosas (outubro a abril, de 1991 a 1995. Em cada ano, 80 bovinos foram utilizados de acordo com os seguintes tratamentos: 28 touros com um ano de idade divididos em quatro grupos; 20 bois com idade de dois anos divididos em quatro grupos, e 32 bois com três anos e divididos em oito grupos. Metade dos grupos de animais de cada idade eram tratados contra H. irritans com intervalos de 28 dias e os demais mantidos como grupos controle. As moscas foram contadas a cada 14 dias e o peso dos bois registrado a cada 28. O número médio de mosca/animal dos grupos controle para o primeiro, segundo, terceiro e quarto anos do estudo foi, respectivamente: cinco, cinco, quatro e cinco, nos animais de um ano; 15, 11, 13 e 27, nos de dois anos e 55, 31, 40 e 51, nos de três anos. Observou-se que maior número de moscas (PThis investigation was carried out due the lack of information about the possible effects of the blood-feeding horn fly, Haematobia irritans (L., on Nellore cattle. Data were recorded during four rainy seasons (October to April from 1991 to 1995. In each year, 80 animals were utilized according to the following treatments: twenty-eight 1-year old bulls divided into four groups; twenty 2-year old cattle divided into four groups and thirty-two 3-year old cattle divided into eight groups. Treatments against H. irritans were conduced at about 28-day intervals on half part of each age groups and the remainders groups maintained without treatment as control. The flies were counted at 14-day intervals and the animals weight registered at each 28-day intervals. The values for the mean flies number on the animals of the control groups in the first, second, third and fourth years of

  10. 不同林龄杂交楝(Azadirachta indica× Melia azedarach)人工林土壤水土保持功能研究%Soil and Water Conservation Functions of Azadirachta indica×Melia azedarach Plantation at Different Ages

    成向荣; 虞木奎; 周卫兵; 何祯祥

    2012-01-01

    为了明确林龄对杂交楝(印楝×苦楝)人工林土壤水土保持功能的影响,通过测定土壤持水能力、渗透能力和抗蚀能力来综合评价不同林龄杂交楝人工林保持水土功能.结果表明,随着杂交楝林龄增加,林地土壤孔隙结构得到改善、持水性能增加、渗透能力增大,提高了土壤水稳性指数,增加了土壤抗蚀性,土壤水土保持功能得到增强.3年生杂交楝林分的土壤持水性能、渗透能力和抗蚀性与1年生林分之间无显著差异,5年生杂交楝林地各指标均比1年生和3年生林分有显著提高.5年生杂交楝林地的土壤最大持水量、总孔隙度、非毛管孔隙度、平均渗透速率和水稳性指数分别比1年生林地增加18.6%、11.4%、19.8%、45%、30.1%.因此,种植杂交楝可以在短期内提高林分的土壤水土保持功能,在山地丘陵地区值得大力发展杂交楝.%In order to evaluate the effect of forest age of Azadirachta indica×Melia azedarach (hybrid neem tree) plantation on soil and water conservation function, soil water-holding capacity, infiltration capacity and erosion resistance of hybrid neem plantation in different ages were studied. The results showed that soil pore structure, soil water-holding capacity, infiltration capacity, and soil erosion resistance increased with the increase of hybrid neem stand age, soil and water conservation function was further enhanced. Soil water-holding capacity, infiltration capacity, and soil erosion resistance were not significant difference between 3-year-old and 1-year-old hybrid neem stands, however, these variables of the 5-year-old hybrid neem stand were significantly higher than that of 1-year-old and 3-year-old stands. Compared to 1-year-old stand, maximal soil water-holding capacity, total porosity, non-capillary porosity, the average infiltration rate and water stability index of the 5-year-old hybrid neem stand increased by 18.6%, 11.4%, 19.8%, 45

  11. Histology of salmonid testes during maturation.

    Dziewulska, Katarzyna; Domagała, Józef

    2003-03-01

    The commonly applied classification systems of fish gonad maturity divide the maturation process into certain stages. However, the scales do not entirely reflect the continuity of the maturation process. Based on light microscope observations, the paper describes a comprehensive pattern of testicular transformations during maturation. The study was carried out on precocious underyearling and 1-year-old males of sea trout (Salmo trutta m. trutta L.), 1-year-old males of salmon (Salmo salar L.), and males of brown trout (Salmo trutta m. fario L.) aged from 7 months to 4 years. A total of 821 gonads collected during all seasons of the year were examined. The fish were fixed in Bouin's fluid. Histological slides of the mid-part of the gonad were made using the standard paraffin technique. The 3-6 microm sections were stained with Heidenhain haematoxylin. Histological changes of testes during maturation were similar in the three species studied. Immature and resting gonads contained type A spermatogonia in lobules only. The appearance of cystic structures containing type B spermatogonia in the lobules signalled the beginning of the sexual cycle in male gonads. Type B spermatogonia underwent synchronous mitotic divisions resulting in an increase in the total number of spermatogonia. As the spermatogenesis continued, the gonads showed a gradual increase in the number of cysts containing cells at all the spermatogenetic stages: type B spermatogonia, primary and secondary spermatocytes, spermatids, and spermatozoa. The well-formed spermatozoa were released to the lobule lumen once the Sertoli cells and spermatozoa connections broke up and the cyst disappeared. This was a continuous process observed throughout the spawning season. The spermatozoa were moved to the efferent duct. While some of the germ cells were completing spermatogenesis, the lobules contained less and less cysts with type B spermatogonia, primary and secondary spermatocytes, and spermatids; eventually all

  12. FDTD calculations of specific energy absorption rate in a seated voxel model of the human body from 10 MHz to 3 GHz

    Finite-difference time-domain (FDTD) calculations have been performed to investigate the frequency dependence of the specific energy absorption rate (SAR) in a seated voxel model of the human body. The seated model was derived from NORMAN (NORmalized MAN), an anatomically realistic voxel phantom in the standing posture with arms to the side. Exposure conditions included both vertically and horizontally polarized plane wave electric fields between 10 MHz and 3 GHz. The resolution of the voxel model was 4 mm for frequencies up to 360 MHz and 2 mm for calculations in the higher frequency range. The reduction in voxel size permitted the calculation of SAR at these higher frequencies using the FDTD method. SAR values have been calculated for the seated adult phantom and scaled versions representing 10-, 5- and 1-year-old children under isolated and grounded conditions. These scaled models do not exactly reproduce the dimensions and anatomy of children, but represent good geometric information for a seated child. Results show that, when the field is vertically polarized, the sitting position causes a second, smaller resonance condition not seen in resonance curves for the phantom in the standing posture. This occurs at ∼130 MHz for the adult model when grounded. Partial-body SAR calculations indicate that the upper and lower regions of the body have their own resonant frequency at ∼120 MHz and ∼160 MHz, respectively, when the grounded adult model is orientated in the sitting position. These combine to produce this second resonance peak in the whole-body averaged SAR values calculated. Two resonance peaks also occur for the sitting posture when the incident electric field is horizontally polarized. For the adult model, the peaks in the whole-body averaged SAR occur at ∼180 and ∼600 MHz. These peaks are due to resonance in the arms and feet, respectively. Layer absorption plots and colour images of SAR in individual voxels show the specific regions in which the

  13. Pediatric dose assessment in combined 18F (FDG) PET/CT procedures

    The fast growing use of hybrid Positron Emission Tomography (PET) combined with Computed Tomography (CT) in diagnosis has proven to provide more accurate diagnostic information on cancer diseases. This is true for both adult and pediatric patients because of the ability for CT to give anatomic information supporting the metabolic information obtained from PET. Although the practice of using PET/CT is found to give clinical benefits, concerns on the doses delivered to pediatric patients continue to rise because of limited data. At King Faisal Specialist Hospital, Riyadh, Saudi Arabia, PET/CT was introduced in the year 2006. PET procedures are performed using 18F fluorodeoxyglucose (FDG) and CT scanning is performed using 80 kVp, 75 mA, 1.675:1 pitch and scan length from mid brain to mid thigh. For ages 14 and 15 years old, the kVp and mAs are 140 and 100 respectively. This study aims to provide data on effective doses to pediatric patients for PET/CT procedures which could contribute to the establishment of reference dose levels. It is also aimed to investigate possible means to reduce pediatric doses to limit the risks of exposures. A total of 113 patients were included in the study and were grouped as age 0 (less 1 year old), 1 (1 to less 5 years old), 5 (5 to less 10 years old), 10 (10 to less 14 years old) and 15 (14 to 15 years old). Age groups 5 and 10 years old give the highest percentage of patients (38 and 37% respectively). Results show that CT doses are in the range of 15 to 25% of the PET doses. The combined mean effective dose due to PET and CT is highest for neonates (15.5 mSv) and age group 1 year old (15.9mSv). Studies have shown that low dose CT provides adequate attenuation and does not contribute high noise to PET images. Reducing the mA from 75 to 10 for age groups 0 and 1 will reduce the dose by a factor of 100. (author)

  14. Evaluation of radiation dose in chest scan with enhanced dual-source computed tomography in children with congenital heart disease

    Objective: To evaluate the radiation dose from enhanced dual-source computed Tomography (DSCT) scan on children with congenital heart disease (CHD). Methods: Seventy children with CHD, age from 1 month to 8 years old, were scanned with enhanced DSCT. Children were divided by age into 5 years old group. The differences among three groups were tested by F test. Then, the SNK test was used to compare the difference between each group. Multiple linear regression analysis was used to test the relationship of dose length product (DLP) with the age, weight, voltage, current, pitch and scan sheet. Results: The average value of DLP was (144.46± 74.07) mGy·cm for all the 70 cases, and that of effective does (ED) was (4.68±2.34) mSv. There were significant differences of DLP among the 3 groups [ 5 years (208.00±73.87) mGy · cm, F=8.26, P=0.0009]. The SNK test showed statistical differences of DLP between 5 years old group (q=5.21, 6.52, P=0.009, 0.004). The difference of DLP between 1-5 years old group and > 5 years old group did not reach significant (q=0.28, P=0.48). The differences of ED was not statistically significant among the three groups [ 5 years (3.74±1.33) mSv, F=0.54, P=0.59]. DLP was positively correlated with age (4.3 years, r=0.54186, P=0.0008), weight (12.1 kg, r=0.56371, P=0.0004), voltage [(95.48±6.99) kV, r=0.63269, P<0.01], current [(138.55±40.67) mA, r=0.79608, P< 0.0001] and scan sheet (236.10±46.51, r=0.72192, P<0.01). DLP was negative correlated with pitch (0.48±0.03, r=-0.46693, P=0.0047). Conclusion: Higher DLP was observed in children over 1 year old under enhanced DSCT scan, but ED was not statistically significant among the three groups due to the higher K value in the children under 1 year old. (authors)

  15. Predictors of ante-natal care, delivery and infant feeding practices among rural women in Madhya Pradesh, India

    Indrapal Ishwarji Meshram

    2014-10-01

    Full Text Available Background: Maternal and infant mortality rates and prevalence of under nutrition are high in the State Madhya Pradesh. Regular ante-natal check-ups (ANC, delivery by trained health personnel, delivery practices and optimal infant feeding practices are important to reduce maternal and infant mortality. Objectives: The aim was to assess antenatal care, delivery and infant feeding practices of mothers of <1-year-old children in Madhya Pradesh. Materials and Methods: This was community-based cross-sectional study carried out in the rural areas of Madhya Pradesh by adopting systematic random sampling procedure. Data were collected from 5324 mothers having <1-year-old children. Information on household (HH socioeconomic and demographic particulars was collected from the mothers. Bivariate and multivariate analysis was performed to study the association between dependent and independent variables. Results and Interpretations: About 36% mothers had undergone at least three ante-natal check-ups and 73% delivered either at government or private hospitals. Only 26% mothers initiated breastfeeding within 1-h of birth and 92% fed colostrum. Step-wise regression analysis showed that ante-natal care for <3 times was significantly (P < 0.01 higher among women with high parity (≥5, illiterate women, and among lower socioeconomic group,s while home delivery was higher among women with high parity (≥5 (odds ratio [OR]: 2.3, among Scheduled Caste and Tribe women (OR: 1.5, illiteracy of head of HH (OR: 2, and among lower socioeconomic groups (OR: 1.3. Discarding colostrum was higher among illiterate women (OR: 1.6, belonging to lower socioeconomic groups (OR: 1.4 and delivery conducted by untrained person (OR: 3.9, while initiation of breastfeeding after 1-h of childbirth was higher among ≥30 years women (OR: 1.9, illiterate women (OR: 1.4, and delivery by untrained person (OR: 2.9. Conclusions: It was observed that antenatal care, delivery and infant and

  16. Children's mouthing and food-handling behavior in an agricultural community on the US/Mexico border.

    Black, Kathleen; Shalat, Stuart L; Freeman, Natalie C G; Jimenez, Marta; Donnelly, Kirby C; Calvin, James A

    2005-05-01

    Children's mouthing and food-handling activities were measured during a study of nondietary ingestion of pesticides in a south Texas community. Mouthing data on 52 children, ranging in age from 7 to 53 months, were collected using questionnaires and videotaping. Data on children's play and hand-washing habits were also collected. Children were grouped into four age categories: infants (7-12 months), 1-year-olds (13-24 months), 2-year-olds (25-36 months) and preschoolers (37-53 months). The frequency and type of events prompting hand washing did not vary by age category except for hand washing after using the bathroom; this increased with increasing age category. Reported contact with grass and dirt also increased with increasing age category. The median hourly hand-to-mouth frequency for the four age groups ranged from 9.9 to 19.4, with 2-year-olds having the lowest frequency and preschoolers having the highest. The median hourly object to mouth frequency ranged from 5.5 to 18.1 across the four age categories; the frequency decreased as age increased (adjusted R(2)=0.179; P=0.003). The median hourly hand-to-food frequency for the four age groups ranged from 10.0 to 16.1, with the highest frequency being observed in the 1-year-olds. Hand-to-mouth frequency was associated with food contact frequency, particularly for children over 12 months of age (adjusted R(2)=0.291; P=0.002). The frequency and duration of hand-to-mouth, object-to-mouth and food-handling behaviors were all greater indoors than outdoors. Infants were more likely to remain indoors than children in other age groups. The time children spent playing on the floor decreased with increasing age (adjusted R(2)=0.096; P=0.031). Parental assessment was correlated with hand-to-mouth activity but not with object-to-mouth activity. The highest combined (hand and object) mouthing rates were observed among infants, suggesting that this age group has the greatest potential for exposure to environmental toxins. PMID

  17. Vigilants Factor of Childhood Urinary Tract Infections and Antibiotic Resistance in One Tourism Region

    Gokhan Aydemir

    2010-08-01

    Full Text Available AIM: Nowadays, it has become quite difficult to set on empiric treatment of the urinary tract infections (UTI due to the levels of antibiotic resistance showing local differences. In our study, we aimed to find out what the antibiotic resistance, the region factors of UTI and we also wanted to observe wheather this resistance shows differences betwen diffirent age groups. METHOD: In this study we made inquiry of six questions with patient parents about region factors effects of UTI. Two hundred children who applied to pediatrics policlinic of Ahu Hetman Hospital with urinary system complaints or diagnosed to have (UTI while hospitalizing and with positive urinary culture results were included in the study. There were no known chronic disorders or no frequent recurrence of UTI history in the patients. The subjects were divided into three groups as 1 under 1 year old; 2 between 1-6 years old; 3 over 6 years old. Then the frequency of the pathogens was examined in terms of the resistance levels occurring against the antibiotics. RESULTS: The range of age the patients was between 1 and 192 months. The reproducing pathogens were Escherichiacoli 86% (n=172, Klebsiella pneumoniae 8% (n=16, Proteus mirabilis 4% (n=8 and Enterococcus spp 2% (n=4 respectively. While there was high resistance to amoxycilline (75.8%, ureidopenicillines (%46.4, 1st generation cephalosporin, (48.4% and cotrimaksazole (43.1%; there was low resistance to imipenem (1.7%, amicasin (5.6% and 3rd generation cephalosporins (14.7%. According to thes age groups, in Group 1 (¡U12 months the most effective agents were netilmicine (13%, gentamicine (13% and ceftriakson (17%; in addition to these, we can add cefuroxim-axetil (22.7% in Group 2 (12-72 months and nitrofrantoin (11% in Group 3. Under 1 year old groups didn't include this inquiry about UTL in tourism region. We made this study with a hundred seventy pation's parents ( upper of one year children than we observed some of

  18. Removal new alternative to chemical and mechanical removal for the study of pollen carried on the wild bee scopae Remoción química como nueva alternativa a la remoción mecánica para el estudio del polen transportado en las escopas de abejas silvestres

    Marta Caccavari

    2010-12-01

    Full Text Available Taxonomic recognition and quantification of the different pollen types collected by bees offer the most direct method to study the diet. To determine the importance of each plant taxon, it is necessary to separate the pollen deposited only in the collecting structures in order to minimize contamination of grains collected passively in other parts of the body. The technique currently applied is based on the mechanical removal of the pollen loads with dissecting needles and repeated washings with ethanol. Metathoracic scopae that underwent this procedure showed traces of pollen in varying amounts when observed under the microscope. As an alternative to this technique chemical removal using HOK is proposed. The leg is removed and treated separatedly to avoid contamination. The deflocculant properties of HOK successfully allowed to separate the pollen adhered to the scopae, which can be then returned to the individual, unaffected by the procedure. Suspend the pollen in a know quantity of mounting fluid permit take the subsamples and determine the total number of pollen grains of each taxon. In this paper, the new technique is presented and its effectiveness is compared to the technique currenty used.El reconocimiento taxonómico y la cuantificación de los distintos tipos polínicos colectados por las abejas ofrecen el método más directo para estudiar la dieta. Para determinar la importancia de cada taxón vegetal y minimizar la contaminación, es necesario separar el polen depositado en las estructuras de colecta, de los granos recolectados en forma pasiva en otras partes del cuerpo. La técnica que se aplica hasta el momento se basa en la remoción mecánica de las cargas polínicas con agujas de disección y sucesivos lavados con etanol. Escopas de patas metatoráxicas sometidas a este procedimiento al ser observadas bajo lupa presentaban aún granos de polen en cantidades variables. Como una alternativa a esta técnica proponemos la remoci

  19. Characterization of Pregnant Women with Heart Disease at the “Ramón Gonzalez Coro” Gynecologic and Obstetric Teaching Hospital Caracterización de las gestantes con cardiopatías en el Hospital Docente Ginecobstétrico “Ramón González Coro”

    Yanara Gutierrez Aliaga

    2011-11-01

    Full Text Available Introduction: pregnancy-related heart disease is nowadays the first cause of maternal morbidity and mortality among pregnancy-related pathologies. Objective: to characterize pregnant women with heart disease according to demographic and clinical features. Method: a descriptive study with some analytic aspects was conducted in the Heart Disease and Pregnancy service of “Ramón Gonzalez Coro’’ Gynecologic and Obstetric Teaching Hospital from 2000-2009. The universe consisted on the 472 pregnant women with heart disease that received follow up during that period. They were treated according to the protocol applied since 2000. Data were obtained through a questionnaire and were processed using the SPSS 11,5 system for Windows, through determination of absolute and relative frequencies. They included: mothers’ age, first and third trimester functional classification, drugs used and cardiovascular complications. Results: valvular heart diseases (25, 6 % were the most common type of heart disease. Important modifications were found at the end of pregnancy for the functional degree. Complications were registered in 29,9 % of patients, being pulmonary acute edema (6,4 %, cardiac arrest (4,3 % and arrhythmias (3,5 %, the most common ones. Pulmonary thomboembolism was the cause of the two maternal deaths that occurred. Conclusion: valvular heart diseases were the most common cardiac disease detected in the patients included in our study. Most of them were classified as functional degree I, being pregnancy a potential risk for them.Introducción: el embarazo en las mujeres cardiópatas constituye hoy, la primera causa de morbi-mortalidad materna entre las patologías asociadas al embarazo. Objetivo: caracterizar a las gestantes con cardiopatía desde el punto de vista clínico y demográfico. Método: estudio

  20. A new proposal to evaluate the healing of open skin wounds: volumetry Nova proposta para avaliar cicatrização de ferida cutânea aberta: volumetria

    Danilo Nagib Salomão Paulo

    2011-12-01

    Full Text Available PURPOSE: To present a new proposal to evaluate the healing of an open subcutaneous and skin wound, which we termed "volumetry". METHODS: A total of 32 circular wounds were performed in the subcutaneous tissues and skin of four feet of pigs (8 each. Each wound had about 1 cm in diameter and was 0.2 cm deep. Volume was calculated from the wound filled with saline and mass Xantopren. With the aid of a magnifying glass and local lighting, the liquid was dripped with a micropipette inside the wound until complete fullness. Volume repletion was calculated in microliters, corresponding to the volume of the wound. The mass of Xantopren was placed inside the wound to obtain a mold of the lesion. Mold volume was calculated using the formula of the volume of a cylinder closest resembling a geometric figure with mold. RESULTS: The calculation of wound volume was possible with both Xantopren and mold techniques. Volume as calculated by micropipette was 119.37 ± 30.87 microliters while the volume calculated by mold was 122.41 ± 33.90 mm3 (p=0.79. CONCLUSIONS: Volumetry in pig feet is simple and reproducible. Volumetry perfomed with saline did not differ from the volumetry with mass Xantopren. This method may be a useful tool to help evaluate the healing of open skin wounds in experimental and clinical research.OBJETIVO: Apresentar nova proposta para avaliar a cicatrização de uma ferida cutânea aberta, denominada "volumetria." MÉTODOS: Foram provocadas 32 feridas circulares cutâneas, com cerca de 1 cm de diâmetro e 0.2 cm de profundidade, em quatro patas de suíno. O volume da ferida foi calculado com solução salina e massa de xantopren. O líquido foi gotejado com uma micropipeta no interior da ferida até sua completa repleção, o que foi auxiliado com uma lupa de aumento e iluminação local. O volume de repleção foi calculado em microlitros e correspondeu ao volume da ferida. A massa de xantopren foi colocada no interior da ferida para se

  1. O ultrassom terapêutico na medula espinhal acelera a regeneração do nervo ciático de ratos Therapeutic ultrasound on the spinal cord accelerates regeneration of the sciatic nerve in rats

    Fernanda Guadallini Jatte

    2011-01-01

    Full Text Available OBJETIVO: Estudar os efeitos da irradiação ultrassônica de baixa intensidade aplicada sobre a medula espinhal na regeneração do nervo ciático de ratos após lesão por esmagamento controlado, avaliando os resultados pelo índice funcional do ciático (SFI, medido nas imagens vídeo-filmadas das plantas das patas. MÉTODOS: Dezoito ratos foram submetidos a esmagamento controlado (do nervo ciático direito e divididos em dois grupos de acordo com o tratamento: Grupo 1 (n=9, irradiação simulada; Grupo 2 (n=9, irradiação efetiva. Irradiação ultrassônica de baixa intensidade foi iniciada no 7º dia pós-operatório e aplicada diariamente por 6 semanas. Imagens das plantas das patas dos animais foram vídeo-filmadas em uma esteira transparente sob velocidade controlada a intervalos semanais até a 6ª semana de irradiação e o correspondente SFI medido com um programa de computador específico. RESULTADOS: O SFI durante a 1ª e a 6ª semana de tratamento foi de -59,12 e -12,55 no Grupo 1, e -53,31 e -1,32 no Grupo 2, indicando uma melhora de 79% e 97%, respectivamente, mas as diferenças entre os grupos somente foram significantes (pOBJECTIVE: To study the effects of low intensity ultrasound irradiation applied on the spinal cord on the regeneration of the rat's sciatic nerve after a controlled crush injury, evaluating the functional results of the sciatic functional index as measured on the video recorded images of the foot sole. METHODS: Eighteen rats were submitted to a controlled crush injury of the right sciatic nerve and divided into two groups according to the treatment: Group 1 (n=9, simulated irradiation; Group 2 (n=9, effective irradiation. Low-intensity ultrasound irradiation was started on the 7th postoperative day and applied daily for 6 weeks. Images of the animals´ foot sole were video recorded on a see-through treadmill type walking belt machine at weekly intervals until the 6th week of irradiation and the corresponding

  2. Amazonian and neotropical plant communities on glacial time-scales: The failure of the aridity and refuge hypotheses

    Colinvaux, P. A.; De Oliveira, P. E.; Bush, M. B.

    2000-01-01

    Plants respond to Pleistocene climatic change as species, not as associations or biomes. This has been demonstrated unequivocally by paleobotanical data for temperate latitudes. In the far richer vegetations of the tropics species populations also fluctuated independently in response to climatic forcing, from their longlasting glacial states to the patterns of brief interglacials like the present and back again. We use pollen data to reconstruct the vegetation of the Amazon basin in oxygen isotope stages 3 and 2 of the last glaciation in order to measure how the plant populations of the Amazon responded to the global warming at the onset of the Holocene. We find that plant communities of the neotropics vent copious pollen to lake sediments and that this pollen yields powerful signals for community composition. Three continuous sedimentary records reaching through oxygen isotope stage 2 are available from the Amazon lowlands, those from Carajas, Lake Pata and marine deposits off the mouth of the Amazon River. All three records yield pollen histories of remarkable constancy and stability. By comparing them with deposits of equal antiquity from the cerrado (savanna) of central Brazil, we show that most of the Amazon lowlands remained under forest throughout a glacial cycle. This forest was never fragmented by open vegetation as postulated by the refugia hypothesis. Instead the intact forest of glacial times included significant populations of plants that are now montane, suggesting that the global warming of the early Holocene resulted in the expulsion of heat intolerant plants from the lowland forest. Pollen data from the Amazonian flank of the Andes and from Pacific Panama provide evidence that populations of these heat intolerant plants survive the heat of interglacials in part by maintaining large populations at cooler montane altitudes. Our conclusion that the Amazon lowlands were forested in glacial times specifically refutes the hypothesis of Amazonian glacial

  3. Analysis of the use of fenthion via epicutaneous in dogs for Rhipicephalus sanguineus control Análise do uso de fenthion via epicutânea em cães para o controle de Rhipicephalus sanguineus

    Fernando de Freitas Fernandes

    2001-01-01

    Full Text Available The action of fenthion was studied in a 15% epicutaneous formulation upon Rhipicephalus sanguineus, which may transmit pathogens to men and other animals, such as Ehrlichia, Babesia and Ricketsia. Dogs were artificially infected for the trial. The fenthion bioassays were begun four months after artificial infestation. The test group, having a mean of 186 ticks per dog, received the formulation dosage according to body weight on the neck region. Tick counts were performed, considering diameters > or = 2mm, during 11 days of treatment, in the most affected body areas: back, ears and paws. Before the application of fenthion in the dogs, it were observed an average 43.3% ticks in the ears, 38.1% in the back area and 17.6% in the paws. The number of ticks in dogs decreased by 36.2%, 63.8%, 82.7%, 67%, 40% and 4.9%, respectively on days 1, 2, 3, 5, 7, 9 and 11 after treatment. R. sanguineus anti-tick activity, lower than that officially recommended, was verified. The number of ticks increased progressively after the 5th day, demonstrating residual insecticide inefficacy. The results obtained did not indicate the use of this formulation, at the tested dosage, as an elective measure for R. sanguineus control.Investigou-se a atividade de fenthion em formulação epicutânea a 15% sobre Rhipicephalus sanguineus, transmissor de patógenos ao homem e animais, tais como Ehrlichia, Babesia e Ricketsia. Infestou-se artificialmente cães com larvas deste carrapato. Os bioensaios com o fenthion iniciaram-se 4 meses após a infestação artificial. Constatada a média de 186 ixodídeos/cão, cães do grupo teste receberam na região da nuca a dosagem correspondente ao seu peso. Avaliaram-se a eficiência e a atividade residual através de contagens dos carrapatos com diâmetro > ou = 2mm, durante 11 dias, nas áreas corpóreas mais parasitadas: dorso, orelhas e patas. Anteriormente, à aplicação do fenthion, 44,3% dos carrapatos format observados nas orelhas

  4. Proporções e coeficientes de crescimento dos não-componentes da carcaça de cordeiros e cordeiras em diferentes métodos de alimentação Proportions and coefficients of growth components, non-carcass of the live weight of male and female lambs under different feeding methods

    Gilberto Teixeira da Rosa

    2002-11-01

    Full Text Available O experimento foi realizado com o objetivo de estudar as proporções dos não-componentes da carcaça e o crescimento relativo dos mesmos. Foram utilizados 45 cordeiros, 22 machos não castrados e 23 fêmeas da raça Texel. Desses, sete foram abatidos no início do experimento 24 horas após o parto, e os demais assim que atingiam os pesos de 25 ou 33 kg. Foi adotado um delineamento inteiramente casualizado com um arranjo fatorial 3 x 2 x 2 (três métodos, dois sexos e dois pesos de abate. Ocorreu diminuição das proporções de cabeça e patas com a elevação do peso de abate, verificando-se valores de 4,44% e 2,63% para pesos de 25 kg e de 3,76% e 2,43% para pesos de 33 kg, respectivamente.Entre sexos a maior proporção de gordura perirenal foi obtida para as fêmeas e entre pesos de abate, para 33 kg .As proporções de pele, fígado e coração não diferiram entre métodos de alimentação, sexos e pesos de abate. A maior proporção de rúmen-retículo foi dos cordeiros desmamados aos 45 dias mas, entre sexos e pesos de abate foram semelhantes.O crescimento relativo das patas, coração, rins e pulmão + traquéia é precoce, enquanto o da pele, fígado e gordura perirenal é isométrico, em relação ao peso de corpo vazio. O rúmen + retículo, independentemente de método e sexo, foi de crescimento tardio, cujos coeficientes variaram entre 2,22 e 2,47.The experiment was carried out to study the components proportions, non-carcass of the body weight and their relative growth. It was used 45 lambs: 22 non-castrated male and 23 females of Texel breed. From that group, 7 were slaughtered in the beginning of the experiment and the others when they reached 25 or 33 kg. A randomly delineation adopted was by a factorial arrangement of 3:2:2 (three methods, two sexes and two weights of slaughter. The head and paws proportions decreased with elevation of the slaughter weight with values of 4.44% and 2.63% to 25 kg; 3.76% and 2.43% to 33 kg

  5. Evaluation of anti-ulcerogenic activity in an Aqueous Extract obtained from Bauhinia forficata leaves

    Giovanna Christina Costa Mazzeo

    2015-09-01

    Full Text Available Bauhinia forficata Link, popularly known as pata-de-vaca, unha-de-vaca, casco-de-vaca, has been widely used in traditional medicine to treat several diseases. Leaves of B. forficata are used in popular medicine as a diuretic, hypoglycemic, tonic and cleanser, and to combat elephantiasis. However, despite the wide range of ethnopharmacological data surrounding the plant, there are no scientific data demonstrating a probable anti-ulcerogenic activity conferred by use of that species. The present study aimed to evaluate the antiulcer properties of an infusion of fresh leaves of B. forficata Link. From the leaves of B. forficata, an Aqueous extract (AqE was obtained and the phytochemical analysis showed the presence of flavonols in this extract. In the gastric ulcer induced by administration of HCl-Ethanol model performed with four different doses of AqE (125, 250, 500 and 1000 mg.Kg-1, the AqE showed significant preventive activity (*p<0.01 at doses of 1000 mg.Kg-1. The antiulcer activity of AqE (1000 mg.Kg-1 could also be demonstrated in experimental models of NSAID-bethanechol (**p<0.001 and absolute ethanol (**p<0.001. Moreover, AqE (1000 mg.Kg-1 promoted a significant increase (**p<0.001 in the amount of gastric mucus. The data presented here demonstrated the potential gastroprotective activity from AqE, possibly attributed to the presence of flavonols in this extract. These results may serve as a support for the development of new treatments related to the pathology of gastric ulcer.Keywords: Gastric ulcer. Cytoprotection. Flavonoids. Bauhinia forficata.  

  6. Primeras manifestaciones del urbanismo romano-republicano en el Valle Medio del Ebro: una nueva interpretación sobre las ciudades en llano de planta ortogonal en Aragón de finales de siglo II y comienzos del I A. E.

    José Ángel ASENSIO ESTEBAN

    2009-12-01

    Full Text Available RESUMEN: Al igual que lo constatado en las investigaciones de los últimos años pata el atea de Cataluña, según proponemos en este momento, en el valle medio del Ebro —en Atagón fundamentalmente—, el final del siglo II y comienzos del I a. C. es un momento clave en el proceso de romanización de estas tierras, que, entre otros testimonios, nos ha dejado una serie de fundaciones de urbanismo reticular de carácter claramente romano y que hasta ahora habían pasado desapercibidas. Estaas nuevas ciudades en llano, cuya estrucctura se aparta radicalmente de lo que conocemos para el urbanismo indígena del momento, son de grandes proporciones — entre 10 y 20 has. y de planta regular octogonal. Sin embatgo, a pesar del carácter itálico de su trazado y de haber sido promovidas, creemos, por los gobernadores romanos, hay que pensar que esrarían ocupadas mayoritariamente por indígenas.ABSTRACT: In the same way as the lats recarches have showed in relationships with the area of Cataluña, the end of the second century and the early years of the first century B. C. is, also in the Ebro's medium valley —Aragón mainly—,. a very important moment in the roman process of organization of this peninsular environment. One of the most significant archivements of this situation is the foundation ex novo of a range of cities planned according to a roman orthogonal plan, well known nowadays in Cataluña. This wok adds four aragonese cities to this-list of replublican foundations in Citerior. AU of them are built on flat ground according to a regular plan, and are vast too —between 10 and 20 Has.— Despite this regularity their inhabitants, we think, migt be mainly Spaniards.

  7. Problemas Del Pollo De Engorde Antes Y Después Del Beneficio (Pollo En Canal. 1º Parte

    Sandra Lissette Ricaurte Galindo M.V.Z.

    2005-06-01

    Full Text Available Cuando los pollos llegan a la planta necesitan una ventilación adecuada en la zona de retención para minimizar la mortalidad y la pérdida excesiva de peso vivo. Los pollos que llegan deben ser programados para el procesamiento dentro de las 8 a 12 horas después de haber comido por última vez. De esta manera disminuye la cantidad de material que podría contaminar potencialmente la canal durante el procesamiento permitiendo tiempo suficiente para que el intestino se vacíe. Los pollos que quedan sin alimento por largos periodos (más de 13 a 14 horas comienzan a perder la mucosa intestinal y tendrán menor rendimiento en canal.Cuando se pierde la mucosa intestinal, el intestino resultante será mucho más débil y se romperá más fácilmente durante la evisceración, se procesa a los pollos principalmente para convertir sus músculos en carne, eliminar los componentes del cuerpo que no se desean (sangre, plumas, vísceras, patas y cabeza y mantener en un mínimo la contaminación microbiológica. La calidad del producto final depende no sólo de la condición de las aves cuando llegan a la planta, sino también de como se manejan durante el procesamiento. Lesiones, huesos rotos, partes faltantes y un número excesivo de reprocesamientos pueden ocasionar pérdidas económicas significativas. La descarga, aturdimiento, sacrificio, escaldado, desplumado, eviscerado, enfriamiento y empacado son algunas de las etapas del procesamiento que pueden ocasionar defectos en el producto. Así que estas etapas deben ser vigiladas.

  8. Asociaciones implícitas como método para la detección de violencia y psicopatía.

    Feggy Ostrosky-Solís

    2009-12-01

    Full Text Available La psicopatía es un trastorno de la personalidad que caracterizado por rasgos interpersonales, afectivos, conductuales y de estilo de vida. Está asociada con conducta violenta, existen pocos estudios que evalúen la tendencia hacia la violencia en psicópatas mediante técnicas de asociaciones implícitas como el Test de Asociaciones Implícitas (IAT. Se desarrolló el IAT-violencia, para evaluar las distorsiones cognitivas acerca de la violencia en 195 reos de acuerdo al nivel de psicopatía y al tipo de delito, se exploró el desempeño en la prueba de acuerdo a los niveles de los factores 1 y 2 de psicopatía. Los resultados indican que los sujetos violentos con alta psicopatía presentan distorsiones cognitivas acerca de la violencia. Aquellos con alto factor 2 de psicopatía presentan distorsiones cognitivas acerca de la violencia. Se discute la relación entre los factores 1 y 2 con la conducta violenta y la importancia de contar con instrumentos breves, confiables y objetivos. Las entrevistas semi-estructuradas requieren 1.5-3.5 horas, un entrenamiento especializado para evaluar el grado de psicopatía. Se discute el potencial para detectar sujetos que estén en riesgo de cometer alguna ofensa violenta mediante el IAT-violencia que toma 15 minutos y cuya calificación es automatizada.

  9. Atividade analgésica do extrato da Pectis jangadensis (S. Moore Preliminary evaluation of Pectis jangadensis (S. Moore analgesic activity

    Caroline C. Soares

    2009-03-01

    Full Text Available A planta Pectis jangadensis, popularmente conhecida como "roxinha", "erva do carregador" ou "coentro da chapada" é utilizada em chás pela população matogrossense, como calmante. Não há estudo na literatura sobre qualquer atividade farmacológica dessa planta. Nosso objetivo foi avaliar atividade analgésica de seu extrato hidro-alcoólico nas doses de 100, 500 e 1000 mg/kg pelos métodos de Contorções induzidas pelo ácido acético e teste da formalina. Os nossos resultados demonstram que não houve diferença significativa entre o grupo controle e os grupos tratados com diferentes doses do extrato tanto em relação ao número de contorções induzidas pelo ácido acético quanto ao tempo de lambedura da pata, na fase 1 e 2, induzida pela formalina. Portanto, pelo menos, por via oral, parece que o extrato hidro-alcoólico da Pectis jangadensis não apresenta atividade analgésica."Preliminary evaluation of Pectis jangadensis (S. Moore analgesic activity's". The plant Pectis jangadensis, popularly known as "roxinha", "erva do carregador" or "coentro da chapada" is used in teas by the matogrossense's people, as a calmative. There isn't any study in the literature about its pharmacologic activity. Our object was to evaluate its extract hidroalcoolic analgesic activity in doses of 100, 500 and 1000 mg/kg by the methods of abdominal writhing induced by acetic acid and the Formalin test. The results show that there wasn't significant difference between the control groups and the groups treated with different doses of the extract in both testes. Therefore, at least by oral, seems that the Pectis jangadensis' hidroalcoolic extract doesn't have analgesic activity.

  10. Neonatal administration of fluoxetine did not alter the anxiety indicators, but decreased the locomotor activity in adult rats in the elevated plus-maze Administração neonatal de fluoxetina não alterou os indicadores de ansiedade, mas diminuiu a atividade locomotora em ratos adultos no labirinto elevado em cruz

    Valdenilson Ribeiro Ribas

    2008-12-01

    Full Text Available The objective of this study was evaluate the anxiety and locomotor activity (LA in 52 Wistar adult male rats, being 26 treated with fluoxetine (10 mg/Kg - sc in the neonatal period. These same rats received foot shock (FS (1.6-mA - 2-s in the 90th day. The anxiety and LA were appraised by plus-maze. The time spent in the open arms was used as anxiety index and the LA was measured by number of entries in closed arms (NECA and the total of entries (TE. T-test was used with pO objetivo deste estudo foi avaliar a ansiedade e a atividade locomotora (AL em 52 ratos Wistar adultos machos, sendo 26 tratados no período neonatal com fluoxetina (10 mg/Kg - sc e no 90º dia, receberam estímulos elétricos nas patas (1,6-mA-2-s. A ansiedade e a AL foram avaliadas por meio do labirinto elevado em cruz. O tempo de permanência dos animais nos braços abertos (BA foi utilizado como índice de ansiedade e a AL medida pelo número de entradas nos braços fechados (NEBF e pelo total de entradas (TE nos BA e BF. O teste t foi utilizado, com (p<0,05 e os dados apresentados em média±erro padrão. Os animais tratados reduziram o NEBF (2,35±0,33 e o TE (3,96±0,61 comparados a seus controles (4,65±0,52 e (6,96±0,94. A administração neonatal de fluoxetina não alterou a ansiedade, mas diminuiu a AL dos animais que receberam EE.

  11. DRD4 dopamine receptor allelic diversity in various primate species

    Adamson, M.; Higley, D. [NIAAA, Rockville, MD (United States); O`Brien, S. [NCI, Frederick, MD (United States)] [and others

    1994-09-01

    The DRD4 dopamine receptor is uniquely characterized by a 48 bp repeating segment within the coding region, located in exon III. Different DRD4 alleles are produced by the presence of additional 48 bp repeats, each of which adds 16 amino acids to the length of the 3rd intracytoplasmic loop of the receptor. The DRD4 receptor is therefore an intriguing candidate gene for behaviors which are influenced by dopamine function. In several human populations, DRD4 alleles with 2-8 and 10 repeats have previously been identified, and the 4 and 7 repeat alleles are the most abundant. We have determined DRD4 genotypes in the following nonhuman primate species: chimpanzee N=2, pygmy chimpanzee N=2, gorilla N=4, siamang N=2, Gelada baboon N=1, gibbon N=1, orangutan (Bornean and Sumatran) N=62, spider monkey N=4, owl monkey N=1, Colobus monkey N=1, Patas monkey N=1, ruffed lemur N=1, rhesus macaque N=8, and vervet monkey N=28. The degree of DRD4 polymorphism and which DRD4 alleles were present both showed considerable variation across primate species. In contrast to the human, rhesus macaque monkeys were monomorphic. The 4 and 7 repeat allels, highly abundant in the human, may not be present in certain other primates. For example, the four spider monkeys we studied showed the 7, 8 and 9 repeat length alleles and the only gibbon we analyzed was homozygous for the 9 repeat allele (thus far not observed in the human). Genotyping of other primate species and sequencing of the individual DRD4 repeat alleles in different species may help us determine the ancestral DRD4 repeat length and identify connections between DRD4 genotype and phenotype.

  12. Holocene Charcoal Deposition From Brazilian Forest Fires

    Turcq, B.; Cordeiro, R. C.; Albuquerque, A. S.; Simoes, F. L.; Sifeddine, A.

    2004-12-01

    Determination of charcoal accumulation rate in lacustrine sediments allows to reconstruct the fire history of the region surrounding the lake. Our studies have been achieved in three Amazonian sites and one site in Atlantic rainforest. Charcoal fragments are identified and counted under a microscope. Typical size of these charcoals is around ten micrometers and they probably have been subject to eolian transport. The highest charcoal accumulation rates were obtained in sediments from Middle Holocene in Carajás region, eastern Amazonia. These rates are on the same order than the present day charcoal accumulation rate in Alta Floresta, a region of Amazonia which is being submited to intense slash and burn. The lowest values were found in Lagoa da Pata in Sao Gabriel da Cachoeira, a very humid area in western Amazon. We observed from the D. Helvécio record, in the Atlantic rainforest, fire occurrences from 8,400 to 6,400 cal years BP. For Carajás lake, surrounded by tropical rain forest, we had identified fires during the period between 8,000 and 5,300 cal years BP. Finally, the lake Caracarana, which is surrounded by grass savanna, showed a record of main fire occurrence phase at 9,750 cal yrs BP and a second phase marked by charcoal peaks at 7,680, 6,990 and 6,460 cal yrs BP. The synchronism of the fire occurrence periods in different Brazilian regions is related to the Middle Holocene dry climate phase provoked by the low summer insolation. Differences in the accumulation rates can be attributed to differences in biomass availability and fire return time. The carbon released in the atmosphere by this fires must have contributed to the observed increase of CO2, poorer in 13C, during the middle Holocene.

  13. Isolation and intracellular localization of insulin-like proteins from leaves of Bauhinia variegata

    C.R. Azevedo

    2006-11-01

    Full Text Available Evidence based on immunological cross-reactivity and anti-diabetic properties has suggested the presence of insulin-like peptides in plants. The objective of the present study was to investigate the presence of insulin-like proteins in the leaves of Bauhinia variegata ("pata-de-vaca", "mororó", a plant widely utilized in popular medicine as an anti-diabetic agent. We show that an insulin-like protein was present in the leaves of this plant. A chloroplast protein with a molecular mass similar to that of bovine insulin was extracted from 2-mm thick 15% SDS-PAGE gels and fractionated with a 2 x 24 cm Sephadex G-50 column. The activity of this insulin-like protein (0.48 mg/mL on serum glucose levels of four-week-old Swiss albino (CF1 diabetic mice was similar to that of commercial swine insulin used as control. Further characterization of this molecule by reverse-phase hydrophobic HPLC chromatographic analysis as well as its antidiabetic activity on alloxan-induced mice showed that it has insulin-like properties. Immunolocalization of the insulin-like protein in the leaves of B. variegata was performed by transmission electron microscopy using a polyclonal anti-insulin human antibody. Localization in the leaf blades revealed that the insulin-like protein is present mainly in chloroplasts where it is also found associated with crystals which may be calcium oxalate. The presence of an insulin-like protein in chloroplasts may indicate its involvement in carbohydrate metabolism. This finding has strengthened our previous results and suggests that insulin-signaling pathways have been conserved through evolution.

  14. Relaciones entre morfología y forrajeo de artrópodos en colibríes de bosque altoandino

    Rico Guevara Alejandra

    2006-06-01

    Full Text Available Con esta investigación se buscó reanudar el debate sobre la importancia que tiene el forrajeo de artrópodos en el estudio de la ecología y evolución de los colibríes. Se examinaron las tácticas de caza, preferencias en selección de presas, estructura morfológica y ciertos parámetros aerodinámicos de las especies encontradas en un bosque altoandino en los cerros orientales, como un primer acercamiento a las características de la depredación de artrópodos por colibríes en ambientes de alta montaña. Se tomaron las cuatro especies más abundantes en el área y se hicieron comparaciones entre tres fuentes de datos complementarias (comportamiento, dieta y morfología, para discutir las particularidades encontradas en este ensamblaje particular, con las tendencias e hipótesis anteriormente propuestas para bosque húmedo tropical. La comunidad de colibríes en conjunto, consumió muchas menos presas de superficie y más presas de aire en comparación con las especies de tierras bajas. Existen diferencias marcadas para el consumo de artrópodos entre las especies e incluso entre los sexos de cada especie, y éstas se relacionaron significativamente con algunas medidas relativas de ala, pico y patas, e índices aerodinámicos calculados para tales especies, sugiriendo la existencia de condicionamientos morfológicos, y por lo tanto presiones selectivas impuestas por la caza de artrópodos sobre el diseño corporal de los colibríes.

  15. Twin-tube practical acoustic thermometry: theory and measurements up to 1000 °C

    Sutton, G.; Edwards, G.; Veltcheva, R.; de Podesta, M.

    2015-08-01

    We present details of a Practical Acoustic Thermometer (PAT), in which temperature is inferred from measurements of the speed of sound along acoustic waveguides. We describe both the theory of operation, and measurements on three devices at temperatures up to 1000 °C. Because the relationship between the speed of sound in a simple gas and absolute temperature is well understood, the mean temperature along a tube may be estimated from measurements of the frequency-dependent propagation constant. A PAT device made from two tubes of different lengths allows the temperature measurement region to be localised, creating an instrument functionally similar to conventional contact thermometers. Three twin-tube PAT devices were constructed and tested. PAT-A, made of silica, served to validate the technique with differences between the acoustic thermometer and a reference thermocouple of less than 2 °C at temperatures in the range from 100 °C to 1000 °C. PAT-B and PAT-C were made of Inconel-600, potentially more suitable for use in harsh environments. The Inconel devices deviated from expected behaviour in a reproducible manner, which after calibration allowed measurements with errors of less than  ±1 °C in the range to 700 °C. No drift was observed up to 700 °C. The drift observed during prolonged exposure to higher temperatures is described and its likely causes discussed. In the longer term, similar technology may provide a means for the measurement of temperature in harsh environments such as those found in the nuclear industry.

  16. Papel del especialista en ejercicio físico en el programa de rehabilitación cardíaca Role played by the physical training specialist in the Program of Cardiac Rehabilitation.

    Reinol Hernández González

    2000-01-01

    Full Text Available Se mencionan algunos de los efectos positivos del ejercicio físico en pacientes cardiópatas, como son el aumento de la capacidad funcional en mujeres y en pacientes clasificados de alto riesgo, la mejoría de la frecuencia cardíaca y la presión arterial, etc. El artículo tuvo como objetivo explicar el funcionamiento de la sección de entrenamiento físico dentro de los programas de rehabilitación cardíaca. Se explicó el funcionamiento de la sección de ejercicio físico del Centro de Rehabilitación del Instituto de Cardiología de La Habana, así como el papel preponderante del especialista en ejercicio físico dentro de la rehabilitación cardíaca. Como conclusión, se determinó que en los programas de rehabilitación cardíaca, siempre existiera el Especialista en ejercicio físico, con los conocimientos necesarios que garanticen la salud y la seguridad del paciente. Some of the positive effects of physical exercise on patients suffering from heart disease, such as the increase of functional capacity in women and patients classified as high risk, the improvement of heart rate and arterial pressure, etc., are mentioned here. The objective of this paper was to explain the functioning of the section of physical training within the cardiac rehablitation programs. The functioning of this section at the Rehabilitation Center of the Cardiology Institute of Havana, as well as the leading role played by the physical training specialist in the cardiac rehabilitation were explained. To conclude, it was determined that in the cardiac rehabilitation programs there will always be a physical training specialist with the necessary knowledge to guarantee patient?s health and safety.

  17. Fraccionamiento térmico de aceite de pollo

    Grompone, María A.

    1994-12-01

    Full Text Available Properties of chicken oil industrially obtained in Uruguay are studied.
    Dry fractionation of neutralized and degummed chicken oil is carried out at laboratory employing two different temperature programmes. The oleine obtained at the final temperature of 13°C (yield of 79.2%, remains clear at 0°C during 20 minutes, and the one obtained at 9°C (yield of 76.3% during 240 minutes. The latter could be used as a substitute of neatsfoot oil.
    Melting points of stearines vary from 39.5°C to 41.5°C. Therefore, and given their composition, they could be used in food industry.

    Se estudian las propiedades del aceite de pollo obtenido industrialmente en el Uruguay.
    Se realizan, a nivel de laboratorio, fraccionamientos térmicos en seco de aceite de pollo neutralizado y desgomado, empleando dos programas de temperatura diferentes. La oleína obtenida a la temperatura final de 13°C (con un rendimiento del 79,2% permanece límpida a la temperatura de 0°C durante 20 minutos y la obtenida a 9°C (con un rendimiento del 76,3%, durante 240 minutos. Esta última podría ser utilizada como sustituto del aceite de patas de vacuno.
    Las estearinas obtenidas tienen puntos de fusión entre 39,5°C y 41,5°C. Por ello y por su composición podrían ser empleadas en productos alimenticios.

  18. El comportamiento animal como escudo para evitar la enfermedad y remedio hacia la salud (algunas bases fisiológicas

    F. I. Flores

    2005-01-01

    Full Text Available Los animales viven en ambientes donde está presente, de manera permanente, la amenaza de enfermar. Para evitarlo, se alimentan lejos de las heces y reconocen las plantas o zonas del potrero que deben evitar. Aprenden, también, a ingerir especies o realizar conductas específicas con fines profilácticos. Si esto falla, entonces el animal manifiesta otras conductas y respuestas fisiológicas como: anorexia, inactividad, dolor y fiebre. El dolor obliga al animal a proteger el área dañada, evitando el apoyar una pata herida o inutilizando un músculo dañado, mientras los tejidos son reparados. La fiebre representa un alto costo energético, y para ahorrar energía, el animal tiende a permanecer inmóvil, estrategia de gran utilidad para controlar el crecimiento y reproducción de bacterias patógenas. En el comportamiento de los animales enfermos se han descubierto sustancias involucradas denominadas citocinas, que juegan un papel muy importante en la inducción de este tipo de conductas; por ejemplo, se puede inducir una disminución del consumo de alimento y en la actividad física inyectando sustancias provenientes de paredes celulares de bacterias o determinadas toxinas. El conocimiento de la conducta y sus bases fisiológicas en la lucha contra la enfermedad ofrecen expectativas prometedoras en la investigación para mejorar el diagnóstico y tratamiento de enfermedades

  19. Isolation of Sporothrix schenkii from the nails of healthy cats Isolamento de Sporothrix schenckii de unhas de gatos sadios

    Lorena Leonardo de Souza

    2006-09-01

    Full Text Available Many cases of sporotrichosis in cats were diagnosed in the town of Rio Grande, RS, Brazil, caused mainly by inoculation due to scratches. In this work, we evaluated the frequency of Sporothrix schenckii in the nails of healthy cats living together with cats showing clinical sporotrichosis. The isolation of the fungus was carried out pressing unwashed nails of the forelimbs of 24 cats (48 paws directly onto the surface of Mycobiotic Agar in Petri dishes. S. schenckii was isolated from seven (29.1% cats. The procedure for isolation of the fungus was simpler than methods that require sedation and cuts of the nails.Um número elevado de casos de esporotricose em gatos foi diagnosticado na cidade de Rio Grande/RS/Brasil, e na maioria dos animais, a doença ocorreu após inoculação do fungo a partir de arranhões. Nesse estudo, avaliou-se a freqüência de Sporothrix schenckii nas unhas de gatos saudáveis que conviviam com gatos com esporotricose. O isolamento do fungo foi realizado a partir da impressão das unhas dos membros torácico direito e esquerdo, de 24 gatos (48 patas, diretamente em placas de Petri com Agar Mycobiotic sem lavagem prévia das unhas. S. schenckii foi isolado de sete gatos (29,1%. O procedimento adotado para o isolamento do fungo foi mais simples que os procedimentos que requerem sedação e corte das unhas do animal.

  20. Effect of the diet and genotype on body measurements and non-constituints of carcass of wooless lambs finished in a feedlot Efeito de dieta e genótipo sobre medidas morfométricas e não constituintes da carcaça de cordeiros deslanados terminados em confinamento

    Ana Sancha Malveira Batista

    2007-12-01

    . A altura de cernelha, altura de posterior, comprimento de corpo, comprimento de perna, perímetro torácico, circunferência de perna, circunferência escrotal, escore corporal, capacidade corporal, CC1 e CC2 foram avaliados. Para os constituintes não carcaças foram estudadas as características de pesos de cabeça, fígado, coração, baço, vesícula, sangue, rins, patas, pele e pulmão + traquéia. Além disso, foram estudadas as características de carcaça: comprimento de carcaça, comprimento de perna, perímetro da coxa, perímetro da garupa, profundidade do tórax, perímetro do tórax e largura de peito. Os dados foram analisados com um modelo, o qual incluiu os efeitos de dieta e genótipo, além da covariável peso ao abate. A dieta afetou (P<0,05 o escore corporal e capacidade corporal (CC2. O genótipo influenciou a altura de cernelha, altura do posterior, comprimento de perna, circunferência escrotal, escore corporal e capacidade corporal. Para as medidas morfométricas da carcaça a dieta só influenciou o perímetro de tórax e largura de peito. O genótipo influenciou o comprimento de perna, perímetro de coxa e perímetro de garupa. Entre os componentes constituintes não carcaça, a proporção de fígado, baço, sangue, patas e pele, foram influenciados pela dieta, enquanto que o genótipo influenciou a proporção de cabeça, fígado, vesícula, rins e patas.

  1. Effects of a Formula Containing Two Types of Prebiotics, Bifidogenic Growth Stimulator and Galacto-oligosaccharide, and Fermented Milk Products on Intestinal Microbiota and Antibody Response to Influenza Vaccine in Elderly Patients: A Randomized Controlled Trial

    Shinya Nagafuchi

    2015-06-01

    Full Text Available We investigated the effect of a formula containing two different prebiotics (bifidogenic growth stimulator and galacto-oligosaccharide and fermented milk products on intestinal microbiota and antibody responses to an influenza vaccine in enterally fed elderly in-patients. Patients were administered either formula containing prebiotics and fermented milk products (group F: n = 12, 79.9 ± 9.5 years old or standard formula (group C: n = 12, 80.7 ± 10.1 years old via percutaneous endoscopic gastrostomy during a 14-week intervention period. Subjects were immunized with an influenza vaccine (A/H1N1, A/H3N2, and B at week 4 of the intervention. Blood biochemical indices, intestinal bacteria populations and antibody titers were analyzed. Bifidobacterium counts increased significantly in group F compared with group C. The enhanced antibody titers against A/H1N1 were maintained in group F for a longer period compared with group C. The titers against A/H3N2 were unchanged between both groups, and those against B were significantly lower in group F than in group C, although few subjects had seroprotective titers against A/H3N2 and B. These results suggest that administration of the formula containing prebiotics and fermented milk products may maintain antibody titers for longer periods through the improvement of intestinal microbiota.

  2. Long-term effects of manipulated natal brood size on metabolic rate in zebra finches.

    Verhulst, Simon; Holveck, Marie-Jeanne; Riebel, Katharina

    2006-09-22

    Long-term effects of developmental conditions on health, longevity and other fitness components in humans are drawing increasing attention. In evolutionary ecology, such effects are of similar importance because of their role in the trade-off between quantity and quality of offspring. The central role of energy consumption is well documented for some long-term health effects in humans (e.g. obesity), but little is known of the long-term effects of rearing conditions on energy requirements later in life. We manipulated the rearing conditions in zebra finches (Taeniopygia guttata) using brood size manipulation and cross-fostering. It has previously been shown in this species that being reared in a large brood has negative fitness consequences, and that such effects are stronger in daughters than in sons. We show that, independent of mass, standard metabolic rate of 1-year-old birds was higher when they had been reared in a large brood, and this is to our knowledge the first demonstration of such an effect. Furthermore, the brood size effect was stronger in daughters than in sons. This suggests that metabolic efficiency may play a role in mediating the long-term fitness consequences of rearing conditions. PMID:17148435

  3. Ketamine and midazolam sedation for pediatric gastroinntestinal endoscopy in the Arab world

    Mohamad-Iqbal S Miqdady; Wail A Hayajneh; Ruba Abdelhadi; Mark A Gilger

    2011-01-01

    AIM: To evaluate the safety and effectiveness of intravenous ketamine-midazolam sedation during pediatric endoscopy in the Arab world. METHODS: A retrospective cohort study of all pediatric endoscopic procedures performed between 2002-2008 at the shared endoscopy suite of King Abdullah University Hospital, Jordan University of Science & Technology, Jordan was conducted. All children were > 1 year old and weighed > 10 kg with American Society of Anesthesiologists class 1 or 2. Analysis was performed in terms of sedation-related complications (desaturation, respiratory distress, apnea, bradycardia, cardiac arrest, emergence reactions), adequacy of sedation, need for sedation reversal, or failure to complete the procedure. RESULTS: A total of 301 patients (including 160 males) with a mean age of 9.26 years (range, 1-18 years) were included. All were premedicated with atropine; and 79.4% (239/301) had effective and uneventful sedation. And 248 (82.4%) of the 301 patients received a mean dose of 0.16 mg/kg (range, 0.07-0.39) midazolam and 1.06 mg/kg (range, 0.31-2.67) ketamine, respectively within the recommended dosage guidelines. Recommended maximum midazolam dose was exceeded in 17.6% patients [34 female (F):19 male (M), P = 0.003] and ketamine in 2.7% (3 M:5 F). Maximum midazolam dose was more likely to be exceeded than ketamine (P 1 year and weighing > 10 kg without co-morbidities.

  4. Fine resolution calculations of SAR in the human body for frequencies up to 3 GHz

    Dimbylow, P. J.

    2002-08-01

    Finite-difference time-domain (FDTD) calculations of whole-body averaged specific energy absorption rate (SAR) have been performed from 100 MHz to 3 GHz at the basic 2 mm resolution of the voxel (volume pixel) model NORMAN without any rescaling to larger cell sizes. The reduction in the voxel size from previous work allows SAR to be calculated at higher frequencies. Additionally, the calculations have been extended down to 10 MHz, covering the whole-body resonance regions at a resolution of 4 mm. As well as for the adult phantom, SAR values are calculated for scaled versions representing 10-, 5- and 1-year-old children for both grounded and isolated conditions. External electric field levels are derived from limits of whole-body averaged SAR and localized SAR in the ankle, and compared with NRPB investigation levels and ICNIRP reference levels. The ICNIRP field reference levels alone would not provide a conservative estimate of the localized SAR exposure in the leg for grounded conditions. It would be necessary to invoke the secondary reference level on limb current to provide compliance with basic restrictions on localized SAR averaged over 10 g.

  5. Mucosubstance histochemistry in control and acid-stressed epidermis of brown bullhead catfish, Ictalurus nebulosus (LeSueur)

    Glycoprotein components of epidermal mucous cells in control (pH 6.8) and acid-stressed (pH 5.8, 4.8, 4.0) brown bullhead catfish were studied by histochemical and autoradiographic methods. Following exposure to acid, increased numbers of epidermal mucous cells were noted in all tissue sites studied, particularly dorsal and ventral skin. Mucous cells of control fish and acid-stressed (pH 5.8) fish contained a mixture of neutral and acidic mucosubstances, the latter including both sialomucins and sulfomucins, with sialomucins predominating. An apparent shift toward increased sulfomucin production was observed in skin from fish exposed to pH 4.8 and 4.0. In addition, autoradiographic studies using 35S showed increased labeling of mucous cells in acid-exposed (pH 4.0) epidermis, offering further support for a shift toward sulfomucin production in acid-stressed fish. Absence of appreciable sulfomucin production in younger fish (less than 1 year old) suggested that this shift may be partly age-dependent. The functional significance of increased sulfomucin production in acid-stressed epidermal mucous cells is uncertain but may be related to maintenance of ionic equilibrium

  6. Ontogenesis and cell specific localization of Fas ligand expression in the rat testis.

    D'Abrizio, Piera; Baldini, Enke; Russo, Paola F; Biordi, Leda; Graziano, Filomena M; Rucci, Nadia; Properzi, Giuliana; Francavilla, Sandro; Ulisse, Salvatore

    2004-10-01

    Over the past few years, a number of experimental evidences suggested the involvement of Fas Ligand (FasL) expressing Sertoli cells to induce apoptosis of Fas bearing germ cells. However, the FasL expression during testicular development and its cell specific localization within the testis is still a matter of debate. In the present study, we have monitored FasL expression during rat testis development by semiquantitative reverse transcriptase-polymerase chain reaction (RT-PCR) and evaluated cell specific localization of FasL expression, by in situ RT-PCR and immunohistochemistry, on adult rat testis. RT-PCR analysis, performed on total RNA from rat testes obtained from 1 day up to 1-year-old animals, demonstrated the presence of FasL transcripts at all developmental stages examined. In situ RT-PCR analysis clearly indicated the presence of FasL mRNA in Sertoli cells of adult testis, while we could never detect FasL transcripts in germ cells. Immunohistochemistry experiments showed a strong immunostaining for FasL in Sertoli cells of adult testis and again, no immunopositivity was observed in germ cells. In conclusion, our data suggest that FasL expression in rat testis is present from the early postnatal days up to the adult, and the Sertoli cells is the main FasL expressing cell within the seminiferous tubule. PMID:15379972

  7. Incidence of Acute Diarrhea Among Children Aged 0 - 1 Year in Southern Brazil, 2012

    Nascimento

    2015-09-01

    Full Text Available Background The incidence rate of acute diarrheal disease in children is a health indicator, and the estimation of these data can help guide public health policies. Objectives The aim of this study was to estimate the incidence and risk factors for acute diarrheal disease in children aged 0 - 1 year. Patients and Methods An observational prospective cohort study was conducted on 210 children recruited at Hospital Nossa Senhora da Conceicao, in Tubarao, state of Santa Catarina, Brazil. Children born between July and September 2012 were followed up for 12 months. The presence of three or more liquid or loose stools during a 24-hour period was considered acute diarrhea. The categories of variables evaluated were comprised of sociodemographic characteristics (per capita income, maternal education, maternal age, access to medical care [public or private], and housing and living conditions [sanitation and hygiene, water supply, daycare attendance, and domestic animal] and characteristics of the child (gender, birth weight, and breastfeeding. Results The incidence of acute diarrhea among the 0 - 1-year-old children was 26.7 cases per 1,000 children per month. Independent risk factors for the occurrence of diarrhea were maternal age under 20 years and health care services provided by the Brazilian National Health System (SUS. Conclusions The high incidence density of diarrhea among the children recruited in this study indicates the need for educational programs directed at people who are involved in this issue.

  8. Epidemiological characteristics of varicella from 2000 to 2008 and the impact of nationwide immunization in Taiwan

    Chang Luan-Yin

    2011-12-01

    Full Text Available Abstract Background Varicella has an important impact on public health. Starting in 2004 in Taiwan, nationwide free varicella vaccinations were given to 1-year-old children. Methods Our study investigated the epidemiological characteristics of varicella from 2000 to 2008, and assessed the change of varicella epidemiology after the mass varicella immunization. ICD-9-CM codes related to varicella or chickenpox (052, 052.1, 052.2, 052.7, 052.8, 052.9 were analyzed for all young people under 20 years of age through the National Health Insurance database of Taiwan from 2000 to 2008. Results Case numbers of varicella or chickenpox significantly declined after the nationwide immunization in 2004. Winter, particularly January, was the epidemic season of varicella. We found a significant post-vaccination decrease in incidence among preschool children, especially 3 to 6 year-old children-- the peak incidence was 66 per thousand for 4 and 5 year-old children before the nationwide immunization (2000 to 2003, and the peak incidence was 23 per thousand for 6 year-old children in 2008 (p Conclusion The varicella annual incidence and varicella-related hospitalization markedly declined in preschool children after nationwide varicella immunization in 2004.

  9. The Effects of Carcass Conditioning on Shear Force Values and Water Holding Capacity of Different Skeletal Muscles of Malaysian Indigenous (MALIN Sheep and the Changes in Their pH and Glycogen Contents

    Panandam Jothi Malar

    2011-01-01

    Full Text Available This study investigated the effects of carcass conditioning on shear force values and water holding capacity of various major skeletal muscles (Infraspinatus, Supraspinatus, Triceps brachii, Longissimus dorsi, Rectus femoris, Vastus lateralis, Semitendinosus, Semimembranosus and Adductor femoris obtained from a total of 18, 1 year old Malaysian Indigenous rams. It also studied the effect of conditioning on changes in their pH and glycogen contents. Sequel to the conditioning, muscle samples were analysed for shear force values and water holding capacity. The postmortem conditioning resulted in significant decline (p>0.05 in muscle pH, glycogen, shear force values and drip loss while the cooking loss remained unaffected. Statistically, there was no interaction (p>0.05 between the conditioning period and muscle type and this indicates that the effects of conditioning on muscle pH, shear force values, drip loss and cooking loss were independent of the muscle type. Meanwhile, its effect on glycogen was influenced by the muscle type.

  10. Cold hardiness of interspecific hybrids between Pinus strobus and P. wallichiana measured by post-freezing needle electrolyte leakage.

    Lu, Pengxin; Colombo, Stephen J; Sinclair, Robert W

    2007-02-01

    Interspecific hybrids between eastern white pine (Pinus strobus L.) and Himalayan blue pine (P. wallichiana A. B. Jacks.) were developed in Ontario, Canada, to introduce blister rust (Cronartium ribicola Fisch.) resistance genes to P. strobus. There is concern that introducing blister rust resistance has resulted in reduced cold hardiness of the progeny compared with non-hybridized eastern white pine. To test the efficacy of backcrossing with P. strobus to improve cold hardiness, 1-year-old seedlings from hybrid crosses differing in P. strobus genome composition were artificially freeze-tested. In Experiment 1, unhardened seedlings were allowed to acclimate to progressively lower temperatures in a growth room, whereas in Experiment 2, seedlings were hardened outdoors under natural weather conditions in Sault Ste Marie, Ontario. Needle cold injury was determined by calculating relative electrical conductivity based on post-freezing electrolyte leakage. Results indicated that needle fascicles from unhardened seedlings of all genotypes in the greenhouse tolerated -5 degrees C for 3 hours with little or no injury. Cold hardiness increased in parallel with declining growth room minimum temperature over the 7-week period of hardening. Cold hardiness was improved for hybrid crosses with increased Pinus strobus genome composition in Experiment 2, but the results were less conclusive in Experiment 1. PMID:17241966

  11. Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival

    Tan, Cheng; Takayama, Tatsuya; Takaoka, Naohisa; Fujita, Hiromi; Miyazaki, Miki; Sugiyama, Takayuki; Ozono, Seiichiro

    2014-01-01

    OBJECTIVE To investigate the relationship between gender differences in fatty acid-binding protein7 (FABP7) and BRN2 (POU class 3 homeobox 2) expression in renal cell carcinoma (RCC) and the prognosis of patients with RCC. MATERIALS AND METHODS immunohistochemical (IHC) staining as well as reverse transcription-polymerase chain reaction (RT-PCR) was performed in renal tissues from 103 patients (83 men, mean age = 63.6 years old; 20 women, mean age = 63.1 years old) underwent radical nephrectomy from January 1, 2001 through December 31, 2010. The probability of overall patient survival was estimated using the Kaplan-Meier method. RESULTS FABP7 mRNA expression was more frequent in men (P = 0.07) while BRN2 protein expression was significantly more frequent in women (P = 0.029). In particular, FABP7 was expressed in 100% of G1 renal cell carcinoma both in mRNA and protein levels. In women, FABP7 (−) and BRN2 (+) groups had a worse prognosis both in mRNA level (P = 0.038) and protein level (P = 0.058). BRN2 was expressed 100% of papillary RCC both in mRNA and protein levels. CONCLUSIONS Our results demonstrated that gender was a key factor in FABP7 and BRN2 expression in RCC, and the combination with FABP7 and BRN2 stratified by gender could be a new potential prognostic factor in patients with RCC. PMID:24653654

  12. Determination of essential elements in commercial infant foods by instrumental neutron activation analysis

    Eating habits are important determinants of health conditions during childhood. Commercial infant food is an important part of the diet for many babies. As such it is necessary that such food contain sufficient amounts of essential elements. Inadequate complementary feeding is a major cause of high rates of malnutrition throughout the world. Commercial infant food is classified into four different stages: Stages 1 and 2 are adequate for babies older than 6 months, but new flavors and food are introduced in stage 2; Stage 3 is offered to 8 month old babies; Junior Stage is recommended to children over 1 year old. In this study, essential elements: Ca, Cl, Co, Cr, Fe K, Mg, Mn, Na, Se and Zn were determined in commercial infant food samples by Instrumental Neutron Activation Analysis (INAA). Twenty-seven infant food samples were bought in stores around Sao Paulo city during 2011. These samples were freeze-dried and homogenized before analysis. The powdered samples were irradiated in the IEA-R1 nuclear research reactor of IPEN-CNEN/SP. For validation of the methodology, INCT MPH-2 Mixed Polish Herbs and NIST-SRM 1577b Bovine Liver reference materials were analyzed. Most of the concentration results were below the World Health Organization's recommended daily intake for infants from 6 to 12 months old. These low essential element concentration results in commercial infant foods obtained in our study indicate that infants should not only be fed with commercial baby foods. (author)

  13. INVESTIGAÇÃO DO USO DE POLIVITAMÍNICOS COMO POSSÍVEL CAUSA DE FLUOROSE EM CRIANÇAS

    Eliane Gava Pizi

    2009-06-01

    Full Text Available The present study aimed to investigate the causes of fluorosis giving primary focus to the presence of fluoride in polivitaminics. Children had been evaluated with fluorosis by collecting data of the former history as the use of fluorides, the use of vitamin supplements, frequency of toohbrushing and ingestion of fluorinated dentifrices. Interviews were made with parents of 50 children who had fluorosis and 50 without fluorosis. Of the children examined 44% had fluorosis grade 2 (as Index of Dean. Of this total, 88% are natural from Presidente Prudente. According to the report of parents, 56% of children with fluorosis made use of polivitaminics, whereas 18% used Kalyamon B12. According to the intake of fluorinated dentifrices was established that 52% do not ingest dentifricies during toohbrushing and that ingest began after 1 year old. We conclude that the intake of products containing fluoride, the use of fluorinated dentifrices and the fluoride present in drinking water, may be leading to consumption above the recommended, being fundamental importance the supervision and guidance of the use of this to minimize the risk of fluorosis. The use of vitamin supplements containing fluoride is linked to the emergence of fluorosis.

  14. Exposure to BPA in Children—Media-Based and Biomonitoring-Based Approaches

    Krista L.Y. Christensen

    2014-04-01

    Full Text Available Bisphenol A (BPA is used in numerous industrial and consumer product applications resulting in ubiquitous exposure. Children’s exposure is of particular concern because of evidence of developmental effects. Childhood exposure is estimated for different age groups in two ways. The “forward” approach uses information on BPA concentrations in food and other environmental media (air, water, etc. combined with average contact rates for each medium. The “backward” approach relies on urinary biomonitoring, extrapolating backward to the intake which would have led to the observed biomarker level. The forward analysis shows that BPA intakes are dominated by canned food consumption, and that intakes are higher for younger ages. Mean intake estimates ranged from ~125 ng/kg-day for 1 year-olds to ~73 ng/kg-day among 16–20 years olds. Biomonitoring-based intakes show the same trend of lower intakes for older children, with an estimate of 121 (median to 153 (mean ng/kg-day for 2–6 years, compared with 33 (median to 53–66 (mean ng/kg-day for 16–20 years. Infant intakes were estimated to range from ~46 to 137 ng/kg-day. Recognizing uncertainties and limitations, this analysis suggests that the “forward” and “backward” methods provide comparable results and identify canned foods as a potentially important source of BPA exposure for children.

  15. Characteristics of one-year-old shoots of peach hybrids from the crossing combination Flaminia × Hale Tardiva Spadoni

    Radović Aleksandar R.

    2015-01-01

    Full Text Available The results of two-year research (2011-2012 of the most important morphological characteristics of 1-year-old shoots in eight peach hybrids obtained from a crossing combination Flaminia × Hale Tardiva Spadoni were shown in this paper. The following characteristics were studied in tested hybrids: length and diameter of shoots, internode length, number of flowers and vegetative buds per shoot, ratio of flower to vegetative buds, number of flower buds per node and 1-m length of a shoot. The properties of sylleptic shoots on one-year-old shoots have also been studied. The significant differences were determined among the hybrids for parameters such as the diameter of shoots, internode length, number of flower and vegetative buds per shoot. Hybrids FH1 and FH6 were characterized by the highest density of flower buds, so that they are singled out as potentially the most yielding. These hybrids may be of interest for growing in areas where there is a risk of frost and in the domain of breeding when creating new peach cultivars of high yield potential. [Projekat Ministarstva nauke Republike Srbije, br. TR 31063: Primena novih genotipova i tehnoloških inovacija u cilju unapređenja voćarske i vinogradarske proizvodnje

  16. Intrascrotal lipoblastoma: report of a case and the review of literature.

    Yada, Keigo; Ishibashi, Hiroki; Mori, Hiroki; Shimada, Mitsuo

    2016-12-01

    Intrascrotal lipoblastoma is a rare pediatric benign soft tissue neoplasm, and only 11 cases have been reported. The accurate preoperative diagnosis is difficult because of its rarelity and the similarity with the other soft tissue tumors. Among them, accurate preoperative diagnosis had been made in only one case. Thus, almost all of the cases had required inguinal mass excision (and orchidectomy in one case). In this paper, we discuss the accurate preoperative diagnosis of intrascrotal lipoblastoma and subsequent simple tumorectomy via minimal invasive scrotal skin incision, in 1-year-old boy. On physical examination, intrascrotal extra-testicular lobulated mass was palpated on the right scrotum. An ultrasonography revealed the well-circumscribed, iso-echoic, scant blood-flow, and lobulated tumors with each lobules of 1 to 4 cm in diameter, and the tumor located outside of the tunica vaginalis testis. The serum values of alpha-fetoprotein (AFP) and beta-human chorionic gonadotropin (b-hCG) were within normal limit. The preoperative diagnosis of intrascrotal lipoblastoma was made, and the mass was excised via minimal scrotal incision. The right testicle and epididymis were normal. The lesion consisted of the distinct two lobulated tumors, and microscopic examination confirmed the diagnosis of intrascrotal lipoblastoma. The postoperative course was uneventful without evidence of recurrence. A rare intrascrotal lipoblastoma is seldom made accurate preoperative diagnosis; however, the accurate preoperative suspicion of this tumor leads to the minimal invasive tumorectomy via scrotal skin incision and favorable postoperative recovery without recurrence. PMID:27059472

  17. The Change of Stretched Penile Length and Anthropometric Data in Korean Children Aged 0-14 Years: Comparative Study of Last 25 Years.

    Park, Sungchan; Chung, Jae Min; Kang, Dong Il; Ryu, Dong Soo; Cho, Won Yeol; Lee, Sang Don

    2016-10-01

    There has been a great improvement in height and weight of Korean children owing to economic development over the last 25 years. This study aimed to evaluate the penile length of Korean children today and to compare it with a previous Korean study reported in 1987. The cross-sectional study was conducted with 909 Korean boys aged 0-14 years who had been brought to outpatient clinics of five tertiary hospitals (Busan, Ulsan, and Changwon) between September 2013 and May 2015. The stretched penile length (SPL) was measured and the testicular size was measured using orchidometry (mL). Student's t-test or Mann-Whitney U test was used to compare the result of our study and the study reported in 1987. SPL of Korean children gradually increased from 4.1 ± 0.8 cm at 0-1 year old to 9.6 ± 3.0 cm at 13-14 years old, the most rapidly during the age of 13. While body weight and testicular size significantly increased from 1987 in most of age groups, there were no significant changes in SPL although there was in some age groups. Height decreased in the infants 6 years old. With the great economic development over the last quarter century in Korea, height, body weight, and testicular size of children significantly increased but there was no significant change in SPL except penile growth pattern. PMID:27550493

  18. Defamilialisation Policies and Attitudes and Behaviour Among Mothers in Twelve European Countries. Do results for Denmark, Finland and Sweden differ from the others?

    Weckström, Sirpa

    2014-12-01

    Full Text Available Diverse family leave and day care policies create varying monetary incentives for mothers to stay at home with their children. They also affect attitudes of mothers and this should influence childcare decisions. In this study, attitudes of mothers towards cutting down on paid work for the sake of family as well as their behaviour regarding childcare at home were studied in 12 European countries. Of special interest were Denmark, Finland and Sweden, three Nordic countries with a long tradition of childcare policies supporting mothers’ work participation. The data is based on the European Social Survey (ESS Round 2, conducted in 2004 and 2005. The least familialistic attitudes were found in Sweden, Denmark and Finland. A coarse indicator for the effectiveness of childcare policy was devised and indicated that attitudes correlated with the policies in several countries. No correspondence was found between attitudes and average times spent with children at home. Regarding the Nordic countries (particularly Sweden and Finland, the contradictions observed were consistent with childcare policies that affect short- and long-term behaviour in opposite directions. In Finland, a familialistic attitude was relatively common among mothers whose youngest child was under 1-year-old.

  19. COEXISTENCE OF CUTANEOUS MUCORMYCOSIS AND SCROFULODERMA IN AN IMMUNODEFICIENT CHILD

    Mahalakshmi

    2016-01-01

    Full Text Available Severe Combined Immunodeficiency (SCID is a genetic disorder characterised by the disturbed development of functional T cells and B cells caused by numerous genetic mutations. (1 These patients are extremely vulnerable to infectious diseases and early death. (1 A 1-year-old child, known case of SCID since 8 months of age, presented with septic shock. He had a swelling on the left hand for 1 month and over left hand, which was a prior site of IV cannulation and swelling over axilla since 6 months. The child received multiple blood transfusions, though no bone marrow transplant was done. We entertained a differential diagnosis of cutaneous tuberculosis, atypical mycobacterial infection, deep fungal infection and foreign body granuloma for the left hand nodule. We thought of scrofuloderma with lymphadenopathy as a diagnosis for the axillary lesion. Biopsy of the hand lesion-multiple broad aseptate hyphae with granulomatous infiltrates suggesting mucormycosis. FNAC of axillary lymph node-necrotising lymphadenitis with AFB positive. Chest X-ray HRCT-PCP Pneumonia. He was started on IV Amphotericin-B

  20. Trends in Oral Antibiotic, Proton Pump Inhibitor, and Histamine 2 Receptor Blocker Prescription Patterns for Children Compared With Adults: Implications for Clostridium difficile Infection in the Community.

    Faden, Howard S; Ma, Chan-Xing

    2016-07-01

    The use of antibiotics, proton pump inhibitor (PPI), and histamine 2 receptor blocker (H2B) was compared between children and adults in the community from 2005 through 2011. Antibiotic prescription rates remained stable for children, but increased significantly for adults, P = .03. PPI prescription rates increased for children, P = .02 and for adults, P = .009. H2B prescription rates increased for children, P = .03, but not for adults. Antibiotic prescription rates were significantly higher in children than adults in all 7 years, P < .0001. In contrast, PPI prescription rates were significantly higher in adults than children in all 7 years, P < .0001. H2B prescription rates were significantly higher in adults than children 1 to 18 years old P < .0001; however, H2B prescription rates were highest in children <1 year old, P = .0001. The high use of oral antibiotics, PPI, and H2B among outpatients may be a contributing factor to the rise of Clostridium difficile infection in the community. PMID:26350427

  1. Influence of Soil Compaction and Drought on the Growth,Photosynthesis and Carbohydrates in Fugi/M.9EMLA Apple Plants

    YAO Yun-cong; John G Streeter; David C Ferree

    2003-01-01

    Greenhouse-grown 1-year-old potted M.9EMLA apple trees (Malus pumila Borkh) were subjected to the soil compaction and, after growing under compacted or non-compacted conditions for 6 weeks, were subjected to drought stress by withholding water for an additional six-week period. Soil compaction and drought stress significantly reduced plant height, number of leaves, and leaf area. Although drought significantly inhibited photosynthesis and transpiration, compaction only depressed transpiration. Furthermore, the effects of drought on plant growth, photosynthesis and transpiration were much greater than the effects of compaction. The rate of water loss from compacted plants was lower than the rate from non-compacted controls and this may explain the insignificant impact of compaction on photosynthesis. Sorbitol, glucose, and fructose concentrations increased over time during the drought stress period whereas sucrose concentration declined. In well-watered controls, sucrose concentration was much higher in leaves of compacted plants than in the leaves on non-compacted controls. For most of the sampling dates the leaf sorbitol concentration was lower in leaves on plants growing in compacted soil than in the leaves of those of the non-compacted controls. Although interactions between the effects of compaction and drought were highly significant for plant growth variables during the onset of drought, interactive effects on photosynthesis, transpiration, relative water content and carbohydrate variables were inconsistent. Compaction and drought both have major effects on apple plants and the interactions between these two stresses are complex.

  2. Effect of Arbuscular Mycorrhiza on the Drought Tolerance of Poncirus trifoliata Seedlings

    Wu Qiangsheng; Xia Renxue; Hu Zhengjia

    2006-01-01

    The effects of Glomus mosseae colonization on the plant growth and drought tolerance of 1-year-old trifoliate Poncirus trifoliata seedlings in potted culture were studied in natural water stress and rewatering conditions.Results showed that arbuscular mycorrhizal (AM)inoculation significantly improved the height,stem diameter,and fresh weight of P.trifoliata seedlings before natural water stress.By the end of the experiment,the survival percentage of AM-transplanted seedlings was 8%higher than those of non-AM ones.During water stress and rewatering,AM significantly increased the contents of soluble sugars and proteins in leaves,and enhanced the activities of superoxide dismutase (SOD),guaiacol peroxidase (G-POD),and catalase (CAT) in either seedling leaves or roots,which indicated that AM colonization could improve the osmotic adjustment response of P.trifoliata,enhance its defense system,and alleviate oxidative damages to membrane lipids and proteins.These results demonstrated that the drought tolerance of P.trifoliata seedlings was increased by inoculation with AM fungi.The functional mechanism underlying the observation that mycorrhizas increased the host's drought tolerance was closely related to enzymatic and nonenzymatic antioxidant defense systems such as SOD,GPOD,CAT,and soluble protein.

  3. A Community-based Randomized Trial of Postcard Mailings to Increase Dental Utilization Among Low-income Children

    Cruz, Asia Dela; Mueller, Gregory; Milgrom, Peter; Coldwell, Susan E.

    2013-01-01

    Purpose Increasing awareness about the importance of preventive dental care among low-income families has been considered to be key to overcoming nonfinancial access to care barriers for children. The purpose of this randomized, controlled trial was to measure the impact of postcard mailings on dental utilization by low-income children through a dental society program designed to increase access to dental care. Methods Five thousand eight hundred and seven low-income 2- to 4-year-olds were randomly assigned to 1 of 3 groups: (1) Group 1 (N=2,014) received postcards containing information on how to enroll in the Yakima County Access to Baby and Child Dentistry program; (2) Group 2 (N=2,014) received the enrollment information as well as additional information on the availability of fluoride varnish and the need to visit the dentist by the age of 1-year-old; and (3) Group 3 (N=1,779) did not receive postcards. Results Preventive services utilization rates were not different among the groups: 61% for Group 1, 62% for Group 2, and 60% for Group 3, although rates were high for a Medicaid population. Conclusions Postcard mailings did not significantly increase utilization of preventive dental services. Other strategies to increase utilization of preventive oral health measures are needed. PMID:23433618

  4. Inguinal panniculitis in a young Tasmanian devil (Sarcophilus harrisii) caused by Mycobacterium mageritense.

    Reppas, G; Nosworthy, P; Hansen, T; Govendir, M; Malik, R

    2010-05-01

    A 1-year-old, entire male Tasmanian devil living in captivity was presented because of a nodular inguinal lesion that subsequently developed a draining sinus tract. A second, similar lesion developed later in the ipsilateral axillary region. A deep representative biopsy specimen of abnormal subcutaneous tissue showed chronic active pyogranulomatous inflammation and beaded Gram-positive and acid-fast bacilli situated in lipid vacuoles within the lesion. A rapidly growing Mycobacterium species, shown subsequently to be M. mageritense, was grown from a swab of the primary lesion. It was susceptible to tetracyclines (including doxycycline) and moxifloxacin in vitro. The lesions resolved following treatment with doxycycline monohydrate (50 mg PO once daily) and then moxifloxacin (10 mg/kg PO for 20 days). The infection probably resulted from inoculation of subcutaneous tissues by material containing this Mycobacterium following fight or bite injuries. The presentation is reminiscent of similar lesions attributable to rapidly growing mycobacterial infections of the subcutis observed in domestic cats and quolls. PMID:20529031

  5. Increasing rate of middle ear ventilation tube insertion in children in denmark

    Djurhuus, Bjarki Ditlev; Skytthe, Axel; Christensen, Kaare;

    2014-01-01

    ventilation tube insertions distributed among 269,459 different children were identified. From 1997 to 2010 the age standardized incidence rate in 0-15-year-olds increased from 26 to 40 per 1000 person years with an estimated annual increase of 2.0% (95% confidence interval 1.9-2.1%). The largest increase in......OBJECTIVE: To study the incidence rates of middle ear ventilation tube insertion in children aged 0 to 15 years in Denmark from 1997 to 2010. METHODS: Using two national registers, the Danish National Health Service Register and the Danish National Patient Register, practically all cases of middle...... incidence rate was found in 1-year-olds with an annual increase of 4.5% (95% confidence interval 4.4-4.6%). Age-specific incidence rates remained at maximum around the age of 14 months throughout the period. The cumulative incidence proportion for the 2010 birth cohort by the time they reach the age of 5...

  6. RESEARCHES REGARDING THE TECHNOLOGICAL PERFORMANCES OF CARP REARING DURING WINTER PERIOD IN THE CONDITIONS OF A RECIRCULATING AQUACULTURE SYSTEM

    G. STEFAN

    2013-12-01

    Full Text Available The techniques of carp culture are highly diversified, ranging from the extensive production in pond or open water with no fertilization or supplemental feeding to highly intensive systems in concrete tanks or cages. Among the different carp species, common carp is the best species reared in intensive monoculture, the others (Chinese and Indian carps being usually cultivated in polyculture (P. Kestemont, 1995. An experiment was conducted in inside recirculation system conditions to identify the technological performances on carp growth and survival at the Fishing and Aquaculture Department, Galati, during winter period (February, 2007 – March, 2007. The 1-year-old carp (Cyprinus carpio 4792g; 4594 g; 4561 g and 4525 g (total weight grew to 7384g; 7017g; 6924g and 7125 g in 44 days in aquarium 1, 2, 3 and 4, respectively. In all aquariums, the fish appeared healthy and no mortality was observed. Feed conversion efficiencies (FCE had similar values among all aquariums, the highest FCE being found in B4 aquarium with 1, 57 value. Water quality parameters were acceptable range for fish culture. Results show that the carp rearing during winter period in the inside recirculation system is a very good economic solution.

  7. Development of the gonads in the triploid (ZZW and ZZZ) fowl, Gallus domesticus, and comparison with normal diploid males (ZZ) and females (ZW).

    Lin, M; Thorne, M H; Martin, I C; Sheldon, B L; Jones, R C

    1995-01-01

    Gonadal development in fowls aged from 1 day to more than 4.5 years was studied in 63 ZZW and 16 ZZZ triploid crossbreds and compared with normal diploid males (ZZ) and females (ZW). In the ZZW fowl, the right gonad developed into a testis (although this occurred earlier in the ZZ genotype), and a structurally-abnormal excurrent duct system containing some malformed spermatids and spermatozoa was associated with the gonad of young adults. The left gonad was an ovotestes at hatching and no excurrent ducts were associated with it. The ovarian component was much less developed than that in the ZW genotype-it started to degenerate by 1 week of age, and most of the oocytes had disappeared by about 3 weeks of age. The seminiferous tubules developed in the medullary region, but only abnormal spermatozoa were produced. Leukocytes infiltrated both gonads at about 9 months of age and the seminiferous epithelium had degenerated in most fowls over 1 year old. In ZZZ fowl, gonadal and excurrent duct development was normal, but occurred earlier than in the ZZ genotype. However, meiosis and spermiogenesis were abnormal and malformed spermatozoa were produced. The heads of spermatozoa from the ducts deferens were about 1.4-times longer in the ZZZ genotype than in the ZZ genotype, indicating that the former may be producing some diploid spermatozoa. PMID:8848586

  8. [Infanticide. Social and forensic aspects].

    Bätje, C; Schläfke, D; Nedopil, N; Hässler, F

    2011-07-01

    Infanticides are not specifically classified in German criminal records. Thus, the number of infanticides varies depending on different sources of information. Reports from expert witnesses (n=48, 1980-2007) from the German regions around Munich and Rostock were analyzed retrospectively in order to identify sociodemographic, clinical and forensic characteristics of child murders. In 87.5% of the cases the victims were the natural children of which 25 were younger than 1 year old. Female offenders outnumbered male offenders by 3:1 and on average females were 8 years younger than males (26.5 years for females and 34.2 years for males). The motives included unwanted pregnancy/child, altruistic deeds, acute psychoses, child abuse (sexual abuse, neglect or negligence), drug or alcohol abuse, sadistic punishment of the child and revenge on partners. In 27 cases a restricted or exemption from criminal responsibility was acknowledged. About one third of the offenders consulted a physician before the crime. For an improvement in primary prevention, support networks should be integrated and sensitized to the problem. PMID:20617427

  9. Evaluation of cortical plasticity in children with cerebral palsy undergoing constraint-induced movement therapy based on functional near-infrared spectroscopy

    Cao, Jianwei; Khan, Bilal; Hervey, Nathan; Tian, Fenghua; Delgado, Mauricio R.; Clegg, Nancy J.; Smith, Linsley; Roberts, Heather; Tulchin-Francis, Kirsten; Shierk, Angela; Shagman, Laura; MacFarlane, Duncan; Liu, Hanli; Alexandrakis, George

    2015-04-01

    Sensorimotor cortex plasticity induced by constraint-induced movement therapy (CIMT) in six children (10.2±2.1 years old) with hemiplegic cerebral palsy was assessed by functional near-infrared spectroscopy (fNIRS). The activation laterality index and time-to-peak/duration during a finger-tapping task and the resting-state functional connectivity were quantified before, immediately after, and 6 months after CIMT. These fNIRS-based metrics were used to help explain changes in clinical scores of manual performance obtained concurrently with imaging time points. Five age-matched healthy children (9.8±1.3 years old) were also imaged to provide comparative activation metrics for normal controls. Interestingly, the activation time-to-peak/duration for all sensorimotor centers displayed significant normalization immediately after CIMT that persisted 6 months later. In contrast to this improved localized activation response, the laterality index and resting-state connectivity metrics that depended on communication between sensorimotor centers improved immediately after CIMT, but relapsed 6 months later. In addition, for the subjects measured in this work, there was either a trade-off between improving unimanual versus bimanual performance when sensorimotor activation patterns normalized after CIMT, or an improvement occurred in both unimanual and bimanual performance but at the cost of very abnormal plastic changes in sensorimotor activity.

  10. Range of motion exercise of temporo-mandibular joint with hot pack increases occlusal force in patients with Duchenne muscular dystrophy.

    Nozaki, S; Kawai, M; Shimoyama, R; Futamura, N; Matsumura, T; Adachi, K; Kikuchi, Y

    2010-12-01

    The purpose of this study is to evaluate whether the range of motion exercise of the temporo-mandibular joint (jaw ROM exercise) with a hot pack and massage of the masseter muscle improve biting disorder in Duchenne muscular dystrophy (DMD). The subjects were 18 DMD patients (21.3+/- 4.1 years old). The jaw ROM exercise consisted of therapist-assisted training (2 times a week) and self-training (before each meal every day). The therapist-assisted training consisted of the application of a hot pack on the cheek of the masseter muscle region (15 minutes), the massage of the masseter (10 minutes), and jaw ROM exercise (5 minutes). The self-training involved jaw ROM exercise by opening the mouth to the maximum degree, ten times. These trainings continued for six months. Outcomes were evaluated by measuring the greatest occlusal force and the distance at the maximum degree of mouth opening between an incisor of the top and that of the bottom. Six months later, the greatest occlusal force had increased significantly compared with that at the start of jaw ROM exercise (intermediate values: from 73.8N to 97.3N) (p = 0.005) as determined by the Friedman test and Scheffi's nonparametric test. The patients' satisfaction with meals increased. However, the maximum degree of mouth opening did not change after six months of jaw ROM exercise. Jaw ROM exercise in DMD is effective for increasing the greatest occlusal force. PMID:21574523

  11. Reasoning about instrumental and communicative agency in human infancy.

    Gergely, György; Jacob, Pierre

    2012-01-01

    Theoretical rationality and practical rationality are, respectively, properties of an individual's belief system and decision system. While reasoning about instrumental actions complies with practical rationality, understanding communicative actions complies with the principle of relevance. Section 2 reviews the evidence showing that young infants can reason about an agent's instrumental action by representing her subjective motivations and the episodic contents of her epistemic states (including false beliefs). Section 3 reviews the evidence showing special sensitivity in young human infants to some ostensive behavioral signals encoding an agent's communicative intention. We also address the puzzle of imitative learning of novel means actions by 1-year olds and argue that it can be resolved only by assuming that the infant construes the model's demonstration as a communicative, not an instrumental, action. Section 4 reviews the evidence for natural pedagogy, a species-unique social communicative learning mechanism that exploits human infants' receptivity to ostensive-communicative signals and enables infants to acquire kind-wide generalizations from the nonverbal demonstrations of communicative agents. We argue that the essentialist bias that has been shown to be involved in children's concepts of natural kinds also applies to infants' concepts of artifacts. We further examine how natural pedagogy may also boost inductive learning in human infancy. PMID:23205408

  12. FEMALE EPISPADIAS: A CASE REPORT AND REVIEW OF THE LITERATURE

    R. Angotti

    2012-05-01

    Full Text Available Female epispadias without bladder exstrophy is an extremely rare anomaly, occurring in 1 in 480.000 female population. It’s the mildest form of the extrophy-epispadias-complex (EEC, that is the most se- rious form of abdominal midline malformation (incidence of EEC can be estimated at 1 in 10.000 births. It’s imperative to diagnose this ab- normalities at birth, because that's enough a complete local examina- tion and a good patient’s past medical history, when the patient is greater, about congenital urinary incontinence and recurrent urinary tract infection. The early diagnosis, so the early treatment, is very im- portant to reduce the psychological and psychosocial problems and prevent the urinary incontinence, that’s a real problem for the social life of the patient. The pathology can be corrected by surgical recon- struction of bladder neck, urethra and external genitalia. Epispadias surgery is a reconstructive surgery and it has mainly two aims: the correction of the urinary incontinence and the reconstruct of the ex- ternal genitalia with good aesthetic appearance. In this case report we present a 3-years-old girl with isolated female epispadias, who un- derwent just one operation to correct her anomaly. In this patient the epispadias was unrecognized until 1 years-old. We reviewed, also, the Literature about cases of female epispadias that confirmed the rarity of the disease.

  13. Cardiomyopathy in captive African hedgehogs (Atelerix albiventris).

    Raymond, J T; Garner, M M

    2000-09-01

    From 1994 to 1999, 16 captive African hedgehogs (Atelerix albiventris), from among 42 necropsy cases, were diagnosed with cardiomyopathy. The incidence of cardiomyopathy in this study population was 38%. Fourteen of 16 hedgehogs with cardiomyopathy were males and all hedgehogs were adult (>1 year old). Nine hedgehogs exhibited 1 or more of the following clinical signs before death: heart murmur, lethargy, icterus, moist rales, anorexia, dyspnea, dehydration, and weight loss. The remaining 7 hedgehogs died without premonitory clinical signs. Gross findings were cardiomegaly (6 cases), hepatomegaly (5 cases), pulmonary edema (5 cases), pulmonary congestion (4 cases), hydrothorax (3 cases), pulmonary infarct (1 case), renal infarcts (1 case), ascites (1 case), and 5 cases showed no changes. Histologic lesions were found mainly within the left ventricular myocardium and consisted primarily of myodegeneration, myonecrosis, atrophy, hypertrophy, and disarray of myofibers. All hedgehogs with cardiomyopathy had myocardial fibrosis, myocardial edema, or both. Other common histopathologic findings were acute and chronic passive congestion of the lungs, acute passive congestion of the liver, renal tubular necrosis, vascular thrombosis, splenic extramedullary hematopoiesis, and hepatic lipidosis. This is the first report of cardiomyopathy in African hedgehogs. PMID:11021439

  14. Determination of Microbial Nitrogen Production by Using Urinary Allantoin and Blood Metabolite Concentrate in Growing Brahman Cattle Fed the Different Proportion of Roughage and Concentrate in Diets

    Determination of microbial nitrogen synthesis by using urinary allantoin and blood metabolite for evaluating the efficiency of feed utilization, in this study was conducted by using four Brahman bulls (about 1 year old). Animals were fed ad libitum with 4 fixed diets of four combinations of pineapple fibre (P) and concentrate (C) in the proportions, on dry matter basis of 0.8:0.2 (P80:C20), 0.6:0.04(P60:C40), 0.4:0.6(P40:C60) and 0.2:0.8 (P20:C80). The experiment was designed as a 4x4 Latin square design The Results showed that increasing in the proportion of concentrate linearly increased the rumen microbial nitrogen production (p<0.001), the concentrations of Insulin and urea-N in plasma and the concentration of urea-N in the urine, but not affected on the concentrations of glucose and creatinine in plasma. In conclusion, the using of allantoin urinary associated with blood metabolite can evaluate the accuracy in evaluation of feed utilization in Brahman cattle

  15. What is your diagnosis? Biopsy impression smear of a hepatic mass in a yearling Thoroughbred filly.

    Gold, Jenifer R; Warren, Amy L; French, Tracy W; Stokol, Tracy

    2008-09-01

    A 1-year-old Thoroughbred filly was presented to the Cornell University Hospital for Animals with a 10-day history of fever, diarrhea, inappetance, and hypodipsia. Clinical pathology abnormalities found by the referring veterinarian included erythrocytosis, hyperproteinemia, and increased serum gamma-glutamyltransferase and lactate dehydrogenase activities. At Cornell University, the laboratory abnormalities were confirmed and also included thrombocytosis and hypoglycemia. Erythrocytosis persisted despite vigorous fluid therapy. Ultrasound examination revealed an extremely enlarged liver with abnormal echogenicity and a 21 x 25-cm hepatic mass with varied echogenicity. Imprints of an ultrasound-guided biopsy of the mass revealed a neoplastic epithelial population of uncertain origin, although the cells did not resemble hepatocytes. Together with the presenting signs, signalment, ultrasonographic findings, and persistent erythrocytosis, the cytologic findings were considered to be most consistent with hepatoblastoma. Histopathologic examination of the mass at necropsy confirmed the diagnosis and findings also included bone marrow erythroid hyperplasia. Serum erythropoietin concentration was 28.0 mU/mL (reference interval 1.0-11.8 mU/mL), supporting erythropoietin production by the tumor and secondary inappropriate erythrocytosis. To our knowledge, this report is the first to document secondary erythrocytosis with increased erythropoietin concentration in a horse with hepatoblastoma, and also the first to describe the cytopathologic features of this rare tumor. PMID:18761530

  16. Prolonged breast feeding, diarrhoeal disease, and survival of children in Guinea-Bissau

    Mølbak, K; Gottschau, A; Aaby, P;

    1994-01-01

    were recorded for three years. SETTING: 301 randomly selected houses in a semiurban area in the capital, Bissau. SUBJECTS: 849 children aged less than 3 years. MAIN OUTCOME MEASURES: Incidence and duration of diarrhoea, weight for age, and death of a child. RESULTS: The incidence of diarrhoea was......OBJECTIVE: To analyse the impact of breast feeding on diarrhoeal disease and survival in children above 1 year of age in Guinea-Bissau, west Africa. DESIGN: A community study of an open cohort followed up weekly by interviews over 15 months. Data on feeding practices, anthropometry, and survival...... higher in weaned children than in partially breast fed children, both in 1 year olds (relative risk 1.41; 95% confidence interval 1.23 to 1.62) and in 2 year olds (1.67; 1.29 to 2.15). The mean duration of an episode of diarrhoea was 5.3 days in breast fed children compared with 6.3 days in weaned...

  17. [Major features of decline of Pinus sylvestris var. mongolica plantation on sandy land].

    Wu, Xiangyun; Jiang, Fengqi; Li, Xiaodan; Xue, Yang; Qiu, Sufen

    2004-12-01

    In view of the decline of man-made sand-fixation forest of Pinus sylvestris var. mongolica in Zhanggutai sand land of Liaoning Province, this paper studied the major characteristics of the decline. The appearance of the declining man-made sand-fixation forest of Pinus sylvestris var. mongolica was grey green, its needle leaf was very thin, the blooming and fruiting rate was low, the average quantity of cones per tree was only 10.4-16.5, with only 6.96 g to 7.39 g per thousand seeds, and there were many empty and astringent seeds. The seasonal dynamics of nutrients in 2-year-old pine needle leaf was similar, i.e., the N and P contents decreased, while K content increased, showing that the nutrient cycle was imbalance. The chlorophyll content in 2-year-old needle leaf of declined forest was high, while that in 1-year-old healthy forest was also high but with a wide increasing range. The infected harm of shoot blight was the clearest mark to the decline of man-made sand-fixation forest of Pinus sylvestris var. mongolica. After the forest declined, the height and the DBH of the pine trees decreased evidently, and the structure of DBH distribution moved "left". The quantity of weak pine trees increased by 15.9%-27.2%, the roots decreased by 22.9%-28.9%, and the absorbing roots (diameter < 0.5 cm) decreased most seriously. PMID:15825430

  18. [Effects of artificial tending on Pinus tabulaeformis forest growth and its structural characteristics].

    Cao, Yun; Yang, Yie; Song, Bingyu; Huang, Heping; Yang, Mingbo; Zheng, Min

    2005-03-01

    The investigation on the growth status, community composition, and structural characteristics of Pinus tabulaeformis forest artificially tended for six years showed that there were significant differences in the average DBH, height, and crown size of the forest among the treatments DA (trimming without intermediate cutting), FA (trimming and intermediate cutting) and CK (without trending). Treatment FA had the highest values of average DBH (7.8 +/- 0.29 cm), height (5.5 +/- 0.09 m) and crown size (249 +/- 7.24 cm), while the CK had the lowest ones. The average biomass of new leaf (1-year-old), old leaf (2 or more-year-old), and branch per tree increased significantly (P<0.01) with enhancing tending treatments. The aboveground biomass of treatment FA was the biggest (44.0 t x hm(-2)), and that of CK was the smallest (14.9 t x hm(-2)). The leaf length and SLA at the early and terminal stages of development (May, June and September) had significant difference among the treatments, and the amount of community composition and the cover degree of undergrowth plants increased evidently under artificial tending treatments. PMID:15943345

  19. Age-related changes in semen quality characteristics and expectations of reproductive longevity in Duroc boars.

    Huang, Yu Hung; Lo, Ling Ling; Liu, Shyh Hwa; Yang, Tien Shuh

    2010-08-01

    Quadratic fitting was used to regress semen characteristics of 1441 samples consisting of 12-month collection from 58 Duroc boars against animal age varied from 10 to 80 months. Data was divided into two groups of cool (14.0-22.7 degrees C, RH 81.5%) and hot season (22.9-29.9 degrees C, RH 86.6%), to test effects of age, season and their interactions. Results revealed that young boars of around 1 year old could endure the hot season. The endurance gradually diminished as animals grew. In the hot season animals exhibited peak performance at age around 33 month and it remained for 1 month, while cool-season kept boars could last for 48 months from 16 months old onward. The reproductive longevity should be 51 month in a subtropical environment and it may extend to 70 month if heat stress can be avoided. The estimated total sperm contribution of a Duroc boar would be 1.8 times more when kept below 22 degrees C than in a natural subtropical environment. It is concluded that to maintain Duroc boars as semen donor to at least 4 years of age is feasible in a subtropical environment and boar longevity could reach 6 years old if well kept in a temperate region. PMID:20662811

  20. Stress among nurses: an examination of salivary cortisol levels on work and day off

    Maria Cecilia Pires da Rocha

    2013-10-01

    Full Text Available The present study evaluates the use of salivary cortisol concentration as a physiological index of the stress level among nurses on their work day and day off and correlates it with the questionnaire used to measure occupational stress in nurses (Inventário de Estresse em Enfermeiros - IEE. This is a comparative, cross-sectional descriptive study in which sociodemographic data, IEE results and salivary cortisol levels were used. Fifty-seven nurses participated in the study (80.7% females and a mean age of 37.1 years old. The IEE average score was 124.5. The average cortisol level was 564.1 ng/m on work day and 354.1 ng/mL on day off. Nurses who had double workdays presented high values of salivary cortisol during the work day (638.1 ng/mL. In conclusion, salivary cortisol identified the nurses’ stress level, and differences were found between a work day and day off. On the nurses’ day off, their salivary cortisol levels and stress scores were lower.

  1. Genetic Test of New Cottonwood Clones at Nursery Stage

    QINGuanghua; JIANGYuezhong

    2004-01-01

    Twenty-five new clones belong to Populus Aigeiros of both domestic and foreign origin had been introduced and tested at nursery stage in Shandong province. Results showed that height (H),diameter at stem base (DO) and survival rate (SR) varied significantly and genetic variation were very large among the clones. CVg and broad-sense heritability (h2) of H, DO and SR of 1-year-old stock nursery were 7.43%, 9.25%, 18.78% and 78.91%, 96.31%, 95.93%, respectively, showing high genetic control on the tested traits. 11 superior clones with characteristics of high growth rate and medium or high SR were primarily selected and genetic gains (△G) of H, DO and SR were 16.89%, 16.08% and 13.08%, respectively.Rooting habits test of some selected clones were also conducted based on the cutting culture in water container and annual growth increment measured. The date of first root emergence, number of main roots, number of lateral roots, length of main roots and the emergence date of growth peak varied to certain degree among the selected clones.

  2. Effects of Cutting Density on Growth,Yield and Quality of Poplar Clone Seedlings

    Fang Shengzuo; Tian Ye; Yuan Fayin

    2006-01-01

    In order to identify the optimum cutting density for producing the highest number of plantable seedlings of poplar clones,a split-plot randomized block design was used to establish four cutting densities in plots.Based on data on the survival,leaf area,seedling height,caliper,and biomass of 1-year-old seedlings of clones Nanlin-95,Nanlin-895,Nanlin-1388 and NL-80351,the growth characteristics and seedling quality under four cutting densities were analyzed.Results indicated that the leaf area,stern and leaf biomass,and caliper of seedlings of all four poplar clones increased with the decrease in cutting density.Leaf area index reached its highest level at the spacing of 40 cm×40 cm,while the aboveground biomass of the seedling on an area basis increased as the cutting density increased.Seedling quality at low cutting density was higher than that at closer cutting density.The quantity of first-grade seedlings (grade Ⅰ) for clones Nanlin-95 and Nanlin-895 was achieved at the spacing of 40 cm×50 cm;for NL-1388 and NL-80351,it was 50 cm×50 cm.According to the seedling quality and the number of plantable seedlings produced,the suggested cutting density for these four poplar clones was 50,000 stems/hm2.

  3. Radiation contamination after the Chernobyl nuclear accident and the effective dose received by the population of Croatia

    Because of the Chernobyl nuclear accident which led to enhanced deposition of all fission products, contamination of the human environment in the Republic of Croatia was much higher than in the previous two decades. The paper deals with the investigation of deposition and contamination by fission product radionuclides (137Cs and 90Sr, in particular), especially within the human food chain. Its aim was to determine differences in contamination levels resulting from the Chernobyl accident and from large-scale atmospheric nuclear weapon tests. For the year following the Chernobyl accident, the radiation doses received from external and internal exposures were estimated for 1-year old infants, children at the age of 10-years and adults. The corresponding annual effective doses were 1·49, 0·93 and 0·83 mSv, respectively. The paper also gives data on the yearly intakes of 137Cs and 90Sr in foods and the corresponding effective doses received by the population of Croatia over many years from the global fallout following nuclear weapons testing and the Chernobyl accident. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  4. Estudio retrospectivo de las enfermedades respiratorias en felinos diagnosticadas clínicamente en el Hospital Veterinario de la Universidad Austral de Chile, Valdivia, durante el período 1997-2004 A retrospective study on feline respiratory diseases clinically diagnosed at the Universidad Austral de Chile Veterinary Hospital, Valdivia, between 1997 and 2004

    L Azócar

    2008-01-01

    Veterinary Hospital at the Universidad Austral de Chile between 1997 and 2004, were analyzed. A total of 2,068 clinical records were examined, of which 291 were identified as respiratory diseases. Most cases were observed in male felines of less than 1 year-old (53.8%, from 1 to 5.9 year-old (57.8%, and among female felines of 6 years of age and older (64.7%. The most affected topographic area was the upper respiratory tract (57.1%, most likely to occur in felines of less than 1 year-old (58.5%. Feline Respiratory Syndrome was the most frequent diagnosis (128 cases with a high rate of cases in male felines of less than 1 year-old (56.4%, from 1 and 5.9 year-old (54.3% and among felines of 6 years of age and older (75.0%. The frequency of respiratory diseases increased during August (13.7%. Feline Respiratory Syndrome had more cases during March (11.7% and September (12.5%. The respiratory disease endemic index during the study period showed an epidemic curve in March, April, May, July, November and December of 2002. Regarding Feline Respiratory Syndrome, there was an epidemic curve in March, April, June, July, November and December of 2002. It was concluded that respiratory diseases affected more frequently male felines of less than 1 year-old; being the upper respiratory tract the most affected area; Feline Respiratory Syndrome was the most frequent diagnosis and the frequency of feline respiratory diseases varied according to month of the year.

  5. Differential expression of zinc accumulation during two growing seasons of Acacia victoriae

    Ali Mahdavi; Khadijeh Khermandar

    2015-01-01

    It is important to understand seasonal heavy metal accumulation in different parts of plants in order to develop the best phytoremediation practices for con-taminated soils. For this purpose we exposed, 1 year old A. victoriae seedlings to ZnSO4 in 4 different concentrations:0, 50, 250 and 500 mg Zn L-1 for 45 days over two growing seasons. Subsequently, bioaccumulation of Zn in different plant tissues (roots, shoots and leafs) was assessed by Atomic Absorption Spectroscopy (AAS) for two peri-ods. In addition, various growth attributes (dry biomass, shoot and root lengths, plant appearance) and functional traits (leaf area, chlorophyll a, b and total) were measured. The accumulation of Zn was influenced by the Zn con-centration in the growth medium and the number of growing seasons. The amounts of Zn concentrated in the root tissues might indicate A. victoriae as a good option for phytostabilization of soils contaminated by Zn. We rec-ommend that if A. victoriae is used for phytoextraction purposes, then it should be harvested at the end of the first growing season (fall) because at this time the concentra-tions of Zn in the above-ground parts will be maximal.

  6. Carbonic anhydrase in Tectona grandis: kinetics, stability, isozyme analysis and relationship with photosynthesis.

    Tiwari, Anita; Kumar, Pramod; Chawhaan, Pravin H; Singh, Sanjay; Ansari, S A

    2006-08-01

    Carbonic anhydrase (CA, EC: 4.2.1.1) activity in teak (Tectona grandis L.f.) was studied to determine its characteristics, kinetics and isozyme patterns. We also investigated effects of leaf age, plant age and genotype on CA activity and gas exchange parameters. Carbonic anhydrase extracted from leaves in 12 mM veronal buffer, pH 7.8, had a K(m) for CO(2) of 15.20 mM and a V(max) of 35,448 U mg(-1) chlorophyll min(-1), which values declined by 50 and 70%, respectively, after 1 week of storage at 4 degrees C. A 15% native polyacrylamide gel revealed the absence of CA isozymes in teak, with only a single CA band of 45 kD molecular mass observed across 10 segregating half-sib families and groups of trees ranging in age from 10 to 25 years. Activity remained stable during the first month in storage at 0 degrees C, but gradually declined to 25% of the initial value after 1 year in storage. During the period of active growth (February-May), maximal CA activity was observed in fully expanded and illuminated leaves. Significant variation was observed in CA activity across 10 1-year-old half-sib families and 21 5-year-old half-sib families. There was a positive correlation between CA activity and photosynthetic rate in a population of 10-year-old trees (P teak genotypes. PMID:16651256

  7. Rapid population increase in an introduced muskox population, West Greenland

    Carsten Riis Olesen

    1993-10-01

    Full Text Available In 1962 and 1965, 27 (13 and 14 muskox yearlings were translocated from East Greenland (71°N to the Angujaartorfiup Nunaa range in West Greenland (67°N. Angujaartorfiup Nunaa is a 6600 km2 icefree, continental area where caribou are indigenous. The climate is strictly continental with a minimum of precipitation but with abundant vegetation. Aerial surveys in 1990 documented that the muskox population has increased to 2600 heads despite quota-based harvesting since 1988. The annual quota was 200, 300 and 400 for 1988, 1989 and 1990, respectively. Distribution of muskoxen shows a significant preference for low altitude habitats southeast of Kangerlussuaq Airport and around Arnangarnup Qoorua (Paradise valley. Annual population increment averages 30% and the calf crop is around 24% of the population. Yearling recruitment in the population reveals that calf mortality during winter is very limited. About half of the 1-year-old females are served and they eventually give birth to their first calf when they turn 2 years old. With half of the 2-year-old females reproducing, the calf/cow ration ranges between 0.9 and 1.0.

  8. A case of interscapular fibrosarcoma in a dwarf rabbit (Oryctolagus cuniculus).

    Petterino, Claudio; Modesto, Paola; Strata, Daniela; Vascellari, Marta; Mutinelli, Franco; Ferrari, Angelo; Ratto, Alessandra

    2009-11-01

    A 1-year-old, intact, male dwarf rabbit (Oryctolagus cuniculus) was vaccinated against myxomatosis and rabbit viral hemorrhagic disease in February 1999, and a localized reaction appeared in the same anatomic site within a few days. No regression was observed after subcutaneous antibiotic treatment. The rabbit was kept under observation, and the swelling apparently disappeared in 3 months. The owner then decided to avoid any further subcutaneous drug administration. The referring veterinarian examined the animal on July 2006 for the sudden appearance of a nodular, 4.5 cm x 3.5 cm x 2.0 cm, subcutaneous mass located over the interscapular space. Fine-needle aspiration was performed, and a population of neoplastic spindle cells, rare pleomorphic multinucleated cells, and rare leukocytes were observed. The mass was surgically removed, fixed in 10% neutral buffered formalin, and routinely processed for histologic, histochemical, and immunohistochemical diagnostic investigation. The neoplastic tissue exhibited fascicles composed of malignant spindle-shaped cells with elongated to oval hyperchromatic nuclei and scant cytoplasm. Occasional multinucleated cells were also observed. The neoplastic cells were immunoreactive for vimentin but did not stain for smooth muscle actin, desmin, myoglobin, and cytokeratins (AE1/AE3). Moreover, the histochemical stain for aluminum was positive. The diagnosis was fibrosarcoma based on morphologic and immunohistochemical results. The histologic features of this neoplasm were remarkably similar to feline injection-site sarcoma. PMID:19901300

  9. Intussusception in infancy and childhood: evaluation of a prognostic scoring pattern.

    Rege V

    1991-04-01

    Full Text Available This is a retrospective analysis of 82 patients of intussusception in infancy and childhood. Males were more than females in the ratio 2.4 : 1, the ages varied from 2 months to 12 years. Majority (73% were less than 1 year old. Commonest presentations were pain, vomiting, distension, palpable lump and blood and mucus in stools. The management of these patients varied from barium enema reduction (3 cases, reduction by surgery and manipulation (59 cases and resection with primary anastomosis (20 cases. We analysed our patients by giving scores based on clinical criteria. We concluded that the patients in our circumstances do not show any correlation of the scoring pattern with morbidity or mortality, chances of reduction by barium enema or manually. Resection, however, did correlate with a high incidence of death (75%. Resections were required slightly more in ileo-ileal intussusceptions than in those having a colonic involvement, morbidity in the form of wound dehiscence, and sepsis was higher in those patients who had undergone resections.

  10. Animal-Assisted Activities: Results From a Survey of Top-Ranked Pediatric Oncology Hospitals.

    Chubak, Jessica; Hawkes, Rene

    2016-07-01

    Animal-assisted activities (AAA) are increasingly common, yet little is known about practices in pediatric oncology. To address this gap, we surveyed the top 20 pediatric oncology hospitals in the United States in May and June of 2014. Questionnaires were sent via e-mail and generally returned by e-mail or postal mail. Among the 19 responding hospitals, the 18 that offered AAA to pediatric patients formed the basis of our analysis. All sites had written AAA policies. Most programs were restricted to dogs. At 11 hospitals, children with cancer could participate in AAA activities. Outpatient waiting rooms and individual inpatient rooms were the most common locations for AAA with pediatric oncology patients. Safety precautions varied by hospital, but all required hand sanitation after visits and that animals receive an annual health examination, be on a leash or in a carrier, be ≥1 year old, and not be directly from a shelter. Our findings reveal consistencies and variations in practice that may help other hospitals develop their own programs and researchers identify areas of future study. PMID:26589356

  11. Aspectos dos líquidos cefalorraquidianos nas meningites bacterianas

    Claudia E. O. Pires de Campos

    1994-06-01

    Full Text Available Foram colhidos 1815 líquidos cefalorraquidianôs de doentes internados com meningite, no Hospital Emílio Ribas, São Paulo, durante os meses de maio a outubro de 1989. Neisseria meningitidis 56%, dos quais 44% do tipo B; Haemophilus influenzae 17%, sendo 72 % isoladas de neonatos até 3 anos; Streptococcus pneumoniae 14%, dos quais 60% isolados de recém nascidos a 1 ano de idade. O estudo citoquímico liquórico mostrou: celularidade: global > 500cel/mm³ e específica > 70%; proteínas > 90mg/dl e glicose Samples of 1815 cerebrospinal fluid (CSF were studied in a meningitis outbreak during 1989 in São Paulo, Brazil. Neisseria meningitis 56% with 44% type B, Haemophilus influenzae 17%, from which 72% in children (days to 3-year old and Streptococcus pneumoniae 14% from which 60% in children (day to 1- year old of443 (24 %of allstrains. Cytochemistry study showed: purulent or turbidity aspects in 70 to 79% positive bacterioscopy or culture of CSF; white cells count > 500/mm³; glucose 90mg/dl in 90% of all patients. We concluded that: CSF prognostic factors: (aspect and cytochemistry were correlated with bacterial meningitis. Bacterioscopy and positive cultures were correlated to NM, SP and HI isolation from these patients (Goodman Test.

  12. Tendência das meningites por Haemophilus influenzae tipo b no Brasil, em menores de 5 anos, no período de 1983 a 2002 Trends in Haemophilus influenzae type b meningitis in Brazil in children under five years of age from 1983 through 2002

    Sybelle de Souza Castro Miranzi

    2006-10-01

    Full Text Available Trata-se de um estudo ecológico, tipo série histórica (1983-2002, onde foram calculados os coeficientes de incidência, mortalidade e letalidade de meningites por Haemophilus influenzae , tipo b, no Brasil, e avaliou-se a tendência da morbi-mortalidade em menores de 5 anos. Para a análise de tendência dos coeficientes construíram-se modelos de regressão polinomial para as faixas etárias de The study was based on an ecological design using a historical time series (1983-2002, related to Haemophilus influenzae type b meningitis in Brazil. Incidence, mortality and case-fatality rates, as well as trends in incidence and morbidity-mortality were estimated in children less than 5 years of age. Polynomial regression analysis was used to analyze trends, adopting a significance level of 0.05. 43.9% of confirmed cases occurred in infants less than 1 year old and 38.7% in children 1-4 years old. The observed rates were also highest in these two age strata. The incidence and mortality rates showed an increasing trend, until approximately 1999, when a quick decline was observed. The study results reinforce the effectiveness of the Vaccination Program against HIB in Brazil, which benefited age ranges that did not receive the vaccine (Herd Immunity.

  13. Evaluation of a density-based rapid diagnostic test for sickle cell disease in a clinical setting in Zambia.

    Ashok A Kumar

    Full Text Available Although simple and low-cost interventions for sickle cell disease (SCD exist in many developing countries, child mortality associated with SCD remains high, in part, because of the lack of access to diagnostic tests for SCD. A density-based test using aqueous multiphase systems (SCD-AMPS is a candidate for a low-cost, point-of-care diagnostic for SCD. In this paper, the field evaluation of SCD-AMPS in a large (n = 505 case-control study in Zambia is described. Of the two variations of the SCD-AMPS used, the best system (SCD-AMPS-2 demonstrated a sensitivity of 86% (82-90% and a specificity of 60% (53-67%. Subsequent analysis identified potential sources of false positives that include clotting, variation between batches of SCD-AMPS, and shipping conditions. Importantly, SCD-AMPS-2 was 84% (62-94% sensitive in detecting SCD in children between 6 months and 1 year old. In addition to an evaluation of performance, an assessment of end-user operability was done with health workers in rural clinics in Zambia. These health workers rated the SCD-AMPS tests to be as simple to use as lateral flow tests for malaria and HIV.

  14. Mortality following snake bite envenomation by Bitis arietans in an HIV positive child: A case report.

    Firth, Gregory B; Street, Matthew; Ramguthy, Yammesh; Doedens, Linda

    2016-07-01

    Snake bites occur commonly in the rural areas of South Africa. Hospitals where snake bites are uncommon should always have protocols on standby in the event of such cases presenting. This is the first reported case documenting the effect of human immunodeficiency virus (HIV) on snake bite in South African children.A case report and review of relevant information about the case was undertaken.We present a case of a 1-year-old child referred from a peripheral hospital following a snake bite to the left upper limb with a compartment syndrome and features of cytotoxic envenomation. The patient presented late with a wide area of necrotic skin on the arm requiring extensive debridement. The underlying muscle was not necrotic. Polyvalent antivenom (South African Institute of Medical Research Polyvalent Snakebite Antiserum) administration was delayed by 4 days after the snake bite. The patient was also diagnosed with HIV and a persistent thrombocytopenia possibly due to both HIV infection and the snake bite venom. Lower respiratory tract infections with subsequent overwhelming sepsis ultimately resulted in the child's death.The case highlights the challenge of treating a snake bite in a young child with HIV and the detrimental outcome of delayed treatment. A protocol is essential in the management of snake bites in all hospitals.Level IV, Case report.This case highlights the interaction of snake bite envenomation and HIV infection on thrombocytopenia. PMID:27399076

  15. Aging and iron accumulation in the monkey brain

    Iron is deposited in the mammalian brain with a characteristic distribution, its amount increasing with aging. The relative abundance of iron in the globus pallidus, substantia nigra and putamen is thought to be responsible for the hypointensity of these nuclei on T2-weighted MR images, due to magnetic susceptibility effects. However, no quantitative correlation between iron content and hypointensity has been made to confirm this hypothesis. Two young (1-year-old) and two older (18-year-old) rhesus monkeys were studied with MR imaging at different field strengths (0.5, 1.5, 2.0 T). MR signal intensities from different anatomic structures were measured on T2-weighted coronal images (2,6000/80 [repetition time msec/echo time msec]). At completion of the MR studies, the monkeys were killed, coronal brain sections were stained for iron (Perls method), and optical densities of anatomic structures were measured. A quantitative correlation between the iron content and the signal intensity decrease was found on T2-weighted images in both deep and superficial cerebral structures. The detectability of magnetic susceptibility effects in a single structure is determined by the amount of iron present, with the threshold being inversely correlated to the strength of the magnetic field

  16. Vegetational Succession on Different Age Series Sponge Iron Solid Waste Dumps with Respect to Top Soil Application

    B. Kullu

    2011-01-01

    Full Text Available Vegetation composition of different age series sponge iron solid w aste dumps was analyzed with respect to the impact of top soil application on vegetation succession. Study revealed that freshly laid dump, without top soil cover was devoid of any vegetation. However, 1, 3 and 5 year old dumps were colonized by grasses, sedges, forbs and shrubs. Tree species could be recorded in 3 and 5 year old dumps, but were absent in 1 year old dump. In all the dumps, species belonging to forbs showed the highest percentage contribution to species composition which was followed by grasses. Common occurrence of certain plant species in all the dumps indicated their greater adaptability to the adverse condition of waste material. IVI of herbaceous plants gradually decreased with dump age which was replaced by occupation of shrub and tree species in older dump. Among the families, Poaceae dominated in all the dumps. Species richness and diversity showed increasing trend, where as dominance showed decreasing trend with increasing dump age. Patch with top soil cover always showed highest species richness, follow ed by mixed patch and lowest by the patch only with waste material. The study revealed that top soil acted as seed bank and its application on sponge iron solid waste dump positively contributed towards species richness and vegetation growth.

  17. Association of cytogenetics and immunophenotype in prognosis of children with acute lymphoblastic leukemia: Literature Review

    Abdollah Banihashem

    2014-02-01

    Full Text Available Acute lymphoblastic leukemia (ALL is the most common type of neoplastic disorder diagnosed in childhood. It is the cause of one third of all pediatric malignancies. ALL is characterized by the abnormal production and proliferation of immature lymphoblasts in bone marrow (BM. It seems that ALL occurs due to a genetic mutation in DNA structure producing white blood cell (WBC stem cells. Because ALL is a systemic disease, its primary management is based on chemotherapy. There are important risk factors responsible for the poor prognosis of  ALL in children less than 1 year old and greater than 10 years old, such as: high WBC, mature T cell ,mature B cell, central nervous system (CNS involvement, DNA index 10 at diagnosis, no remission at the end of induction therapy and Minimal residual disease at the end of consolidation therapy. Complications might appear during the treatment including tumor lysis syndrome, bleeding, renal failure, sepsis, seizure, thrombosis, etc. Some consequences might identify after a long-term follow-up such as learning impairment, growth retardation, and secondary malignancies. It is estimated that up to 90% of pediatric ALL cases are curable.

  18. Primary Mediastinal Large B-Cell Lymphoma during Pregnancy

    Cesar A. Perez

    2012-01-01

    Full Text Available Non-Hodgkin’s Lymphoma (NHL rarely presents during pregnancy and primary mediastinal large B-cell lymphoma (PMLBCL accounts for approximately 2.5% of patients with NHL. The case of a 22-year-old woman who was diagnosed with Stage IIA PMLBCL during week 13 of her intrauterine pregnancy is described. The staging consisted in computed tomography (CT of the chest and magnetic resonance imaging (MRI of the abdomen and pelvis. She was managed with R-CHOP regimen (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone for a total of six cycles and, because of the early presentation during the second trimester, she received the entire chemotherapy course during the pregnancy. She delivered a healthy baby at 34 weeks of pregnancy and a 18FDG-PET/CT scan demonstrated complete remission after delivery. After 20 months of follow up she remains with no evidence of disease and her 1-year-old son has shown no developmental delays or physical abnormalities. PMLBCL, although an uncommon subgroup of DLBCL, may present during pregnancy and R-CHOP should be considered as one suitable option in this complex scenario.

  19. SPM analysis of cerebrovascular reserve capacity after stimulation with acetazolamide measured by Tc-99m ECD SPECT in normal brain MRI patient

    This study was undertaken to evaluate normal response of acetazolamide in normal individuals, whose brain MRI is normal, using SPM99. In total, 10 Tc- 99m ECD brain SPECT were evaluated retrospectively. The half of the patients were male. Their mean age was 47.1 years old with a range of 33-61 years. They all visited our neurology department to evaluate stroke symptom. Their brain MRI was normal. Rest/acetazolamide brain SPECT was perfomed using Tc-99m ECD and the sequential injection and subtraction method. SPECT was acquired using fanbeam collimators and triple-head gamma camera (MultiSPECT III, Siemens medical systems, Inc. Hoffman Estates, III, USA). Chang's attenuation correction was applied their brain SPECT revealed normal rCBF pattern in visual analysis by two nuclear physician and they were diagnosed clinically normal. Using SPM method, we compared rest brain SPECT images with those of acetazolamide brain SPECT and measured the extent of the area with significant perfusion change (P<0.05) in predefined 34 cerebral regions. Acetazolamide brain SPECT showed no significant decreased region in comparison to rest brain SPECT. Only small portion of left mid temporal gyrus revealed increased rCBF on acetazolamide brain SPECT in comparison to rest brain SPECT. It apperas that there is no significant change in rCBF between rest and acetazolamide brain SPECT using Tc-99m ECD. The small number of this study is limitation of our study

  20. Seasonal and Tissue Age Influences on Endophytic Fungi of Pinus tabulaeformis (Pinaceae) in the Dongling Mountains,Beijing

    Liang-Dong Guo; Guo-Rui Huang; Yu Wang

    2008-01-01

    Endophytic fungi associated with Pinus tabulaeformis Carr.were investigated in the Dongling Mountains of Beijing.A total of 16200 tissue segments of P.tabulaeformis from four sample collections were processed,and 10659 fungal isolates were recovered.The overall colonization and isolation rates of endophytic fungi from high to low were spring>winter>autumn>summer and in different tissues were bark>needle>xylem,irrespective of sampling seasons.The colonization rates of endophytic fungi of needles increased with age in the four sample collections.There were no significant differences of the colonization rates of endophytic fungi among 1-,2-,and 3-year-old bark and xylem,except for significantly lower colonization rates in 1-year-old bark than in 2- and 3-year-old bark in summer.A similar trend of the isolation rates of endophytic fungi occurred.A total of 24 fungal taxa were recorded,of these five taxa Alternaria alternata,Leptostroma sp.,Pestalotiopsis besseyi,Phoma lingam,and Phomopsis archeri,were consistently isolated as the common fungi in each sample collection.Our results suggest that some fungi show a certain degree of tissue recurrence or specificity,and the composition of endophytic assemblages is not conspicuously influenced by the seasonal factor.

  1. Feasibility of perfusion cardiovascular magnetic resonance in paediatric patients

    Kellenberger Christian

    2009-01-01

    Full Text Available Abstract Aims As coronary artery disease may also occur during childhood in some specific conditions, we sought to assess the feasibility and accuracy of perfusion cardiovascular magnetic resonance (CMR in paediatric patients. Methods and results First-pass perfusion CMR studies were performed under pharmacological stress with adenosine and by using a hybrid echo-planar pulse sequence with slice-selective saturation recovery preparation. Fifty-six perfusion CMR examinations were performed in 47 patients. The median age was 12 years (1 month-18 years, and weight 42.8 kg (2.6-82 kg. General anaesthesia was required in 18 patients. Mean examination time was 67 ± 19 min. Diagnostic image quality was obtained in 54/56 examinations. In 23 cases the acquisition parameters were adapted to patient's size. Perfusion CMR was abnormal in 16 examinations. The perfusion defects affected the territory of the left anterior descending coronary artery in 11, of the right coronary artery in 3, and of the circumflex coronary artery in 2 cases. Compared to coronary angiography, perfusion CMR showed a sensitivity of 87% (CI 52-97% and a specificity of 95% (CI 79-99%. Conclusion In children, perfusion CMR is feasible and accurate. In very young children (less than 1 year old, diagnostic image quality may be limited.

  2. Impact of Obesity and Underweight on Surgical Outcome of Lumbar Disc Herniation

    Farzad Omidi-Kashani

    2014-01-01

    Full Text Available Background. The relationship between underweight and lumbar spine surgery is still unknown. Aim. To evaluate the effect of underweight versus obesity based on surgical outcome of lumbar disc herniation. Material and Method. In this retrospective study, we evaluated 206 patients (112 male and 94 female with a mean age of 37.5±3.1 years old (ranged 20–72 who have been surgically treated due to the refractory simple primary L4-L5 disc herniation. We followed them up for a mean period of 42.4±7.2 months (ranged 24–57. We used Body Mass Index (BMI, Oswestry Disability Index (ODI, and Visual Analogue Scale (VAS for categorization, disability, and pain assessment, respectively. We used Wilcoxon and Mann-Whitney U tests for statistics. Results. Surgical discectomy in all weight groups was associated with significant improvement in pain and disability, but intergroup comparison showed these improvements in both underweight and obese groups and they were significantly lower than in normal weight group. Excellent and good satisfaction rate was also somewhat lower in both these ends of weight spectrum, but statistically insignificant. Conclusion. Both obesity and underweight may have adverse prognostic influences on the surgical outcome of lumbar disc herniation, although their impact on subjective satisfaction rate seems to be insignificant.

  3. Grassland carbon sequestration and emissions following cultivation in a mixed crop rotation

    Acharya, Bharat Sharma; Rasmussen, Jim; Eriksen, Jørgen

    2012-01-01

    grassland and a pea field as reference. Aboveground and root biomass were determined and soils were incubated to study CO2 emissions after soil disturbance. Aboveground biomass was highest in 1-year-old grassland with slurry application and lowest in 4-year-old grassland without slurry application. Root...... biomass was highest in 4-year-old grassland, but all 1–4-year-old grasslands were in between the pea field (0.81 ± 0.094 g kg−1 soil) and the 17-year-old grassland (3.17 ± 0.22 g kg−1 soil). Grazed grasslands had significantly higher root biomass than cut grasslands. There was no significant difference in......Grasslands are potential carbon sinks to reduce unprecedented increase in atmospheric CO2. Effect of age (1–4-year-old) and management (slurry, grazing multispecies mixture) of a grass phase mixed crop rotation on carbon sequestration and emissions upon cultivation was compared with 17-year-old...

  4. Metacognición, escritura y rendimiento académico en universitarios de Colombia y Francia

    Kiara Campo

    2016-04-01

    Full Text Available The main of this article were: (1 To describe the degree of objectives knowledge and the planning strategies identified by university students in relation to the process of developing written texts, and (2 to establish the link between the students’ perception about these processes and the academic success. The hypothesis was that the students that describe a low degree of metacognitive knowledge and planning strategies used in the process of writing, show low levels of academic success. A comparative and descriptive research design was used with 462 students selected intentionally from two psychology programs (231 Colombian and 231 French students with average age of 18.8 and 20.1 years old respectively. These students completed a questionnaire composed by two scales: Metacognitive Knowledge and Planning Strategies in Writing. It was found that the students acknowledged their metacognitive knowledge used when developing their written texts. The Colombian students described that they use planning strategies occasionally while the French students declared that they use this strategy more frequently. In addition, a positive correlation appeared between the metacognition and the academic success.

  5. Clinical and course indicators of bipolar disorder type I with and without opioid dependence

    Amir Shabani

    2010-01-01

    Full Text Available Background: The existing evidence about the clinical situations of the bipolar patients with opioid dependence is scarce. The present study was carried out to compare the clinical features and course of the bipolar disorder type I re-garding the two subgroups of opioid dependent and non- dependent. Methods: There were 178 adult patients with bipolar disorder type I consecutively referred to the Iran Hospital of Psy-chiatry, Tehran, Iran, from January 2008 to January 2009 who enrolled in the study. The Persian Structured Clinical Interview for DSM- IV axis I disorders (SCID- I, HDRS- 17, and Y- MRS were administered for all patients. Other clini-cal information was gathered through the face- to- face interviews with the probands and the hospital records. The T test, Chi square test and logistic regression were used to analyze the data. Results: The mean age of probands were 33.6 ± 11.1 years old and they were mostly male. Among the evaluated indi-ces, the factors gender, anxiety disorders comorbidity, non- adherence, and positive family history were different sig-nificantly and independently from the other studied factors between opioid dependent and non- dependent bipolar pa-tients. Conclusions: Despite some differences, the opioid dependent and non- dependent bipolar patients did not have any significant difference regarding most of the examined clinical and course indices.

  6. Influence of solar UV radiation on the nitrogen metabolism in needles of Scots pine (Pinus sylvestris L.)

    Krywult, Marek [Department of Instrumental Analysis, Provincial Sanitary-Epidemiological Station, State Sanitary Inspection, Pradnicka 76, PL-31-202 Krakow (Poland)], E-mail: marasek2@gazeta.pl; Smykla, Jerzy [Department of Biodiversity, Institute of Nature Conservation, Polish Academy of Sciences, Mickiewicza 33, PL-31-120 Krakow (Poland)], E-mail: smykla@iop.krakow.pl; Kinnunen, Heli [Finnish Forest Research Institute, Rovaniemi Research Unit, P.O. Box 16, FI-96301 Rovaniemi (Finland)], E-mail: heli.kinnunen@gmail.com; Martz, Francoise [Finnish Forest Research Institute, Rovaniemi Research Unit, P.O. Box 16, FI-96301 Rovaniemi (Finland)], E-mail: francoise.martz@metla.fi; Sutinen, Marja-Liisa [Finnish Forest Research Institute, Rovaniemi Research Unit, P.O. Box 16, FI-96301 Rovaniemi (Finland); Department of Biology, University of Oulu, P.O. Box 3000, FI-90014 (Finland)], E-mail: marja-liisa.sutinen@metla.fi; Lakkala, Kaisa [Arctic Research Centre, Finnish Meteorological Institute (FMI-ARC), Taehtelaentie 62, FI-99600 Sodankylae (Finland)], E-mail: kaisa.lakkala@fmi.fi; Turunen, Minna [Arctic Centre, University of Lapland, POB 122, FI-96101 Rovaniemi (Finland)], E-mail: minna.turunen@ulapland.fi

    2008-12-15

    Needles of 20-year-old Scots pine (Pinus sylvestris L.) saplings were studied in an ultraviolet (UV) exclusion field experiment (from 2000 to 2002) in northern Finland (67 deg. N). The chambers held filters that excluded both UV-B and UV-A, excluded UV-B only, transmitted all UV (control), or lacked filters (ambient). UV-B/UV-A exclusion decreased nitrate reductase (NR) activity of 1-year-old needles of Scots pines compared to the controls. The proportion of free amino acids varied in the range 1.08-1.94% of total proteins, and was significantly higher in needles of saplings grown under UV-B/UV-A exclusion compared to the controls or UV-B exclusion. NR activity correlated with air temperature, indicating a 'chamber effect'. The study showed that both UV irradiance and increasing temperature are significant modulators of nitrogen (N) metabolism in Scots pine needles. - This research presents new information on the responses of N metabolism, particularly nitrate reductase (NR) activity, of Scots pine needles to UV radiation and temperature.

  7. Studies and Observations on the Spawning of Oreochromis Niloticus Species Reared at SCDP Nucet - Dambovita

    Cecilia Bucur

    2012-10-01

    Full Text Available At the Fish Culture Research and Development Station Nucet, in 2011 were achieved studies and observations on the reproduction, sexual organs and seminal products of Oreochromis niloticus tropical species. A batch of 140 breeders of 1 year old Nile tilapia (T1 was stoked both in a pond as in Ewos tanks in two variants of density (VI – 8 fish/tank, (VII – 12 fish/tank. In a third variant were used 2 years old Nile tilapia breeders (T2, (VIII – 4 fish/tank. The male/female ratio in all variants from tanks was 1:3. Independently, into another tank were stoked 20 males. Into the pond, spawning was achieved naturally, and on the tank variants, the eggs were gathered from the mouth of females and incubated in different incubation systems. On both rearing systems, under the climatic conditions from Nucet (south of Romania were achieved 3 generations of Nile tilapia fry. On the female breeders, were determined: the gonad-somatic ratio, theoretical and adjective prolificacy (no. of eggs/g of ovary, and for males were achieved spermatozoa motility tests and determination of spermatozoa number per unit of volume.

  8. Effect of storage on the chemical composition and biological activity of several popular South African medicinal plants.

    Stafford, G I; Jäger, A K; van Staden, J

    2005-02-10

    The in vitro biological activity of nine frequently used medicinal plants in South Africa was assessed and re-assessed after various lengths of storage. The plants investigated were Alepidea amatymbica, Leonotis leonurus, Drimia robusta, Vernonia colorata, Merwilla natalensis, Eucomis autumnalis, Bowiea volubilis, Helichrysum cymosum and Siphonochilus aethiopicus. Water, ethanol and hexane extracts of fresh, 90-day-old and 1-year-old material were assayed for antibacterial activity against four strains of bacteria and for COX-1 inhibition activity. TLC-fingerprints of the fresh and stored extracts were produce to document chemical changes. Alepidea amatymbica, Eucomis autumnalis, Helichrysum cymosum, Leonotis leonurus, Siphonochilus aethiopicus and Vernonia colorata were investigated further as to the effect of 1 year's storage. Elevated temperature and humidity (55 degrees C and 100% relative humidity) were used to accelerate the ageing process of Alepidea amatymbica, Leonotis leonurus and Vernonia colorata plant material for further investigation. The TLC-fingerprints indicated that there was chemical breakdown during storage in certain species. The degree of changes in biological activity and chemistry due to storage were species-specific. In general, antibacterial activity was retained in most species while COX-1 inhibition activity was lost rapidly. PMID:15652284

  9. Defects in myelination, paranode organization and Purkinje cell innervation in the ether lipid-deficient mouse cerebellum.

    Teigler, Andre; Komljenovic, Dorde; Draguhn, Andreas; Gorgas, Karin; Just, Wilhelm W

    2009-06-01

    Ether lipids (ELs), particularly plasmalogens, are essential constituents of the mammalian central nervous system. The physiological role of ELs, in vivo, however is still enigmatic. In the present study, we characterized a mouse model carrying a targeted deletion of the peroxisomal dihydroxyacetonephosphate acyltransferase gene that results in the complete lack of ELs. Investigating the cerebellum of these mice, we observed: (i) defects in foliation patterning and delay in precursor granule cell migration, (ii) defects in myelination and concomitant reduction in the level of myelin basic protein, (iii) disturbances in paranode organization by extending the Caspr distribution and disrupting axo-glial septate-like junctions, (iv) impaired innervation of Purkinje cells by both parallel fibers and climbing fibers and (v) formation of axon swellings by the accumulation of inositol-tris-phosphate receptor 1 containing smooth ER-like tubuli. Functionally, conduction velocity of myelinated axons in the corpus callosum was significantly reduced. Most of these phenotypes were already apparent at P20 but still persisted in 1-year-old animals. In summary, these data show that EL deficiency results in severe developmental and lasting structural alterations at the cellular and network level of the cerebellum, and reveal an important role of ELs for proper brain function. Common molecular mechanisms that may underlie these phenotypes are discussed. PMID:19270340

  10. Predisposing factors for renal scarring in children with urinary tract infection

    Fatemeh Beiraghdar

    2012-01-01

    Full Text Available This study was undertaken to determine the predisposing factors for renal scarring in children with urinary tract infection. In this prospective cohort study, 176 children with documented urinary tract infection were categorized into four groups: ≤1 year old, 1-2 years old, 2-7 years and 7-14 years old. Ultrasonography and Technetium-99 m-DMSA scan were used to detect the possible abnormalities. Infants under 12 months old presented as the most common group for renal scarring (27 cases, 52.9%, and vesicoureteral reflux (VUR was diagnosed in 29 cases (56.8%. Fifteen (41.67% children between the ages of one and two years had renal scar, and VUR was detected in half of the patients. In the third group, 36.3%, and in fourth group, 41.6% of the patients had renal scar. Also, 38.6% in group three and 50% in the final group had VUR. A co-incidental finding that was observed in this study was the high incidence of pseudohypoaldesteronism (PHA in our patients: in 39.2% of the children in group one, 22.2% in group two and 4% in group three. In group four however, none of the patients had PHA. Risk of scar formation with urinary tract infection (UTI was higher in the younger age group and in those with recurrent UTIs.

  11. Comparative study of plant growth of two poplar tree species irrigated with treated wastewater, with particular reference to accumulation of heavy metals (Cd, Pb, As, and Ni).

    Houda, Zarati; Bejaoui, Zoubeir; Albouchi, Ali; Gupta, Dharmendra K; Corpas, Francisco J

    2016-02-01

    Water is a scarce natural resource around the world which can hamper the socio-economic development of many countries. The Mediterranean area, especially north Africa, is known for its semi-arid to arid climate, causing serious water supply problems. Treated wastewater (TWW) is being used as an alternative strategy for recycling wastewater. It is also a potential source of nutrients for reforestation with certain plant species such as poplar trees, a useful wood resource, and even for phytoremediation purposes. In the present study, we used treated wastewater to irrigate two clones of 1-year-old poplar trees (Populus nigra cv. I-488 and Populus alba cv. MA-104) for 90 days. After a stipulated time, a comparative study was made of the effects of TWW on growth parameters, acquisition of essential minerals (Na, Fe and Zn) and pollutants (Cd, Pb, As and Ni) as well as the enrichment of secondary metabolites such as polyphenolic, flavonoid and tannin compounds which could contribute to the growth and development of poplar plants. The results of this study show that the use of TWW increased P. alba's biomass production by 36% and also enhanced its Cd and Pb accumulation capacity. We also found that P. alba has considerable potential to be used as an alternative plant species for reforestation and/or phytoremediation of toxic metals from contaminated water or effluent. PMID:26780418

  12. The Sr-90 atom charged in the etiopathogenesis of malignant hepatomas in sucklings (reality or incompetency ?)

    The authors present a case considered as typical in which the radioactive pollution is accused by local mass media of affecting the state of population health on no objective basis. A baby, 1 year old, is hospitalized and operated of malignant hepatomas, assigning Sr-90 as the cause. After a second operation and occurrence of new cancer reactions the infant deceases. The authors undertook a thorough analysis of all the medical data and of the radioactive pollution levels of the environment. They established that cases of malignant hepatomas in infants (primary tumors), similar to that in question, do occur in Romania at a rate of 1.7 to 105 inhabitants (as compared to 4-6 to 105 inhabitants, in Eastern Europe). The level of Sr-90 in milk is 80.6 mBq/dm3 what is around the average value in the country. Other arguments are also given, all pleading for a case of cancer inscribed in the usual rate of occurrence in infants with no implication of Sr-90. The authors do appeal to an objective public information with no underestimates or overestimates of radiation hazard

  13. Investigation of regurgitation and other symptoms of gastroesophageal reflux in Indonesian infants

    Badriul Hegar; Aswitha Boediarso; Agus Firmansyah; Yvan Vandenplas

    2004-01-01

    AIM: To evaluate the incidence of regurgitation and other symptoms of gastroesophageal reflux in Indonesian infants.METHODS: In a cross-sectional study at the University Outpatient Clinic for vaccination in Jakarta, 138 mothers of healthy infants less than 12-mo old were prospectively asked to report the frequency of regurgitation.RESULTS: Whatever the age was, some infants did not regurgitate (from 10% during the first month of life to 67%in 1-year-old infants). Regurgitation of at least once a day was reported in 77% of infants younger than 3 mo. Daily regurgitation decreased to 12% in the 9-12 mo old group.Reported peak prevalence was 81%(26/32) during the first month of life. Regurgitation decreased sharply between the 4-6 and 7-9 mo old groups (from 44% to 9%). The longer the regurgitation persisted, the more frequently the mother perceived regurgitation as a problem. Volume and frequency of regurgitation, back arching, irritability, crying and refusal of feeding were the symptoms causing maternal anxiety. The longer the regurgitation persisted, the more frequently the mothers viewed it as a health problem.CONCLUSION: Regurgitation occurs frequently in Indonesian infants, and is a frequent cause of concern to mothers.

  14. Determination of essential elements in commercial infant foods by instrumental neutron activation analysis

    Vallinoto, Priscila; Maihara, Vera A., E-mail: pvallinoto@ipen.br, E-mail: vmaihara@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Eating habits are important determinants of health conditions during childhood. Commercial infant food is an important part of the diet for many babies. As such it is necessary that such food contain sufficient amounts of essential elements. Inadequate complementary feeding is a major cause of high rates of malnutrition throughout the world. Commercial infant food is classified into four different stages: Stages 1 and 2 are adequate for babies older than 6 months, but new flavors and food are introduced in stage 2; Stage 3 is offered to 8 month old babies; Junior Stage is recommended to children over 1 year old. In this study, essential elements: Ca, Cl, Co, Cr, Fe K, Mg, Mn, Na, Se and Zn were determined in commercial infant food samples by Instrumental Neutron Activation Analysis (INAA). Twenty-seven infant food samples were bought in stores around Sao Paulo city during 2011. These samples were freeze-dried and homogenized before analysis. The powdered samples were irradiated in the IEA-R1 nuclear research reactor of IPEN-CNEN/SP. For validation of the methodology, INCT MPH-2 Mixed Polish Herbs and NIST-SRM 1577b Bovine Liver reference materials were analyzed. Most of the concentration results were below the World Health Organization's recommended daily intake for infants from 6 to 12 months old. These low essential element concentration results in commercial infant foods obtained in our study indicate that infants should not only be fed with commercial baby foods. (author)

  15. The value of TORCH screening in children with bilateral profound sensorineural hearing loss

    Rabee M Al Sabellha

    2012-01-01

    Full Text Available We aimed to ascertain the effectiveness of TORCH (toxoplasma, rubella, cytomegalovirus, herpes simplex investigation in children with profound sensorineural hearing loss (SNHL. Review of TORCH laboratory results in 2011 from 168 patients who had cochlear implants between 2006 and 2010 at King Abdul-Aziz University hospital Riyadh was conducted. Of the 168 patients, 102 had TORCH laboratory results. Nine were positive for cytomegalovirus (CMV IgM antibody (8.8%, two were positive for herpes simplex virus (HSV IgM antibody (1.96%, and one was positive for rubella IgG (0.9%. No patient showed positive results for toxoplasma or syphilis. The mean age at which the request was made was 5.89 years. All 102 patients who had TORCH laboratory results were above the age of 2 years, and all the patients had bilateral profound SNHL. The nine patients who were positive for CMV were above 1 year old, and it was thus difficult to differentiate between congenital and acquired CMV infection; however, acquired CMV is unlikely to cause a neurodevelopmental disability.

  16. Imaging abusive head trauma: why use both computed tomography and magnetic resonance imaging?

    Vazquez, Elida; Delgado, Ignacio; Sanchez-Montanez, Angel [Hospital Universitario Vall d' Hebron, UAB, Pediatric Radiology Department, Barcelona (Spain); Fabrega, Anna [Hospital Universitario Vall d' Hebron, UAB, Department of Pediatrics, Barcelona (Spain); Cano, Paola [Hospital Universitario Vall d' Hebron, UAB, Pediatric Neurosurgery, Barcelona (Spain); Martin, Nieves [Hospital Universitario Vall d' Hebron, UAB, Pediatric Ophthalmology, Barcelona (Spain)

    2014-12-15

    Abusive head trauma is the leading cause of death in child abuse cases. The majority of victims are infants younger than 1 year old, with the average age between 3 and 8 months, although these injuries can be seen in children up to 5 years old. Many victims have a history of previous abuse and the diagnosis is frequently delayed. Neuroimaging is often crucial for establishing the diagnosis of abusive head trauma as it detects occult injury in 37% of cases. Several imaging patterns are considered to be particularly associated with abusive head trauma. The presence of subdural hematoma, especially in multiple locations, such as the interhemispheric region, over the convexity and in the posterior fossa, is significantly associated with abusive head trauma. Although CT is the recommended first-line imaging modality for suspected abusive head trauma, early MRI is increasingly used alongside CT because it provides a better estimation of shear injuries, hypoxic-ischemic insult and the timing of lesions. This article presents a review of the use and clinical indications of the most pertinent neuroimaging modalities for the diagnosis of abusive head trauma, emphasizing the newer and more sensitive techniques that may be useful to better characterize the nature and evolution of the injury. (orig.)

  17. Product estimate of air kerma-area and the air kerma in the input surface of the skin of pediatric patients undergoing chest X-ray; Estimativa do produto kerma ar-area e do kerma ar na superficie de entrada da pele de pacientes pediatricos submetidos a radiografia de torax

    Villa-Chan, Beatriz; Carvalho, Aline; Andrade, Marcos Ely A.; Barros, Vinicius S.M. de; Khoury, Helen J., E-mail: beatrizvillachan@gmail.com, E-mail: alinecx90@gmail.com, E-mail: marcos.ely@gmail.com, E-mail: vsmdbarros@gmail.com, E-mail: hjkhoury@gmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear

    2014-07-01

    The aim of this paper is to evaluate the entrance air kerma (Ka,e) and the product air kerma-area (Pka) for chest examinations performed with pediatric patients in a large public hospital of Recife. For this study 89 examinations of patient with ages from zero to 10 years old were evaluated. The results showed that the mean Ka,e values, for patients of 0-1 years old, 1-5 years old and 5-10 years old, were, respectively, 100 mGy, 120 mGy and 100 mGy. The Pka values for newborn patients range from 11,9 to 58,4 mGy.cm{sup 2}, for patients with 1 to 5 years old range from 17 to 192 mGy.cm{sup 2}, and from 30,4 to 136,2 mGy.cm{sup 2} for patients with ages from 5 to 10 years old. The differences in the Pka values are due the different dimensions of the radiation field. For the results its possible to conclude that the Pka values are high, in special for patients with ages from 1 to 5 years old, indicating that the collimation of the radiation field is not adequate. (author)

  18. Radial tear of posterior horn of the medial meniscus and osteonecrosis of the knee

    We studied the relation between a radial tear of the posterior horn of the medial meniscus and osteonecrosis of the knee. Thirty-eight knees of 37 patients were diagnosed as medial meniscus tear and received arthroscopic knee surgery. We divided them into two groups: knees having radial tear of the posterior horn of the medial meniscus (posterior horn group) and knees containing radial tear except for posterior horn, horizontal tear, degenerative tear, and flap tear of the medial meniscus (non-posterior horn group). The posterior horn group consisted of 14 knees (average age: 65.1 years old) and the non-posterior horn group consisted of 24 knees (average age: 59.6 years old). All cases underwent MRI before arthroscopy. MRI findings were classified into three types (typical osteonecrosis, small osteonecrosis, and non-osteonecrosis). In the posterior horn group, typical osteonecrosis were five knees and small osteonecrosis were five knees, while in the non-posterior horn group only three knees were small osteonecrosis. These findings suggest the relevance between radial tear of the posterior horn of the medial meniscus and osteonecrosis of the knee (Mann-Whitney test p<0.01). The etiology of spontaneous osteonecrosis of the knee joint is unknown, however one etiology could be the radial tear of the posterior horn of the medial meniscus. (author)

  19. Influence of solar UV radiation on the nitrogen metabolism in needles of Scots pine (Pinus sylvestris L.)

    Needles of 20-year-old Scots pine (Pinus sylvestris L.) saplings were studied in an ultraviolet (UV) exclusion field experiment (from 2000 to 2002) in northern Finland (67 deg. N). The chambers held filters that excluded both UV-B and UV-A, excluded UV-B only, transmitted all UV (control), or lacked filters (ambient). UV-B/UV-A exclusion decreased nitrate reductase (NR) activity of 1-year-old needles of Scots pines compared to the controls. The proportion of free amino acids varied in the range 1.08-1.94% of total proteins, and was significantly higher in needles of saplings grown under UV-B/UV-A exclusion compared to the controls or UV-B exclusion. NR activity correlated with air temperature, indicating a 'chamber effect'. The study showed that both UV irradiance and increasing temperature are significant modulators of nitrogen (N) metabolism in Scots pine needles. - This research presents new information on the responses of N metabolism, particularly nitrate reductase (NR) activity, of Scots pine needles to UV radiation and temperature

  20. Product estimate of air kerma-area and the air kerma in the input surface of the skin of pediatric patients undergoing chest X-ray

    The aim of this paper is to evaluate the entrance air kerma (Ka,e) and the product air kerma-area (Pka) for chest examinations performed with pediatric patients in a large public hospital of Recife. For this study 89 examinations of patient with ages from zero to 10 years old were evaluated. The results showed that the mean Ka,e values, for patients of 0-1 years old, 1-5 years old and 5-10 years old, were, respectively, 100 mGy, 120 mGy and 100 mGy. The Pka values for newborn patients range from 11,9 to 58,4 mGy.cm2, for patients with 1 to 5 years old range from 17 to 192 mGy.cm2, and from 30,4 to 136,2 mGy.cm2 for patients with ages from 5 to 10 years old. The differences in the Pka values are due the different dimensions of the radiation field. For the results its possible to conclude that the Pka values are high, in special for patients with ages from 1 to 5 years old, indicating that the collimation of the radiation field is not adequate. (author)

  1. Improved Prefrontal Activity and Chewing Performance as Function of Wearing Denture in Partially Edentulous Elderly Individuals: Functional Near-Infrared Spectroscopy Study

    Kamiya, Kazunobu; Narita, Noriyuki; Iwaki, Sunao

    2016-01-01

    The purpose of this study was to elucidate the effects of wearing a denture on prefrontal activity during chewing performance. We specifically examined that activity in 12 elderly edentulous subjects [63.1±6.1 years old (mean ± SD)] and 12 young healthy controls (22.1±2.3 years old) using functional near-infrared spectroscopy (fNIRS) in order to evaluate the quality of prefrontal functionality during chewing performance under the conditions of wearing a denture and tooth loss, and then compared the findings with those of young healthy controls. fNIRS and electromyography were used simultaneously to detect prefrontal and masticatory muscle activities during chewing, while occlusal force and masticatory score were also examined by use of a food intake questionnaire. A significant increase in prefrontal activity was observed during chewing while wearing a denture, which was accompanied by increased masticatory muscle activity, occlusal force, and masticatory score, as compared with the tooth loss condition. Prefrontal activation during chewing while wearing a denture in the elderly subjects was not much different from that in the young controls. In contrast, tooth loss in the elderly group resulted in marked prefrontal deactivation, accompanied by decreased masticatory muscle activity, occlusal force, and masticatory score, as compared with the young controls. We concluded that intrinsic prefrontal activation during chewing with a denture may prevent prefrontal depression induced by tooth loss in elderly edentulous patients. PMID:27362255

  2. Clinical and Paraclinical Findings in Shigelosis

    Afshin Dejakam

    Full Text Available Objective: Shigella infections are one of the major causes of diarrhea worldwide and especially in developing countries. This study was conducted to investigate clinical symptoms, predisposing factors and effective antibiotic regimens in children hospitalized for clinical dysentery.Material & Methods: Children older than 6 months admitted for gastroentritis in Bahrami hospital in Tehran from September 1998 to September 2001 with a positive fecal culture for Shigella were included in this study. The data was gathered from patients' records.Findings: From 173 patients, 46.2% were females mostly aged 2-5 years. More than 50% of patients were admitted in summer. The frequency of anemia was 31.8% and 34.7% were under the median growth curve. Except diarrhea, the most frequent clinical manifestations of shigellosis were fever (98.2%, dehydration (87.2% and convulsion (68.2%. 135 (78% patients received Nalidixic acid and the rest was treated with ceftriaxone as the first choice because of their poor condition on admission. Nine (5.2% patients died with Ekiri syndrome and sepsis manifestation despite antimicrobial treatment. Conclusion: The mortality rate in this study was higher than in other studies. Fifty-six percent of mortality cases was due to Ekiri syndrome and the remainder was due to sepsis in children less than 1 year old. We found no specific clinical symptom or sign for shiglosis.

  3. Imaging abusive head trauma: why use both computed tomography and magnetic resonance imaging?

    Abusive head trauma is the leading cause of death in child abuse cases. The majority of victims are infants younger than 1 year old, with the average age between 3 and 8 months, although these injuries can be seen in children up to 5 years old. Many victims have a history of previous abuse and the diagnosis is frequently delayed. Neuroimaging is often crucial for establishing the diagnosis of abusive head trauma as it detects occult injury in 37% of cases. Several imaging patterns are considered to be particularly associated with abusive head trauma. The presence of subdural hematoma, especially in multiple locations, such as the interhemispheric region, over the convexity and in the posterior fossa, is significantly associated with abusive head trauma. Although CT is the recommended first-line imaging modality for suspected abusive head trauma, early MRI is increasingly used alongside CT because it provides a better estimation of shear injuries, hypoxic-ischemic insult and the timing of lesions. This article presents a review of the use and clinical indications of the most pertinent neuroimaging modalities for the diagnosis of abusive head trauma, emphasizing the newer and more sensitive techniques that may be useful to better characterize the nature and evolution of the injury. (orig.)

  4. The Association of IFI27 Expression and Fatigue Intensification during Localized Radiation Therapy: Implication of a Para-Inflammatory Bystander Response

    Leorey N. Saligan

    2013-08-01

    Full Text Available The mechanisms behind fatigue intensification during cancer therapy remain elusive. The interferon alpha-inducible protein 27 (IFI27 was the most up-regulated gene based on our previous microarray data in fatigued men with non-metastatic prostate cancer receiving localized external beam radiation therapy (EBRT. The purpose of this study was to confirm the IFI27 up-regulation and determine its association with fatigue intensification during EBRT. Peripheral blood samples and fatigue scores were collected at three time points—prior to EBRT, at midpoint, and at completion of EBRT. Confirmatory quantitative real time polymerase chain reaction (qPCR and enzyme-linked immunosorbent assay (ELISA were utilized to verify the microarray results. Subjects were a total of 40 Caucasian men with prostate cancer; 20 scheduled for EBRT (65.6 ± 7.5 years old, and 20 on active surveillance as controls (62.8 ± 6.1 years old. Significant IFI27 expression overtime during EBRT was confirmed by qPCR (p < 0.5, which correlated with fatigue scores during EBRT (R = −0.90, p = 0.006. Alterations in mechanisms associated with immune response and mitochondrial function that explain the up-regulation of IFI27 may provide an understanding of the pathways related to the intensification of fatigue during localized radiation therapy.

  5. [Improved Response to 5-FU Using Dose Adjustment and Elastomeric Pump Selection Based on Monitoring of the 5-FU Level--A Case Report].

    Muneoka, Katsuki; Shirai, Yoshio; Kanda, Junkichi; Sasaki, Masataka; Wakai, Toshifumi; Wakabayashi, Hiroyuki

    2015-10-01

    A 6 1-year-old man with unresectable multiple hepatic metastases after resection of sigmoid colon carcinoma was treated with irinotecan and infused 5-fluorouracil (5-FU) plus Leucovorin (FOLFIRI). Since the levels of tumor markers increased, the 5-FU dose was increased from 2,700 to 3,000 mg/m2 using a Jackson-type pump and an extended infusion time of 53 hours. The blood level of 5-FU was 507 ng/mL 16 hours after starting the infusion. The pump was then changed to a bottle-type pump with the same dose of 3,000 mg/m2. At 16 hours, the 5-FU level was 964.5 ng/mL. The areas under the concentration vs. time curve (AUC mg・h/L)were 21 and 44 mg・h/L for the Jackson- and bottle-type pumps, respectively. Owing to the development of Grade 3 stomatitis and hand-foot syndrome, 5-FU was reduced to 2,700 mg/m2 with a bottle-type pump. The AUC decreased to 27 mg・h/L, but the liver metastases were reduced and the adverse effects subsided to Grade 1. This case shows that individual dose adjustment of 5-FU to the appropriate AUC based on pharmacokinetic monitoring of the blood 5-FU level can improve the response, reduce adverse effects, and have a clinical benefit. PMID:26489552

  6. Vaccine Adverse Events Reported during the First Ten Years (1998–2008 after Introduction in the State of Rondonia, Brazil

    Mônica P. L. Cunha

    2013-01-01

    Full Text Available Despite good safety records, vaccines given to young children can cause adverse events. We investigated the reported adverse events following immunization (AEFI of vaccines given to children of less than seven years of age during the first ten years (1998 to 2008 in the state of Rondonia, Brazil. We worked with the events related to BCG (Bacillus Calmett-Guérin, HB (hepatitis B, DTwP/Hib (diphtheria-tetanus-pertussis+Hemophillus influenza b, DTP (diphtheria-tetanus-pertussis, MMR (mumps, measles, rubella, and YF (yellow fever vaccines because they were part of the recommended scheme. The number of doses of vaccines given was 3,231,567 with an average of AEFI of 57.2/year during the studied period. DTwP/Hib was responsible for 298 (57.8%, DTP 114 (22.9%, HB 31 (6%, MMR 28 (5.4%, BCG 24 (4.7%, and YF 20 (3.9% of the reported AEFI. The combination of the AEFI for DTwP/Hib vaccines showed the highest number of systemic (61.4% and local events (33.8%. Young children (≤1-year old were more susceptible to AEFI occurring in the 6 hours (54.2% following vaccine uptake. This study suggests significant differences in reactogenicity of vaccines and that despite limitations of the AEFI Brazilian registry system we cannot ignore underreporting and should use the system to expand our understanding of adverse events and effects.

  7. The effect of plant growth-promoting rhizobacteria on asparagus seedlings and germinating seeds subjected to water stress under greenhouse conditions.

    Liddycoat, Scott M; Greenberg, Bruce M; Wolyn, David J

    2009-04-01

    Plant growth-promoting rhizobacteria (PGPR) can have positive effects on vigour and productivity, especially under stress conditions. In asparagus (Asparagus officinalis L.) field culture, seeds are planted in high-density nurseries, and 1-year-old crowns are transplanted to production fields. Performance can be negatively affected by water stress, transplant shock, and disease pressure on wounded roots. PGPR inoculation has the potential to alleviate some of the stresses incurred in the production system. In this study, the effects of PGPR (Pseudomonas spp.) treatment were determined on 3-week-old greenhouse-grown seedlings and germinating seeds of 2 asparagus cultivars. The pots were irrigated to a predetermined level that resulted in optimum growth or the plants were subjected to drought or flooding stress for 8 weeks. The cultivars responded differently to PGPR: single inoculations of seedlings enhanced growth of 'Guelph Millennium' under optimum conditions and 'Jersey Giant' seedlings under drought stress. Seed inoculations with PGPR resulted in a positive response only for 'Guelph Millennium', for which both single or multiple inoculations enhanced plant growth under drought stress. PMID:19396238

  8. Risk factors in pediatric asthmatic patients. Cases and control studies.

    Rafael Alejandro Gómez Baute

    2003-04-01

    Full Text Available Background: Asthma constitutes the first disease among chronic diseases in children. The morbid-mortality promoted to continue being elevated in spite of the new therapies. For this reason it is a disease with high priority for investigation in pediatric ages. Method: A control and case group study was carried out. The samples was composed by 72 asthmatic children from three General Comprehensive doctor offices from Palmira health area located in Cienfuegos Province, Cuba; and a control group of 72 children apparently healthy from the same population. A questionnaire with the different risk variables was elaborated. Odds ratio technique was used to estimate the risk. Results: low weight at birth, family history of asthma, brochiolitis antecedent and the excessive usage of antibiotics in children under 1 year old were the main risks found. Conclusions: It is conclusive that the exposure to home allergen plus a genetic favorable factor, the prematurity, and brochiolitis constituted the most outstanding elements to suffer from asthma in the population studied.

  9. The Acute Effects of Upper Extremity Stretching on Throwing Velocity in Baseball Throwers

    Michael Williams

    2013-01-01

    Full Text Available Purpose. To examine the effects of static and proprioceptive neuromuscular facilitation (PNF stretching of the shoulder internal rotators on throwing velocity. Subjects. 27 male throwers (mean age = 25.1 years old, SD = 2.4 with adequate knowledge of demonstrable throwing mechanics. Study Design. Randomized crossover trial with repeated measures. Methods. Subjects warmed up, threw 10 pitches at their maximum velocity, were randomly assigned to 1 of 3 stretching protocols (static, PNF, or no stretch, and then repeated their 10 pitches. Velocities were recorded after each pitch and average and peak velocities were recorded after each session. Results. Data were analyzed using a repeated measures ANOVA. No significant interaction between stretching and throwing velocity was observed. Main effects for time were not statistically significant. Main effects for the stretching groups were statistically significant. Discussion. Results suggest that stretching of the shoulder internal rotators did not significantly affect throwing velocity immediately after stretching. This may be due to the complexity of the throwing task. Conclusions. Stretching may be included in a thrower's warm-up without any effects on throwing velocity. Further research should be performed using a population with more throwing experience and skill.

  10. PALMILHAS PROPRIOCEPTIVAS PARA O CONTROLE POSTURAL

    Alessandra Madia Mantovani

    2010-12-01

    Full Text Available The postural control and balance depend of the sensory system and musculoskeletal biomechanics being the feet one of the main sensors of the sensory system. The aim were to evaluate postural control and plantar pressures before, during and after the use of proprioceptive insoles. Participated 15 subjects, age 19,62,1 years old, and body mass índex (BMI of 24,45,4 kg/m2. Postural assessment values have been measured the arrows on the spine curvature, followed by analysis of plantar pressures and measures for pedobarometricstabilometric for measuring of displacement of center of pressure before, during andafter the use of insoles. In the results we saw normal arrows post insole plantar pressureand stabilometry not statistically significant after its use. Conclued that after using these insole, was saw an adequate postural realignment, probably due to adequate muscle and posture tonedemonstrating the importance of assessing the captor podal for understanding postural disordens.

  11. The Effect of Exhausting Exercise Induced Muscular Fatigue On Functional Stability

    K. Letafatkar

    2009-01-01

    Full Text Available Problem statement: To quantify the effect of exhausting exercise induced muscular fatigue on functional stability. Approach: About 30 male professional athletes with mean age 23±2.1 years old, mean weight 82±1.3 kg and mean height1 81±9.7 cm were selected for participation in this study. In this study Unstable Biodex platform (level 3 used for stability evaluation. Balance performance was quantified as a stability index and the mean deflection of the platform. Running Based Anaerobic Test (RAST test used for fatigue execution. Results: Results showed no significant (p>0.05 main effect for exercise duration in the stability index, suggesting that balance performance was maintained throughout the competition. Hence there wasn’t a significant relationship between lactate acid accumulation and variations of stability indices (r = -0/661, pConclusion: Therefore, the improvement of proprioception in the ankle and knee joint is recommended as a prevention role to the injuries in the abovementioned joints.

  12. Effects of the ultraviolet-B radiation (UV-B) on conifers: a review

    The current knowledge on conifer responses to enhanced ultraviolet-B (UV-B) radiation is mainly based on greenhouse or growth chamber experiments of one growing season in duration. However, the biomass losses observed in greenhouses do not occur in field-grown trees in their natural habitats. Moreover, the majority of the 20 conifer species studied have been 1-year-old seedlings, and no studies have been undertaken on mature trees. Fully grown needles, with their glaucous waxy surfaces and thick epidermal cells with both soluble and wall-bound UV-B screening metabolites, are well protected against UV-B radiation. However, it is not known whether these are sufficient protectants in young emerging needles or during the early spring period of high UV-B levels reflected from snow. In order to understand all the mechanisms that result in the protection of conifer needles against UV-B radiation, future research should focus on the epidermal layer, separating the waxes, cuticle and epidermal and hypodermal cells. Parallel studies should consist of wall-bound and soluble secondary metabolite analysis, antioxidant measurements and microscopic observations. (author)

  13. Japanese macaque (Macaca fuscata) mothers huddle with their young offspring instead of adult females for thermoregulation.

    Ueno, Masataka; Nakamichi, Masayuki

    2016-08-01

    It is unclear whom animals select to huddle with for thermoregulation. In this study, we investigated whom Japanese macaque (Macaca fuscata) mothers huddled with-their young offspring or other adult group members-when there is need for thermoregulation. We used a focal-animal sampling method, targeting 17 females at Katsuyama, Okayama Prefecture, Japan. A majority of huddling among adult females was recorded during winter season (December, January, and February). Females who had young (0- or 1-year-old) offspring huddled less frequently with other adult females compared to females who did not have young offspring in winter. However, including young offspring, the frequency of huddling with any other individuals did not differ by whether females had young offspring. Moreover, the females who did not have young offspring huddled with other adult females more often in cloudy than in sunny weather during winter season. In contrast, females who had young offspring increased huddling with their young offspring in cloudy than in sunny weather, but did not do so with other adult females. This study indicates that Japanese macaque mothers huddle with their young offspring instead of other adult females when there is need for thermoregulation. PMID:27262980

  14. Progress in estimation of dose due to the Fukushima Daiichi Nuclear Power Plant accident

    The magnitude of dose due to the Fukushima Daiichi Nuclear Power Plant accident was revealed by the UNSCEAR 2013 report published in April 2014. In the report, effective doses and thyroid doses were estimated for 1-year-old infants and 10-year-old children as well as adults. The UNSCEAR Committee formally agreed to rely principally on data available and literature published before the end of September 2012. However, studies on dose estimation have been conducted after that. Then, recent papers and activities of 'Fukushima Health Management Survey' are presented. In relation to this, the effective dose estimated by the UNSCEAR report was compared with the estimation by another method (extrapolation from the result of Fukushima Health Management Survey with data on individual dose measurement using personal dosimeters). As a result, they were generally consistent each other. The UNSCEAR report states, it is likely that some overestimation has been introduced generally by the methodology used by the Committee. In the case of internal dose, direct measurements of the radioactive content of the thyroid indicated doses being lower than those estimated by the Committee, by a factor of about 3 to 5. Thus, studies on reconstructing a more realistic dose for residents are still needed. (author)

  15. PINE NEEDLES (PINUS SYLVESTRIS L. AS BIOINDICATORS IN THE ASSESSMENT OF URBAN ENVIRONMENTAL CONTAMINATION WITH HEAVY METALS

    Agnieszka Parzych

    2014-07-01

    Full Text Available The studies on Zn, Pb and Mn content in the needles of Pinus silvestris and the surface layers of soil (0.0–0.2 m and 0.4–0.6 m were conducted in 2010. The research stations covered residential areas, municipal parks, neighborhoods of busy streets, industrial establishments, waste dump sites and sewage treatment plants. The tests showed variability of the analyzed elements in the needles of P.silvestris and in municipal soils, depending on concentration of urban and industrial activity, road traffic and the depth of the examined layer of soil. The content of heavy metals in soil varied. Zn was characterized by the highest variability, depending on the depth (50.3–52.4%, Mn slightly lower (38.5–42.2%, and Pb, the lowest (29.1–33.2%. It was evidenced that the values of the heavy metals enrichment factors of the needles are closely connected with concentration of the examined metals in the soil. Along with the rise of Zn, Mn and Pb content in the soil, the values of enrichment factors decreased. The strongest negative correlations were found in the case of Zn, both in 1-year old needles (r = -0.82, p<0.05, as well as in 2-years’ old ones (r = -0.83, p<0.05, slightly weaker in the cases of lead and manganese.

  16. Identification of the secondary follicle cycle of Hexi cashmere goat.

    He, Yanyu; Cheng, Lixiang; Wang, Jiqing; Liu, Xiu; Luo, Yuzhu

    2012-09-01

    This experiment conducted to identify a periodic change of ultrastructures of secondary follicle characteristics during a whole year, reveal the molecule regulation of growth of cashmere. A total of 10 cashmere goats of 1-year old were studied. The paraffin section and ultrathin slices of skin were made each month in a whole year, observed, photographed, and analyzed under light microscope and transmission electron microscope after stained. Following the development of down fiber, the ultrastructures of secondary follicle of Hexi cashmere goat showed a periodic change within a year. There were five different periods during a down fiber cycle. It was observed that the stage of telogen, proanagen, anagen, procatagen, and catagen was in January and February, March and April, May to August, September and October, and November and December, respectively. The key change observed in secondary follicle under transmission electron microscope was inner root sheath. This study illustrated the five different stage of secondary follicle of Hexi Cashmere goat within a whole growth cycle, and has provided more detailed information about the research field of Hexi cashmere goat. Choosing the suitable time to harvest the cashmere may get the profit maximization. PMID:22753049

  17. Radiation doses from coal-fired plants in Oxfordshire and Berkshire

    This report contains an assessment of the radiation doses to members of the public living in Oxfordshire and Berkshire from the releases to atmosphere of natural radioactivity from Didcot Power Station and the coal-fired boilers that operate at the Atomic Weapons Establishment (AWE) at Aldermaston and the Harwell Laboratory of UKAEA. The calculated annual effective dose equivalents to adults from the emissions from Didcot Power Station and the coal-fired plants at AWE, Aldermaston, and UKAEA, Harwell, at 5 km from the sites are, respectively, 0.3, 0.06 and 0.01 μSv. The dose to red bone marrow are broadly comparable with these values. The doses to the other age groups considered (1-year-old and 10-year-old children) are similar to those to the adults. The conclusion is therefore drawn that the discharges from the coal-fired plants make a negligible contribution to the total radiation doses received by the population living around the sites. (author)

  18. Iatrogenic surgical microscope skin burns: A systematic review of the literature and case report.

    Lopez, Joseph; Soni, Ashwin; Calva, Daniel; Susarla, Srinivas M; Jallo, George I; Redett, Richard

    2016-06-01

    Cutaneous burns associated with microscope-use are perceived to be uncommon adverse events in microsurgery. Currently, it is unknown what factors are associated with these iatrogenic events. In this report, we describe the case of a 1-year-old patient who suffered a full thickness skin burn from a surgical microscope after a L4-S1 laminectomy. Additionally, we present a systematic review of the literature that assessed the preoperative risk, outcome, and management of iatrogenic microscope skin burns. Lastly, a summary of the Food and Drug Administration's (FDA) Manufacturer and User Facility Device Experience (MAUDE) database of voluntary adverse events was reviewed and analyzed for clinical cases of microscope thermal injuries. The systematic literature review identified only seven articles related to microsurgery-related cutaneous burns. From these seven studies, 15 clinical cases of iatrogenic skin burns were extracted for analysis. The systematic review of the FDA MAUDE database revealed only 60 cases of cutaneous burns associated with surgical microscopes since 2004. Few cases of microscope burns have been described in the literature; this report is, to our knowledge, one of the first comprehensive reports of this iatrogenic event in the literature. PMID:26777456

  19. Noninvasive measurements of cerebral blood flow using 99mTc-ECD SPECT in elderly depressed patients

    The purpose of this study was to see whether the SPECT can clearly detect the minor abnormality that MRI could barely detect. Subjects were elderly depressed patients (73.6 years old in average, 1 male and 10 females) with a mean 18.9 score of Hamilton ranging scale for depression and normal people (72.1 years old, 5 males and 5 females) having given the informed consent. Patients' MRI hardly gave findings for cerebral atrophy and latent cerebral infarction. Rapidly after intravenous administration of 99mTc-ECD (370 MBq), the flow of the tracer from the aortic arches to the brain was recorded every second with a gamma-camera to calculate the brain perfusion index (BPI) by Patlak plotting. Mean cerebral blood flow (mCBF) was calculated from BPI and cerebral blood flow measured by 133Xe inhalation SPECT. Regional cerebral blood flow (rCBF) was also computed. The apparatus was Siemens Mutti SPECT3 which had 3 detectors. mCBF of the patients (34.9 ml/100 g/min) was found significantly lower than the control (42.1 ml/100 g/min). rCBFs in the frontal lobe, temporal lobe, parietal lobe, thalamus, tegmentum, caudate nucleus and hippocampus were also lowered in the patients. Lowered blood flows in the left hemisphere were observed. These findings were considered to suggest the functional abnormality of the brain or the impaired blood flow possibly leading to infarction. (K.H.)

  20. Influence of the science intervention for early childhood development on infants' growth and development%儿童早期发展科学干预对婴幼儿生长发育的影响

    高明英; 段娅莉; 徐兵; 张程华; 孙恩; 胡雯

    2011-01-01

    目的:研究儿童早期发展的科学干预活动对婴幼儿生长发育的影响效果.方法:用随机抽样原则分实验组对照组.两组儿童均自出生后接受儿童保健系统管理中常规生长发育监测和精神发育评估指导;同时,实验组儿童还自胎儿5个月开始,实施该院自行设计、符合婴幼儿早期发展特点和发育规律的科学训练方案至婴儿期.两组儿童均在1岁和3岁时采用盖瑟尔(Gesell)婴幼儿发育量表测试其神经心理发育水平.结果:体格发育指标在1岁和3岁时两组儿童中差异均无统计意义.但发育年龄(DA)及发育商(DQ)在1岁时,实验组均高于对照组,差异均有统计学意义(P<0.05);在3岁时实组发育年龄(DA)和发育商(DQ)均高于对照组,其中言语能区和应人能区2个能区差异具有统计学意义(P<0.05).结论:儿童早期发展的科学干预活动可促进婴幼儿的智能发育,并可产生深远的长期持续影响.%Objective: To explore the effect of the science intervention for early childhood development on growth and development of 0 ~ 3 years old infant. Methods: Comparing with the Gontrol group, the experimental group was trained by their trained parents every day using" The Early Childhood Development Intervention Plan" designed by the hospital from the embryo to 1 year old. Regularly two groups were evaluated physical and mental development indicators. All children were assessed by Gesell scales of development at 1 and 3 year -old. Results: In 1 and 3 year -old children, there were no differences on items of physical development between the two groups. The development age (DA) and development quotient (DQ) of the experiment group were higher than the control group; there was a significant difference between the two groups of all ability in 1 year - old and part ability in 3 year - old ( P < 0. 05 ) . Conclusion: Early childhood development intervention can promote the growth of infant's intelligence, and

  1. 红原县0~3岁儿童营养状况调查%Investigation on nutritional status of children aged 0-3 years in Hongyuan County

    李艳; 李小玉

    2015-01-01

    目的:了解红原县0~3岁儿童营养状况。方法在红原县各乡镇按比例随机抽样288例,准确测量儿童身高、体重,用2006年WHO儿童生长标准为参考标准,判断儿童营养不良状况并分度,然后统计分析各种程度营养不良比例。结果中重度体重低下、生长迟缓、消瘦的比例分别为15.3%、17.36%和6.25%;其中小于1岁婴儿体重低下者占22.67%,生长迟缓占20.00%;小于1岁婴儿体重低下比例明显高于大于1岁组,两组比较有显著差异(P<0.05),生长迟缓及消瘦情况比较无显著差异,不同性别间不同程度营养不良比例比较均无显著差异。结论红原县0~3岁儿童,尤其是1岁以内儿童,其营养不良患病率明显高于其他地区,应加快民族偏远地区医疗卫生事业发展,提高教育水平,加强对家长科学喂养知识的教育。%Objective To evaluate the nutritional status of children aged from 0 to 3 years old in Hongyuan county. Methods Randomly selected 288 cases according to the proportion. In all villages and towns in Hongyuan County. All the children were accurate measurements of height, weight. WHO child growth standards In the 2006 were designated as the reference standard, and through these standards to judge the child malnutrition and divided degree. Then the proportion of different degree of malnutrition were calculated, and statistical analysis was performed. Results The pro-portion of moderate to severe under weigth, stunting, wasting was respectively 15.3%, 17.36% and 6.25%. The under weigth and stunting accounted for 22.67% and 20.00% in the infants less than 1 year of age, the low weight ratio was significantly higher than that of more than 1 years old children, there was significant difference between two groups (P<0.05). Underweight and stunting had no difference in two groups,there was no significant differences between different gender. Conclusion Hongyuan County 0 to 3 years

  2. Effect of age on click-evoked otoacoustic emission A systematic review

    Jinfeng Liu; Ningyu Wang

    2012-01-01

    OBJECTIVE: The aims of this study were to investigate the changes of the total intensity of transient evoked otoacoustic emission (TEOAE) and signal-to-noise ratio in various frequency bands as a function of aging, and to explore the role of age-related decline of cochlear outer hair cells.DATA SELECTION: Inclusion criteria: (1) Articles should involve the total TEOAE level or sig-nal-to-noise ratio. (2) The measurement and analysis system used was Otodynamics ILO analysis system (ILO88, ILO92, ILO96 or ILO292). (3) Studies involved groups of greater than 10 subjects and TEOAE results were from normally hearing ears. (4) If more papers from the same author or laboratory analyzed the same subjects, only one was used. MAIN OUTCOME MEASURES: The correlations of the age scale with the total level and sig-nal-to-noise ratio of TEOAE was determined, respectively.RESULTS: (1) TEOAE total level gradually increased until 2 months of age, and then decreased with increasing age. Significant negative correlations between total TEOAE level and age were found (r = -0.885, P = 0.000). (2) The most rapid decrease of TEOAE amplitude occurred at 1 year old. The total TEOAE level decreased about 4.25 dB SPL between 2 months to 1 year old, then about 0.26-0.52 dB SPL from 1 year to 10 years old, about 0.23 dB SPL from 11 years to 25 years old, and about 0.14 dB SPL from 26 years to 60 years old. (3) The signal-to-noise ratio in the fre-quency bands centered at 1.5, 2, 3 and 4 kHz decreased with increasing age after 2 months of age. Significant negative correlations between the signal-to-noise ratio and age were found for frequency bands ranging from 1.5 kHz to 4 kHz, with the highest correlations at 4 kHz (r = -0.890, P < 0.01), then at 3 kHz (r = -0.889, P < 0.01), at 2 kHz (r = -0.850, P < 0.01) and at 1.5 kHz (r = -0.705, P < 0.05). Conversely, a positive correlation between the signal-to-noise ratio centered at 1 kHz and age was found, but was not statistically significant (r = 0

  3. Avaliação prognóstica da doença coronária estável através de um novo escore Evaluación pronóstica de la enfermedad coronaria estable a través de un nuevo score New prognostic score for stable coronary disease evaluation

    Fernanda Coutinho Storti

    2011-05-01

    Full Text Available FUNDAMENTO: A necessidade de melhorar a acurácia do teste de esforço, determinou o desenvolvimento de escores, cuja aplicabilidade já foi amplamente reconhecida. OBJETIVO: Avaliação prognóstica do coronariopata estável através de um novo escore simplificado. MÉTODOS: Um novo escore foi aplicado em 372 coronariopatas multiarteriais e função ventricular preservada, 71,8% homens, idade média 59,5 (± 9,07 anos, randomizados para angioplastia, revascularização cirúrgica e tratamento clínico, acompanhados por 5 anos. Óbito cardiovascular foi o desfecho primário. Infarto do miocárdio não-fatal, óbito e re-intervenção formaram o desfecho combinado secundário. O escore baseou-se numa equação previamente validada resultante da soma de 1 ponto para: sexo masculino, história de infarto, angina, diabete, uso de insulina e ainda 1 ponto para cada década de vida a partir dos 40 anos. Teste positivo adicionou 1 ponto. RESULTADOS: Ocorreram 36 óbitos (10 no grupo angioplastia, 15 no grupo revascularização e 11 no grupo clínico, p = 0,61. Observou-se 93 eventos combinados: 37 no grupo angioplastia, 23 no grupo revascularização e 33 no grupo clínico (p = 0,058. 247 pacientes apresentaram escore clínico > 5 pontos e 216 > 6 pontos. O valor de corte > 5 ou > 6 pontos identificou maior risco, com p = 0,015 e p = 0,012, respectivamente. A curva de sobrevida mostrou uma incidência de óbito após a randomização diferente naqueles com escore > 6 pontos (p = 0,07, e uma incidência de eventos combinados diferente entre pacientes com escore 6 pontos (p = 0,02. CONCLUSÃO: O novo escore demonstrou consistência na avaliação prognóstica do coronariopata estável multiarterial.FUNDAMENTO: La necesidad de mejorar la exactitud de las pruebas de estrés, determinó el desarrollo de los puntajes, cuya aplicación fue ampliamente reconocida. OBJETIVO: La evaluación pronóstica del coronariópata estable a través de un nuevo score

  4. High prevalence of clinically unsuspected dengue disease among children in Ribeirao Preto city, Brazil.

    Poloni, Telma Regina; Dornas, Fabio Pio; Dos Santos, Nilton Nascimento; Soares, Adriana Moreira; Amarilla, Alberto Anastacio; Alfonso, Helda Liz; Trigueiro, Sabrina; Lavrador, Marco Aurélio Sicchiroli; Yamamoto, Aparecida Yulie; Aquino, Victor Hugo

    2016-10-01

    The aim of this study was to analyze the characteristics of Dengue virus (DENV)-infected children and the accuracy of dengue diagnosis based on clinical presentations. The inclusion criteria were children ≥1-year-old presenting febrile illness with 1-7 days of onset. Children (n = 110) aged 2-15 years were included in this study. DENV infection was confirmed with virological tests using serum, salvia, and/or urine samples. The attending pediatricians classified 56/110 (50.91%) of the children as suspected dengue cases. The DENV infection was confirmed by specific laboratory tests in 52/56 (92.9%) of the suspected dengue cases but also in 44/54 (81.5%) of the unsuspected dengue cases; total of 96/110 (87.27%) confirmed dengue cases. The clinical diagnosis gave an overall sensitivity of 54.2% (52/96) and a specificity of 71.4% (10/14). The positive predictive value of the clinical diagnosis was 92.8% and negative predictive value was 18.5%. After the third day of onset of symptoms, the DENV genome detection rate was similar in serum and saliva samples, suggesting that saliva samples represent an alternative to blood samples for early dengue diagnosis. Vaccination against Yellow fever virus did not influence the antibody response against DENV-1, DENV-2, and DENV-3, which circulated during the study period. Although the signs and symptoms were compatible with dengue, the attending pediatricians did not suspect the disease in several children. Therefore, the inclusion of virological tests for early diagnosis in the protocols for dengue surveillance would help in the implementation of prompt treatment of patients and epidemic containment strategies. J. Med. Virol. 88:1711-1719, 2016. © 2016 Wiley Periodicals, Inc. PMID:27004990

  5. Elevated Urinary Levels of 8-Hydroxy-2'-deoxyguanosine in a Japanese Child of Xeroderma Pigmentosum/Cockayne Syndrome Complex with Infantile Onset of Nephrotic Syndrome.

    Kondo, Daiki; Noguchi, Atsuko; Tamura, Hiroaki; Tsuchida, Satoko; Takahashi, Ikuko; Kubota, Hiroki; Yano, Tamami; Oyama, Chikako; Sawaishi, Yukio; Moriwaki, Shinichi; Takahashi, Tsutomu

    2016-01-01

    Nucleotide excision repair (NER) is an essential biological pathway protecting against ultraviolet light-induced DNA damage. Deficient NER causes a group of rare genetic disorders including two autosomal recessive diseases, xeroderma pigmentosum (XP) and Cockayne syndrome (CS). In addition to the cutaneous photosensitivity shared in XP and CS, CS is featured by growth failure, neurological deterioration, microcephaly, and deep sunken eyes. XP/CS complex is an extremely rare type of NER disorder with a distinct phenotype that is characterized by the skin and eye pathology of XP and the somatic and neurological abnormalities of CS. Some of CS cases have been reported to be complicated with renal failure, but the genetic background or the etiology of the renal failure has not been reported. We herein report a 1-year-old Japanese boy with XP/CS complex, complicated by nephrotic syndrome. Diagnosis was confirmed by the presence of compound heterozygous mutations, G47R (c.139G>A) and R616G (c.1846C>G), in the excision repair cross-complementation group 2 (ERCC2) gene. The kidney biopsies, performed at the age of 1 year and 2 months, revealed diffuse expansion of the mesangial matrix and segmental glomerulosclerosis under light microscopy, and diffused thin capillary walls with partially lamellated regions under electron microscopy. Notably, high levels of urinary 8-hydroxy-2'-deoxyguanosin, known as an oxidative stress marker, were observed during the clinical course. The patient died at the age of 1 year and 11 months because of renal failure. We suggest the involvement of oxidative stress in the pathogenesis of nephrotic syndrome in NER disorders. PMID:27396511

  6. Fibrodysplasia ossificans progressiva: initial presentation with a preosseous lesion of the scalp and its MRI appearance.

    Lin, Fu-Yu; Lin, Chien-Hung; Shu, Ginger; Chen, Clement Kuen-Huang

    2016-07-01

    This case subject is a 1-year-old girl presenting with recurrent diffuse soft-tissue swelling of the scalp and periorbital region. Her family denied any known history of trauma. There was no obvious discoloration or local heat at the lesion. Magnetic resonance imaging (MRI) revealed diffuse soft tissue swelling of the scalp manifesting as high signal intensity on T2-weighted images and low signal intensity on T1-weighted images with diffuse enhancement after gadolinium-contrast administration. Biopsy yielded inconclusive pathological results. Fibrodysplasia ossificans progressiva (FOP) was not suspected until malformation of the patient's toes was noticed. The scalp lesion underwent spontaneous regression, and subsequent radiographs of the chest and cervical spine revealed heterotopic ossifications of the neck and thorax. Early diagnosis of FOP is vital because trauma, unnecessary biopsy and intramuscular injection are known to cause acceleration of heterotopic ossifications. Previous studies reported diffuse soft tissue swelling at the posterior neck, thoracic wall or paraspinal region as preosseous lesions of FOP (Shiva Kumar et al. Neurology. 2010;74(6):e20, Merchant et al. Pediatr Radiol. 2006;36(10):1108-11, Hagiwara et al. AJR Am J Roentgenol. 2003;181(4):1145-7). To our knowledge, diffuse soft tissue swelling of the scalp as a preosseous lesion of FOP and associated MRI findings have not yet been reported. We believe that awareness of preosseous lesions presenting as diffuse soft tissue swelling, in addition to shortening and valgus deformity of the great toes, is an important diagnostic clue for establishing FOP. PMID:27003387

  7. Nanomechanical phenotype of chondroadherin-null murine articular cartilage.

    Batista, Michael A; Nia, Hadi T; Önnerfjord, Patrik; Cox, Karen A; Ortiz, Christine; Grodzinsky, Alan J; Heinegård, Dick; Han, Lin

    2014-09-01

    Chondroadherin (CHAD), a class IV small leucine rich proteoglycan/protein (SLRP), was hypothesized to play important roles in regulating chondrocyte signaling and cartilage homeostasis. However, its roles in cartilage development and function are not well understood, and no major osteoarthritis-like phenotype was found in the murine model with CHAD genetically deleted (CHAD(-/-)). In this study, we used atomic force microscopy (AFM)-based nanoindentation to quantify the effects of CHAD deletion on changes in the biomechanical function of murine cartilage. In comparison to wild-type (WT) mice, CHAD-deletion resulted in a significant ≈70-80% reduction in the indentation modulus, Eind, of the superficial zone knee cartilage of 11 weeks, 4 months and 1 year old animals. This mechanical phenotype correlates well with observed increases in the heterogeneity collagen fibril diameters in the surface zone. The results suggest that CHAD mainly plays a major role in regulating the formation of the collagen fibrillar network during the early skeletal development. In contrast, CHAD-deletion had no appreciable effects on the indentation mechanics of middle/deep zone cartilage, likely due to the dominating role of aggrecan in the middle/deep zone. The presence of significant rate dependence of the indentation stiffness in both WT and CHAD(-/-) knee cartilage suggested the importance of both fluid flow induced poroelasticity and intrinsic viscoelasticity in murine cartilage biomechanical properties. Furthermore, the marked differences in the nanomechanical behavior of WT versus CHAD(-/-) cartilage contrasted sharply with the relative absence of overt differences in histological appearance. These observations highlight the sensitivity of nanomechanical tools in evaluating structural and mechanical phenotypes in transgenic mice. PMID:24892719

  8. National estimates of emergency department visits for pediatric severe sepsis in the United States

    Sara Singhal

    2013-05-01

    Full Text Available Objective. We sought to determine the characteristics of children presenting to United States (US Emergency Departments (ED with severe sepsis. Study design. Cross-sectional analysis using data from the National Hospital Ambulatory Medical Care Survey (NHAMCS. Using triage vital signs and ED diagnoses (defined by the International Classification of Diseases, Ninth Revision codes, we identified children <18 years old presenting with both infection (triage fever or ICD-9 infection and organ dysfunction (triage hypotension or ICD-9 organ dysfunction. Results. Of 28.2 million pediatric patients presenting to US EDs each year, severe sepsis was present in 95,055 (0.34%; 95% CI: 0.29–0.39%. Fever and respiratory infection were the most common indicators of an infection. Hypotension and respiratory failure were the most common indicators of organ dysfunction. Most severe sepsis occurred in children ages 31 days–1 year old (32.1%. Most visits for pediatric severe sepsis occurred during winter months (37.4%, and only 11.1% of patients arrived at the ED by ambulance. Over half of severe sepsis cases were self-pay or insured by Medicaid. A large portion (44.1% of pediatric severe sepsis ED visits occurred in the South census region. ED length of stay was over 3 h, and 16.5% were admitted to the hospital. Conclusion. Nearly 100,000 children annually present to US EDs with severe sepsis. The findings of this study highlight the unique characteristics of children treated in the ED for severe sepsis.

  9. Seroprevalence of Ehrlichia canis in dogs referred to Veterinary Hospital of Shahid Chamran University of Ahvaz, Iran

    Avizeh, R.

    2010-01-01

    Full Text Available Canine ehrlichiosis is a zoonotic rickettsial disease transmitted by ticks. In the present study, 198 companion dogs of different ages were examined for serum antibody detection against Ehrlichia canis by means of immunochromatography assay. The dogs were selected among referred cases to Veterinary Hospital of Shahid Chamran University of Ahvaz, Southwestern Iran from November 2008 to March 2010. The studied dogs were classified based on age, sex, breed, region and season. Nineteen of 198 serum samples (9.6% had antibody against E. canis. Prevalence was significantly higher in adult dogs more than 3 year-old (16.18% (P= 0.002 and 1 – 3 years (11.86% (P= 0.016 compared with young dogs less than 1 year-old (1.41%. Prevalence was higher in male dogs (10.62% than female dogs (8.24%, in the summer (11.32% and west region (11.11%. There were not significant differences between the prevalence of infection and host gender, season and region (P>0.05. Typical morulae of E. canis were observed in monocytes of four infected dogs (2.02%. Five out of 24 (20.83% of the thrombocytopenic dogs and 14 out of 174 (8.05% of the non-thrombocytopenic dogs were positive for ehrlichiosis. Of 19 seropositive dogs, six (31.58% had anemia, four (21.05% hypoalbuminemia and five (26.32% leukopenia. There were not statistically significant differences between hematological findings and prevalence of infection (P> 0.05. This is the first report indicating the presence of E. canis in companion dogs of Ahvaz district. However, the sources of infection in these dogs were not clear. Finally, the role of companion dogs in the epizootiology of E. canis infection needs to be further explored.

  10. Tritrichomonas foetus infection in cats with diarrhea from densely housed origins.

    Arranz-Solís, David; Pedraza-Díaz, Susana; Miró, Guadalupe; Rojo-Montejo, Silvia; Hernández, Leticia; Ortega-Mora, Luis Miguel; Collantes-Fernández, Esther

    2016-05-15

    Tritrichomonas foetus is a protozoan parasite that has been recently identified as a causative agent of chronic diarrhea in domestic cats. Transmission of infection occurs by the fecal-oral route through direct contact among animals. Consequently, feline trichomonosis (FT) is more likely to be present in multi-cat environments. The objective of this work was to study the presence of T. foetus and some associated risk factors in cats from densely housed origins and with a reported history of chronic diarrhea. Animals enrolled in this study were family cats (n=15) acquired from pet shops, shelters or breeding centers and cattery cats belonging to one breeding center (n=28) and two cat shelters (A and B, n=25 each). In the catteries, a follow-up analysis for a period of up to 2 months was also performed to determine the parasite shedding pattern in feces and the incidence of infection. Fecal samples were analyzed using in vitro culture and a PCR technique. T. foetus was detected in a total of 38.7% (36/93) of the cats with chronic diarrhea. Parasite infection was similarly detected in family cats and cattery animals (40% versus 38.4%). In the catteries, the parasite was detected in 50%, 44% and 20% of the animals from the breeding center and shelters A and B, respectively. The follow-up analysis showed that 58.3% of infected cats intermittently shed trophozoites in their feces, with an incidence of 23.1%. Investigation of potential risk factors showed that cats ≤1 year old were more likely to be infected than older cats (57.1% versus 27.3%; Pcats and highlight the relevance of close contact conditions for T. foetus transmission. PMID:27084482

  11. Children's exposure to ionizing radiations linked with diagnostic procedures in 2010 in France

    The objective of this study was to characterize the medical exposure of the French pediatric population to ionizing radiations (IR) in 2010. It only includes diagnostic procedures. Data are mainly provided by the French Health Insurance (CNAM-TS), through a representative sample of about 1% of the French population (the so-called 'EGB' sample). In 2010, more than 100,000 children from 0 to 15 years old were included in this sample. About 600 examinations per 1000 children were performed: 55% are radiological examinations and 42% dental. CT examinations are rather rare (about 2%). Nuclear medicine and interventional radiology represent less than 1% of the examinations. Children from 10 to 15 years old and babies from new born to 1 year old are the most examined. Exposure of girls and boys are rather similar. From 10 to 15 years old, dental and limbs examinations are the most frequent. Chest and pelvic examinations are the most frequent examinations performed on babies. CT pediatric examinations concern mainly the head and the neck. In 2010, a third of the French children has been exposed to at least one examination using IR. The mean and median effective doses were respectively equal to 0.65 mSv and 0.025 mSv. These values were respectively 5.7 mSv and 1.7 mSv for the children exposed to at least one CT examination (about 1% of the studied population). This study brings reference data on pediatric exposure to IR, and makes them available for public health and epidemiological purposes. This analysis should be periodically carried out to assess the evolution of the pediatric exposure. (authors)

  12. Cephalometric Standards of Pre-University Boys with Normal Occlusion in Hamadan

    N. Farhadian

    2005-04-01

    Full Text Available The important base of orthodontic treatment is correct diagnosis . One of the diagnostic tools is lateral cephalogram. There are some differences in normal standards between different races. The present study was carried out with the aim of determining and assessing the cephalometric standards of boys with the age of 17 to 20 years old in Hamadan.Among 1204 boys of preuniversity centers , 27 persons were selected based on IOTN and normal occlusal standards. Lateral cephalograms were obtained in Natural Head Position. 22 cephalometric variables (15 angles , 5 lines , 2 ratios were determined and measured three times by an orthodontist . Student t - test used for analysis.Mean age of the cases were 18.2±1.4 years. Range of reliability coefficient was between 0.901 to 0.986. In comparison with similar studies following variables were statistically different at p<0.05 level: Articular Angle= 146 ,Gonial Angle =118 , NPog-TH =89 , AB-TH = 4.6 , L1 –TH =116 , Go Gn –TH =20 , Ant. Cranial Base =76mm.The length of anterior cranial base in our study was significantly less than Michigan standards and there was a tendency to more straight profile in this evaluation . In comparison with the Cooke standards there was less protrusion in mandibular incisors and more counter-clockwise rotation of mandible. In comparison with similar study on girls(with normal occlusion and 18.2±1.1 years old linear measurements were generally greater in boys. Therefore it is important to consider the ethnic and racial variations in our ideal treatment plan.

  13. Employers' readiness for the mother-friendly workplace: an elicitation study.

    Bai, Yeon K; Wunderlich, Shahla M; Weinstock, Marni

    2012-10-01

    Currently over half of mothers of infants under 1-year-old are in the workforce in the United States. These women face challenges to continue breastfeeding when they return to work 3 to 6 months post-partum. This study explored the perspectives of employers on mother-friendly environments to assess their readiness to provide breastfeeding accommodation using the elicitation under the theory of planned behaviour. Researchers conducted phone/in-person interviews with a convenient sample of 20 human resource managers from companies that had 500 or more employees in the New York metropolitan area in 2009. Content analyses identified the common concepts that represent underlying beliefs of the constructs of the theory. The demography of the participants is 40% male and 80% White, with mean ages of 34.3±8.5 years. 'Happy employees' and 'high retention rate and improved loyalty' were the most frequently mentioned (95%) benefits to the company (behavioural beliefs). Supporters of a mother-friendly environment (normative beliefs) in the workplace included 'mothers and expectant mothers (70%)', and 'managers supervising women and new mothers (55%)'. Most frequently mentioned company drawbacks (control beliefs) were 'not cost effective (65%)' and 'time consuming (65%)', followed by 'perception of special favours for some (50%)'. Workplace breastfeeding promotion efforts can be successful by reinforcing positive beliefs and addressing the challenges associated with implementation of breastfeeding accommodation through education and other incentives such as recognition of model companies and tax breaks. The identified beliefs provide a basis for the development of a quantitative instrument to study workplace breastfeeding support further. PMID:21978139

  14. A Method for Prediction of Graft Incompatibility in Sweet Cherry

    S. Filiz GUCLU

    2012-05-01

    Full Text Available This study was carried out on 1-year old trees of ‘0900 Ziraat’ variety grafted onto ‘Kuş kirazi’, ‘Kara idris’, ‘Sari idris’, ‘MaxMa 14’, ‘MaxMa 60’ and ‘Gisela 5’ in order to determine their compatibility. For this purpose, total peroxidase activity was determined by spectrophotomery assay. Taking ground tissue samples were planned three times as before the grafting (beginning, and then 8 and 12 months after grafting. Total peroxidase activities of rootstocks before grafting varied between 10.80 ΔAg.min. (‘Kuş kirazi’ and 7.83 ΔAg.min. (‘Kara idris’ and were found to be statistically important. The peroxidase activity of ‘0900 Ziraat’ was 11.07ΔAg.min. and the closest value occurred in Prunus avium rootstock. The most different values occurred in rootstocks of ‘Kara idris’ and ‘Gisela 5’. The results showed that peroxidase activity increased in rootstock and graft scion. This increase had higher values in heterogenetic combinations especially in ‘0900 Ziraat’/‘Gisela 5’ and ‘0900 Ziraat’/‘Kara idris’ grafts. Peroxidase activity was decreased at the 12th month for all combinations. The highest value was obtained from ‘0900 Ziraat’/‘MaxMa 14’ combinaion with 29.17 ΔAg.min. while lowest one was ‘0900 Ziraat’/‘Kuş kirazi’ with 17.39. The findings showed that peroxidase activity could be used as a parameter in early determination of graft incompatibility.

  15. Effect of MTA-based sealer on the healing of periapical lesions

    Joao Eduardo GOMES-FILHO

    2013-06-01

    Full Text Available Some manufacturers have recently added specific components to improve the ease of handling and insertion material properties of MTA in order to create MTA-based sealers. Objective The aim of this study was to evaluate the healing of periapical lesions in canine teeth after a single session of endodontic treatment with MTA Fillapex® compared with Sealapex® or Endo-CPM-Sealer®. Material and Methods Sixty-two root canals were performed on two 1-year-old male dogs. After coronal access and pulp extirpation, the canals were exposed to the oral cavity for 6 months in order to induce periapical lesions. The root canals were prepared, irrigated with a solution of 2.5% sodium hypochlorite and filled with gutta-percha and different sealers, according to the following groups: 1 Sealapex®; 2 Endo-CPM-Sealer®; and 3 MTA Fillapex®. Some teeth with periapical lesions were left untreated for use as positive controls. Healthy teeth were used as negative controls. After 6 months, the animals were sacrificed and serial sections from the roots were prepared for histomorphologic analysis and stained with hematoxylin and eosin and the Brown and Brenn technique. The lesions were scored according to pre-established histomorphologic parameters and the scores statistically analyzed using the Kruskal-Wallis test. Results All 3 materials produced similar patterns of healing (p>0.05; in particular, persistent inflammation and absence of complete periapical tissue healing were consistently noted. Conclusions Preparation of the infected root canals followed by filling with the materials studied was insufficient to provide complete healing of the periapical tissues.

  16. Henry S. Kaplan Distinguished Scientist Award 2003. The crooked shall be made straight; dose-response relationships for carcinogenesis.

    Hall, E J

    2004-05-01

    Estimates of radiation-induced malignancies come principally from the atomic (A)-bomb survivors and show an excess incidence of carcinomas that is linearly related to dose from about 5 cGy to 2.5 Gy. Above and below this dose range there is considerable uncertainty about the shape of the dose-response relationship. Both the International Commission of Radiation Protected (ICRP) and the National Council of Radiation Protection (NCRP) suggest that cancer risks at doses lower than those at which direct epidemiological observations are possible should be obtained by a linear extrapolation from higher doses. The demonstrated bystander effect for irradiation exaggerates the consequences of small doses of radiation and implies that a linear extrapolation from high doses would underestimate low dose risks. It is possible to make estimates of the cancer risk of diagnostic radiological procedures. Helical computed tomography in children is of particular interest since it is rapidly increasing in use and the doses involved are close to the lower limit of significance in the A-bomb survivors. For example, an abdominal computed tomographic scan in a 1-year-old child can be estimated to result in a lifetime cancer risk of about 1:1000. In the context of radiotherapy, some normal tissues receive 70 Gy, while a larger volume receives a lower dose, but still far higher than the range for which data are available from the A-bomb survivors. Data are available for the risk of radiation-induced malignancies for patients who received radiotherapy, e.g. for prostate or cervical cancer. New technologies such as intensity modulated radiation therapy could result in a doubling of radiation-induced second cancers since the technique involves a larger total-body dose due to leakage radiation and the dose distribution obtained involves a larger volume of normal tissue exposed to lower radiation doses. PMID:15223765

  17. [Litter decomposition of dominant plantations in Guangxi and its effects on leachate quality].

    Yang, Gai-Ren; Zhang, Xiu-Qing; Cai, De-Suo; Shi, Xian-Hui; Zhang, Hua; Huang, Cheng-Biao

    2012-01-01

    To understand the decomposition characteristics of the litters in different forest plantations and the effects of released substances during litter decomposition on the leachate quality, litter samples (leaf, shoot, and cortices) were collected from five forest plantations (1 year-old Eucalyptus urophylla x E. grandis, EU1; 4 year-old Eucalyptus urophylla x E. grandis, EU4; 7 year-old Acacia mangium x A. auriculaef, AM; 13 year-old Pinus massoniana Lamb, PL; and mixed broad-leaved softwood, BL), and incubated at 28 degrees C, using water leached for 255 days. In the first 105 days, the litter leachates of EU1 and EU4 had significantly higher coloration and N and P contents and lower pH than those of AM, PL, and BL. On the 255th day, the cumulative chemical oxygen demand (COD) in the leaf litters leachates of EU1 and EU4 was 193.9 and 212.8 g x kg(-1), being 4.2, 4.0, and 4.3 times and 5.3, 4.4, and 4.7 times higher than that of AM, PL, and BL, respectively. The mass loss rate and the N and P leaching rate of the leaf litter of EU1 were significantly higher than those of AM, PL, and BL. The mass loss rate of cortices of EU1 was significantly higher than that of PL. No significant difference was observed for the leaching rate of the shoot litters between AM, PL, and BL. Among the litter samples, leaf litter was easiest to be decomposed, while shoot litter was most difficult to be decomposed. The pH value of the litter leachates of Eucalyptus plantations was significantly negatively correlated with leachate chroma and COD, and the COD had significant positive correlations with the concentrations of total N and P in the leachates. PMID:22489473

  18. Balance, gait, functionality and strength: comparison between elderly fallers and non-fallers

    Elaine C. Cebolla

    2015-04-01

    Full Text Available BACKGROUND: Accidental falls are a major health problem related to aging and affect one in every three elderly individuals over the age of sixty. OBJECTIVE: To evaluate and compare the muscle strength, gait kinematics parameters, and performance in functional tests between elderly subjects with and without a prior history of falls. In addition, the association between the history of falls and the variables that demonstrated differences between groups were tested. METHOD: 62 elderly subjects participated in the study and were allocated to the group with falls history (FG; n=20; 68.0±6.9 years old or the group without falls history (CG; n=42; 65.5±4.1 years old. Maximal strength, gait kinematics parameters, and functional tests were tested. RESULTS: The FG showed lower muscle strength in the knee flexors (51.45±8.6 vs. 62.09±19 Kg, lower average toe clearance during the swing phase (0.04±0.006 vs. 0.043 ± 0.005 m, and lower performance in the "8-foot up-and-go" test (5.3±0.7 vs. 5.8±0.7 s (p<0.05. There were no associations between any variables and falls, but the increased time in the "8-foot up-and-go" test may double the likelihood of a fall occurring. CONCLUSION: Fallers have reduced lower limb strength, gait alterations, the worst performance in the dynamic balance test, and an increased risk of falls.

  19. The influence of seedling density in containers on morphological characteristics of European beech

    Wrzesiński Piotr

    2015-09-01

    Full Text Available This study examines the influence on growth parameters, in particular the morphological features of the root system, of 1-year-old European beech seedlings cultivated in containers with two different densities. The experiment was conducted in the container nursery in Skierdy (Forest District of Jabłonna in spring 2011. After 10 months of cultivation in Hiko polyethylene containers, above- and below-ground parts of the seedlings were measured. The measurements of the root system were conducted with a scanner and the WinRHIZO software. No influence due to the seedling density on either shoot height or thickness was observed, but instead the research showed that different seedling densities affected the development of root systems. The mean root thickness and dry mass of the European beech seedlings were significantly higher at the lower density. The influence of seedling density on the development of root mass deserves special attention as it is the most important factor affecting future growth of the seedlings during cultivation. This tendency also suggests that the amount of nutrients allocated to shoot development may be higher in order to improve the efficiency of photosynthesis. At both densities, differences in biomass accumulation affected the root-toshoot ratio. In seedlings cultivated at the lower density, the increased dry root matter of the seedlings resulted in a significant increase in the root-to-shoot ratio. This may cause a potential growth advantage of these seedlings after they are planted and may thus result in a more productive cultivation.

  20. A Comparison of the Contact Force Distributions on the Acetabular Surface Due to Orthopedic Treatments for Developmental Hip Dysplasia.

    Márquez-Flórez, Kalenia M; Silva, Octavio; Narváez-Tovar, Carlos A; Garzón-Alvarado, Diego A

    2016-07-01

    We used a three-dimensional rigid body spring model (RBSM) to compare the contact force distributions on the acetabular surface of the infant hip joint that are produced by three orthopedic treatments for developmental dysplasia of the hip (DDH). We analyzed treatments using a Pavlik harness, a generic rigid splint, and a spica cast. The joint geometry was modeled from tomography images of a 1-year-old female. The articular cartilage was modeled as linear springs connecting the surfaces of the acetabulum and the femoral head, whereas the femur and the hip bone were considered as rigid bodies. The hip muscles were modeled as tensile-only preloaded springs. The treatments with the Pavlik harness and the generic rigid splint were modeled for an infant in supine position with a hip flexion angle of 90 deg. Also, since rigid splints are often recommended when children are initiating their gait phase, we modeled the treatment with the infant in standing position. For the spica cast, we only considered the infant in standing position with a flexion angle of 0 deg, and the fixation bar at two heights: at the ankle and at the knee. In order to analyze the effect of the hip abduction angle over the contact force distribution, different abduction angles were used for all the treatments modeled. We have found that the treatments with the infant in supine position, with a flexion angle of 90 deg and abduction angles between 60 deg and 80 deg, produce a more homogenous contact force distribution compared to those obtained for the treatments with the infant in standing position. PMID:27150210